Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17182gna 1ON68568534000.0
Kwal_56.23599na 1ON6486686822e-79
AGR094Wna 1ON1381364341e-49
Ecym_4314na 2ON9301524711e-48
KLTH0G13816gna 1ON6551604341e-44
KLLA0F18997gna 1ON4001493663e-37
AGR093Wna 2ON6131843213e-30
Kwal_23.55935.277ON3501461261e-06
SAKL0G10912g5.277ON337841223e-06
KLTH0G06908g5.277ON3611241171e-05
AER235C5.277ON324831091e-04
Ecym_73645.277ON330831072e-04
TDEL0E034905.277ON34591950.007
NDAI0D015805.277ON299104920.013
KLLA0F21824g5.277ON27692900.024
NCAS0A066405.277ON270115840.11
CAGL0M09636g2.360ON24949714.2
KAFR0D050205.277ON25784714.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17182g
         (685 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some...  1314   0.0  
Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {...   267   2e-79
AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No...   171   1e-49
Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar t...   186   1e-48
KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON} cons...   171   1e-44
KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]...   145   3e-37
AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; N...   128   3e-30
Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa] ...    53   1e-06
SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conser...    52   3e-06
KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conser...    50   1e-05
AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON} ...    47   1e-04
Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON} ...    46   2e-04
TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277     41   0.007
NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277      40   0.013
KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa] ...    39   0.024
NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5....    37   0.11 
CAGL0M09636g Chr13 (956604..957353) [750 bp, 249 aa] {ON} simila...    32   4.2  
KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277      32   4.6  

>SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some
           similarities with uniprot|Q74ZV5 Ashbya gossypii AGR094W
           AGR094Wp
          Length = 685

 Score = 1314 bits (3400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/685 (93%), Positives = 643/685 (93%)

Query: 1   MNHDFQNVALSRTGTPVNSETVNLQESPSSMGMRNGHAETSSEESNNGDGQVDSALWLLR 60
           MNHDFQNVALSRTGTPVNSETVNLQESPSSMGMRNGHAETSSEESNNGDGQVDSALWLLR
Sbjct: 1   MNHDFQNVALSRTGTPVNSETVNLQESPSSMGMRNGHAETSSEESNNGDGQVDSALWLLR 60

Query: 61  DILQSVLTKIRNQKNLYQFYTTAREQCLSYSQSPGHVSVDPDSIFKNLMAYPTEVLSAIY 120
           DILQSVLTKIRNQKNLYQFYTTAREQCLSYSQSPGHVSVDPDSIFKNLMAYPTEVLSAIY
Sbjct: 61  DILQSVLTKIRNQKNLYQFYTTAREQCLSYSQSPGHVSVDPDSIFKNLMAYPTEVLSAIY 120

Query: 121 IPVTIRFLDWANATHRIPAQCTSGRGIVTSKRCLGFLKDDSNVLSHTSGTAQRIVEGLKL 180
           IPVTIRFLDWANATHRIPAQCTSGRGIVTSKRCLGFLKDDSNVLSHTSGTAQRIVEGLKL
Sbjct: 121 IPVTIRFLDWANATHRIPAQCTSGRGIVTSKRCLGFLKDDSNVLSHTSGTAQRIVEGLKL 180

Query: 181 LQRLQMIIFPEKPVFYNDPGDDQALNSVWQPLESREVYEFLESLSSHRNELEMXXXXXXX 240
           LQRLQMIIFPEKPVFYNDPGDDQALNSVWQPLESREVYEFLESLSSHRNELEM       
Sbjct: 181 LQRLQMIIFPEKPVFYNDPGDDQALNSVWQPLESREVYEFLESLSSHRNELEMSPTSPSS 240

Query: 241 XXXXXXXXXXXRRGNLYPQLAPSPHATSLPPNVPMPSLAFEPLHPSSITDQRDADLLNPH 300
                      RRGNLYPQLAPSPHATSLPPNVPMPSLAFEPLHPSSITDQRDADLLNPH
Sbjct: 241 TTSMNPRSSISRRGNLYPQLAPSPHATSLPPNVPMPSLAFEPLHPSSITDQRDADLLNPH 300

Query: 301 VTFPSQQTLTNSDLDMKLAPIFNQIIPDMEQRLHYLALENKSLREQNMVLLQNVSSLESQ 360
           VTFPSQQTLTNSDLDMKLAPIFNQIIPDMEQRLHYLALENKSLREQNMVLLQNVSSLESQ
Sbjct: 301 VTFPSQQTLTNSDLDMKLAPIFNQIIPDMEQRLHYLALENKSLREQNMVLLQNVSSLESQ 360

Query: 361 IAQLQNFVSVVVSKPTGATSLSLQPQEPRQARKKIGKVKQQRTSPTQMSATPNQAPLAQI 420
           IAQLQNFVSVVVSKPTGATSLSLQPQEPRQARKKIGKVKQQRTSPTQMSATPNQAPLAQI
Sbjct: 361 IAQLQNFVSVVVSKPTGATSLSLQPQEPRQARKKIGKVKQQRTSPTQMSATPNQAPLAQI 420

Query: 421 DQIVPKQPPTLNTASSNLHNLQFSNSTDHRMSEYDTMLHSYDPLMVRSSELGRSSNGLTN 480
           DQIVPKQPPTLNTASSNLHNLQFSNSTDHRMSEYDTMLHSYDPLMVRSSELGRSSNGLTN
Sbjct: 421 DQIVPKQPPTLNTASSNLHNLQFSNSTDHRMSEYDTMLHSYDPLMVRSSELGRSSNGLTN 480

Query: 481 STQEPTFELHSANPLIIQEGQSRILSYQNTPDPXXXXXXXXXXXXYTESKKARPKYKDTP 540
           STQEPTFELHSANPLIIQEGQSRILSYQNTPDP            YTESKKARPKYKDTP
Sbjct: 481 STQEPTFELHSANPLIIQEGQSRILSYQNTPDPQLRSTLQQQQLRYTESKKARPKYKDTP 540

Query: 541 GSQLSKGKTYHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVK 600
           GSQLSKGKTYHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVK
Sbjct: 541 GSQLSKGKTYHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVK 600

Query: 601 DFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACN 660
           DFGKSRLV            AFVYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACN
Sbjct: 601 DFGKSRLVQFKKKRTFQKKKAFVYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACN 660

Query: 661 NLNLLKDMLVKHRPDLRDTVFSDTE 685
           NLNLLKDMLVKHRPDLRDTVFSDTE
Sbjct: 661 NLNLLKDMLVKHRPDLRDTVFSDTE 685

>Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {ON}
           [contig 176] FULL
          Length = 648

 Score =  267 bits (682), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 194/668 (29%), Positives = 323/668 (48%), Gaps = 90/668 (13%)

Query: 41  SSEESNNGDGQVDSALWLLRDILQSVLTKIRNQKNLYQFYTTAREQCLSYSQSPGHVSVD 100
           SS   +N    V+S L++L+D+L ++L   RN   L   Y  A+ +C  +   P  +SV+
Sbjct: 48  SSMRQHNQAQHVESTLFVLQDVLWNLLVHFRNHGTLQASYEMAKHRCEGHY--PSILSVE 105

Query: 101 PDSIFKNLMAYPTEVLSAIYIPVTIRFLDWANATHRIPAQCTSGRGIVTSKRCLGFLKDD 160
              IFK LM YP E+LSAIY+P+ +RF  W+ +  +   +    R I+T+KR + FL  +
Sbjct: 106 --CIFKVLMDYPAELLSAIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAFLVAN 163

Query: 161 SNVLSHTSGTAQRIVEGLKLLQRLQMIIFPEKPVFYNDPGDDQALNSVWQPLESREVYEF 220
            +  S+ + T  +  + LKLLQ L+M + P+KPV  +D  D++A++  W PL S ++   
Sbjct: 164 FHEFSYNAATLYQASQSLKLLQSLEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQLESL 223

Query: 221 LESLSSHRNELEMXXXXXXXXXXXXXXXXXXRRGNLYPQLAPSPHATSLPPNVPMPSLAF 280
           ++SL+   + L                        + P++AP+  +  LP   P  S   
Sbjct: 224 IKSLTKDASTL-----------------PQVESAPVLPEIAPASISEFLPFTRPSQS--- 263

Query: 281 EPLHPSSITDQRD----------------ADLLNPHVTFPS---QQTLTNSDLDMKLAPI 321
            P++ S +T  +                 +DL  P  T PS    ++L++   D     +
Sbjct: 264 PPMNMSYVTALQHQPTVYGVQQVPIPSAFSDLPEPFTTLPSGHSNESLSHQSSDK----L 319

Query: 322 FNQIIPDMEQRLHYLALENKSLREQNMVLLQNVSSLESQIAQLQNFVSVVVSKPTGATSL 381
           F+Q  P++  R++ L + N+ L + N  L +++  L+SQ+  L+  V           + 
Sbjct: 320 FSQTFPNIFHRINALEVANERLTQDNDALFKDMEKLKSQLQNLEKSVE----------NT 369

Query: 382 SLQPQEPRQARKKIGKVKQQRTSPTQM-SATPNQAPLAQIDQIVPKQPPTLNTASSNLHN 440
           SLQ              +Q  TSP  + +  P+ A     + +VP   P + T+   +  
Sbjct: 370 SLQ--------------RQNVTSPKVVHTGFPSSA---SANVVVPSSYP-METSDLAISG 411

Query: 441 LQFSNS-TDHRMSEYDTMLHSYDPLMVRSSELGRSSNGLTNSTQE--PTFELHSANPLII 497
           ++     +   +++   +   Y+ LM                T E  P   L  A   I 
Sbjct: 412 VKLEGDLSSQPVNQAQQLATGYESLM-----------PFNPGTSEFIPDTRLRGAGQFIH 460

Query: 498 QEGQSRILSYQNTPDPXXXXXXXXXXXXYTESKKARPKYKDTPGSQLSKGKTYHPPVSIT 557
            E  S I S  ++               ++ +KK +P   +  G++L+KG+TYHPP +  
Sbjct: 461 GETMSTISSRGDSIASTSPVGLLATSDFHSPAKKPKPVSYNYEGAKLTKGETYHPPQAPD 520

Query: 558 GKNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXX 617
           GK YL+DE+G+LAIVM+  Q S+Y +YNE+YQSL+PQV+++ +D+GK  +          
Sbjct: 521 GKRYLLDEEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQ 580

Query: 618 XXXAFVYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACNNLNLLKDMLVKHRPDLR 677
              AFV   E+++ +  +P E VL +ID +R RE+KSVVWACNNL   +  L  + P+L+
Sbjct: 581 KKKAFVQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYNPELK 640

Query: 678 DTVFSDTE 685
           D   SD E
Sbjct: 641 DRGLSDVE 648

>AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No
           homolog in Saccharomyces cerevisiae
          Length = 138

 Score =  171 bits (434), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/136 (61%), Positives = 99/136 (72%)

Query: 550 YHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVKDFGKSRLVX 609
           Y PP++  GKNYLVD++G+ +I+MSNDQDSIYSIYNEFYQSLK QVE+FV+DFGKS+LV 
Sbjct: 3   YQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVQ 62

Query: 610 XXXXXXXXXXXAFVYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACNNLNLLKDML 669
                      AFVYL EKIAY   +  E VL I D +R +EEKSVVW CNNL  LK  L
Sbjct: 63  FRKKRTFQKKKAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKCAL 122

Query: 670 VKHRPDLRDTVFSDTE 685
           VK+RPDL D + SD +
Sbjct: 123 VKYRPDLHDIIMSDPD 138

>Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar to
           Ashbya gossypii AGR093W +AGR094W
          Length = 930

 Score =  186 bits (471), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 86/152 (56%), Positives = 109/152 (71%)

Query: 530 KKARPKYKDTPGSQLSKGKTYHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQ 589
           KK R +YK++ GS+LSKG  Y PP++  GK Y++ EDG+ +IVMS+DQDSIYSIYNEFYQ
Sbjct: 775 KKLRSRYKESSGSKLSKGVQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQ 834

Query: 590 SLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVETVLGIIDQIRH 649
           SLK QV+SFV+D+GKS+L             AFVYL EKI+Y   +P E VL I+D +R 
Sbjct: 835 SLKLQVDSFVQDYGKSKLTQFRKKRTFQKKKAFVYLVEKISYFSKLPPEQVLDIVDDVRI 894

Query: 650 REEKSVVWACNNLNLLKDMLVKHRPDLRDTVF 681
           +E KSVVW CNNL  LK  LVK+RP L+D + 
Sbjct: 895 KEGKSVVWVCNNLGSLKYALVKYRPKLKDIIM 926

 Score =  156 bits (395), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 110/170 (64%), Gaps = 1/170 (0%)

Query: 55  ALWLLRDILQSVLTKIRNQKNLYQFYTTAREQCLSYSQSPGHVSVDPDSIFKNLMAYPTE 114
            L+    +L ++L +IRN ++LYQFYT  +EQCLSY+Q   +V +D D++FK LM+   E
Sbjct: 11  VLYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDALFKLLMSSTPE 70

Query: 115 VLSAIYIPVTIRFLDWANATHRIPAQCTSGRGIVTSKRCLGFLKDDSNVLSHTSGTAQRI 174
           +L+ + +P  +RF++W+  T  I +     R I+T  RCL FLK+D +   H+S T + I
Sbjct: 71  LLNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAFKHSSETCKGI 130

Query: 175 VEGLKLLQRLQMIIFPEKPVFYNDPGDDQALNSVWQPLESREVYEFLESL 224
           +  LKLLQ+LQMI+F EKP+  ND  D  + + VW+PL++    +FL SL
Sbjct: 131 LGALKLLQKLQMIMFAEKPML-NDTNDPDSESVVWKPLDTAIAIQFLNSL 179

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 35/51 (68%)

Query: 321 IFNQIIPDMEQRLHYLALENKSLREQNMVLLQNVSSLESQIAQLQNFVSVV 371
           +F Q IP++ QRLH+L ++N  L++Q+ +L+Q +++L   +  LQ  V+ +
Sbjct: 513 LFQQGIPEINQRLHHLTVQNNKLKQQDTILMQQINNLRQIVTSLQKTVTSI 563

>KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON}
           conserved hypothetical protein
          Length = 655

 Score =  171 bits (434), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 111/160 (69%), Gaps = 2/160 (1%)

Query: 528 ESKKARPKYKD--TPGSQLSKGKTYHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYN 585
           +S   RPK+++    G++LSKG+TY PP +  GKNYL+D +GRLAIVM+ +Q S+Y +YN
Sbjct: 496 QSPAKRPKHRNRRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLAIVMATEQSSVYGVYN 555

Query: 586 EFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVETVLGIID 645
           E+YQSL+PQV+S+  DFGK  +             AFV   E+I+ + NMP E VL I+D
Sbjct: 556 EYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPELVLDIVD 615

Query: 646 QIRHREEKSVVWACNNLNLLKDMLVKHRPDLRDTVFSDTE 685
           ++R +E+KSVVWACNNL   + +L +++PDL+DT  SD E
Sbjct: 616 EVRLKEKKSVVWACNNLGRFRLVLNRYKPDLKDTALSDVE 655

 Score =  126 bits (316), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 113/199 (56%), Gaps = 4/199 (2%)

Query: 27  SPSSMGMRNGHAETSSEESNNGDGQVDSALWLLRDILQSVLTKIRNQKNLYQFYTTAREQ 86
           +PS   + +      S ++      VDS L LL+D+L +VL  IR        Y+ A+ +
Sbjct: 41  APSGQSLSDSPGTRRSSQAAELTNSVDSTLNLLQDVLWNVLVHIRGHGTFESCYSLAKRR 100

Query: 87  CLSYSQSPGHVSVDPDSIFKNLMAYPTEVLSAIYIPVTIRFLDWANATHRIPAQCTSGRG 146
             ++ QS   VSV+   IFK L  YP E+LSA+YIPV +RF  W ++  ++P +    R 
Sbjct: 101 YEAHYQS--LVSVE--CIFKTLANYPAEILSAMYIPVILRFFKWCSSVRQLPPEFKGSRF 156

Query: 147 IVTSKRCLGFLKDDSNVLSHTSGTAQRIVEGLKLLQRLQMIIFPEKPVFYNDPGDDQALN 206
           ++T+K+ + FL  + +  S+ + T  +    LKLLQ L++ +FP+KP  Y+DP D++A +
Sbjct: 157 LITTKKGITFLMTNLSECSYNAATLYQAFRALKLLQSLEIALFPQKPALYHDPEDEEADD 216

Query: 207 SVWQPLESREVYEFLESLS 225
             W+PL+  ++   + S++
Sbjct: 217 PNWKPLDDSQLEVLISSVT 235

>KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]
           {ON} some similarities with uniprot|Q74ZV5 Ashbya
           gossypii AGR094W AGR094Wp
          Length = 400

 Score =  145 bits (366), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 95/149 (63%), Gaps = 1/149 (0%)

Query: 529 SKKARPKYKDTPG-SQLSKGKTYHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYNEF 587
           +K+A+  +    G + +SKG+ + PP+S  GKNYLV +DG L+IVM ND DS+YSIYNEF
Sbjct: 250 NKQAKTMHAKKIGVASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLDSVYSIYNEF 309

Query: 588 YQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVETVLGIIDQI 647
            QSLKPQ++SFV+D G+S+L             AF    E I    +   E +L IID I
Sbjct: 310 MQSLKPQIDSFVQDHGRSKLAKFQKKRTFQKRKAFCSFVETIVNSTSFTSEEILDIIDGI 369

Query: 648 RHREEKSVVWACNNLNLLKDMLVKHRPDL 676
           R + + SV+W CNNLN LK  L+K RPDL
Sbjct: 370 RAQNDHSVIWVCNNLNQLKMDLLKQRPDL 398

>AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; No
           homolog in Saccharomyces cerevisiae
          Length = 613

 Score =  128 bits (321), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 109/184 (59%), Gaps = 3/184 (1%)

Query: 41  SSEESNNGDGQVDSALWLLRDILQSVLTKIRNQKNLYQFYTTAREQCLSYSQSPGHVSVD 100
           S  +     G ++  L +++ +++S+L ++R Q++LYQ YT  +EQCLS+SQ      +D
Sbjct: 5   SGADERGTSGHIEGRLLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPGGGID 64

Query: 101 PDSIFKNLMAYPTEVLSAIYIPVTIRFLDWANATHRIPAQCTSGRGIVTSKRCLGFLKDD 160
            DS+F+ LM    E+L  + +P  +RF +WA  T  I A+ T  R ++T  RC  FLK+D
Sbjct: 65  VDSMFELLMMRTPELLGLVSLPAMVRFFEWAQRTETIAAETT--RAVITPTRCYNFLKED 122

Query: 161 SNVLSHTSGTAQRIVEGLKLLQRLQMIIFPEKPVFYNDPGDDQALNSVWQPLESREVYEF 220
               +H +     + E L+LLQ+LQMI+F EKP+ + D  D  + + +W+PL+S    + 
Sbjct: 123 VGTFAHGAEVVGGVFEALQLLQQLQMIVFREKPMLH-DRNDPDSASPMWKPLDSPTTLQL 181

Query: 221 LESL 224
           L SL
Sbjct: 182 LHSL 185

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 121/241 (50%), Gaps = 32/241 (13%)

Query: 282 PLHPSSITDQRDADLLNPHV---TFPSQQTLTNSDLDMKLAPIFNQIIPDMEQRLHYLAL 338
           PL  SS ++++   L  P     T P Q    N D     +P+F Q IPD+ QR+++L L
Sbjct: 364 PLQKSSTSNRQTVPLQQPQSASSTTPVQYYYPNYDSACS-SPLFQQSIPDINQRIYHLTL 422

Query: 339 ENKSLREQNMVLLQNVSSLESQIAQLQNFVSVVVSKPTGATSLSLQPQEPRQARKKIGKV 398
           EN  L++Q+ VL+Q+++SL+  ++ LQ  V+  +S  TG T +          + K+ K+
Sbjct: 423 ENNKLKQQDTVLMQHINSLKQLVSSLQKTVT-SMSLATGTTPV----------KGKVTKL 471

Query: 399 KQQRTSPTQMSATPNQAPLAQIDQIVPKQPPTLNTASSNLHNLQFSNSTDHRMSEYDTML 458
           K+   +    S   N++  + +  I       LN + SN      +N+ D  +   D +L
Sbjct: 472 KRSAATTPIRSTFINESNNSSMTSI----SGALNYSESNT-----ANAADDEL--VDPLL 520

Query: 459 HSYDPLMVRSSEL--GRSSNGLTNSTQEPTFELHS--ANPL--IIQEGQSRILSYQNTPD 512
            +Y+P ++++ +    RS+N   +S+ +    + S   +PL  I ++  S +LSYQ  P 
Sbjct: 521 ENYEPFILKTEQRQQSRSANHEPSSSSQGMQSVLSFQNDPLFDIPRDDTSSLLSYQTVPV 580

Query: 513 P 513
           P
Sbjct: 581 P 581

>Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa]
           {ON} [contig 11] FULL
          Length = 350

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 65/146 (44%), Gaps = 13/146 (8%)

Query: 529 SKKARPKYKDTPGSQLSKGKTYHPPV---------SITGK-NYLVD--EDGRLAIVMSND 576
           S++    Y DTP S+L + +   P V         + T K  YL D  +     + MSN 
Sbjct: 198 SRRRDELYTDTP-SKLPRVRAPAPAVCSPWEKQNATDTKKLQYLKDWVDISEFTLQMSNQ 256

Query: 577 QDSIYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMP 636
             +++++Y+EF  SL PQ+  + K +GK +              A V   +K +     P
Sbjct: 257 PTTVFALYSEFETSLGPQMLEYEKRYGKGQSSRLPRIRTFQRRRALVSEIDKFSRRTGRP 316

Query: 637 VETVLGIIDQIRHREEKSVVWACNNL 662
           +E  +   + IR R  +SV W  NNL
Sbjct: 317 IEEAIAYFELIRTRNRRSVAWLYNNL 342

>SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conserved
           hypothetical protein
          Length = 337

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 39/84 (46%)

Query: 579 SIYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVE 638
           S+  +Y+EF  SLK Q+  F K FGK +L             A V   +K A   N   E
Sbjct: 245 SVAELYDEFDNSLKLQILEFEKKFGKGQLSRIPKIRTYQRRRALVSEIDKYARFTNKSTE 304

Query: 639 TVLGIIDQIRHREEKSVVWACNNL 662
             +   + IR+ + K+V W  NNL
Sbjct: 305 DAIHFFENIRNEKNKTVAWLYNNL 328

>KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conserved
           hypothetical protein
          Length = 361

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 5/124 (4%)

Query: 542 SQLSKGKTYHPPVSITGKNYLVDEDGRLAIV--MSNDQDSIYSIYNEFYQSLKPQVESFV 599
           S L  G+T   P S     Y  D     A V  MS +  ++  +Y E+   L+PQ+  F 
Sbjct: 234 SLLKSGQT---PCSSRHLRYAKDAKDISAYVLKMSGNPKTVGDMYYEYEHQLRPQILEFE 290

Query: 600 KDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWAC 659
           K +GK ++             A +   EK A  +   +E  +   ++IR + +K+V W  
Sbjct: 291 KRYGKGQISRLPKVRTYQRRRALINEIEKFARREGKSIEEAVQYFEEIRTQNKKTVPWLY 350

Query: 660 NNLN 663
           NNLN
Sbjct: 351 NNLN 354

>AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON}
           NOHBY524; No homolog in Saccharomyces cerevisiae'
          Length = 324

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 36/83 (43%)

Query: 580 IYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVET 639
           +  +Y EF  SLK Q+  F K +GK +L             A V   ++ A   N   E 
Sbjct: 232 VNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEE 291

Query: 640 VLGIIDQIRHREEKSVVWACNNL 662
            +   D IR  + K+V W  NNL
Sbjct: 292 AIQFFDDIRMEKNKTVAWLYNNL 314

>Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON}
           similar to Ashbya gossypii AER235C
          Length = 330

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 36/83 (43%)

Query: 580 IYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVET 639
           +  +Y EF  SLK Q+  F K +GK +L             A V   ++ A   N   E 
Sbjct: 238 VNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEE 297

Query: 640 VLGIIDQIRHREEKSVVWACNNL 662
            +   D IR  + K+V W  NNL
Sbjct: 298 AIQFFDTIRVEKNKTVAWLYNNL 320

>TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277
          Length = 345

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 1/91 (1%)

Query: 579 SIYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVE 638
           S+  +Y+E+  SLK Q+E F + FGK +L             A V   +K A   N    
Sbjct: 247 SVAEVYHEYENSLKSQIEEFERLFGKGQLSKLPKIRTYQRRRALVTEIDKYATSYNKTTH 306

Query: 639 TVLGIIDQIRHREEKSVVWACNNLN-LLKDM 668
             +   +++R  ++++V    NNL  +LK++
Sbjct: 307 EAIEFFEKVRIAKKRTVPGLYNNLGKILKEL 337

>NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277
          Length = 299

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%)

Query: 566 DGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYL 625
           + ++ + M+   +SI  ++ E+   L P+V+   K +GK  L             A V  
Sbjct: 191 NKKIQLAMAVKPNSITELFYEYENVLTPKVKDIQKKYGKKCLKQITNIRTLQRRKALVSE 250

Query: 626 AEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACNNLNLLKDML 669
            +K A      ++  L + + IR +  +SV W  NN++ L D L
Sbjct: 251 IKKFAKQNRKSIKETLEVAEYIRLKNNRSVPWLYNNISHLLDEL 294

>KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa]
           {ON} conserved hypothetical protein
          Length = 276

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%)

Query: 571 IVMSNDQDSIYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIA 630
           ++M++   S++ +Y+EFY   K Q+  F +  G  +L             A V    K A
Sbjct: 174 LIMTDCPKSVHDLYHEFYTDTKLQILHFEEKHGAGQLSKLPKLRTYQRRSALVNAINKYA 233

Query: 631 YMQNMPVETVLGIIDQIRHREEKSVVWACNNL 662
             +N+ VE  +     I    +K++ W  NNL
Sbjct: 234 KGKNITVEQSIEHFQGIVEENDKTIPWLYNNL 265

>NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5.277
          Length = 270

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 49/115 (42%), Gaps = 4/115 (3%)

Query: 559 KNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXX 618
           KN   D+  ++ I +     +I  +  +F   + PQ++   +  GK  L           
Sbjct: 155 KNIACDQRDKIVIDLVEYPSTIKDLVVDFETVVFPQLKYLQRSMGKKALRNIAKLRTVQR 214

Query: 619 XXAFVYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACNN----LNLLKDML 669
             + V     I+ + N+ +E V+ I + IR    KSV W  NN    L  ++D+L
Sbjct: 215 RKSLVRAIHDISTLYNLSLEEVINIFETIRENGGKSVAWMYNNKAHVLQTVQDLL 269

>CAGL0M09636g Chr13 (956604..957353) [750 bp, 249 aa] {ON} similar
           to uniprot|Q03796 Saccharomyces cerevisiae YMR156c
          Length = 249

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 149 TSKRCLGFLKDDSNVLSHTSGTAQRIVEGLKLLQRLQMIIFPEKPVFYN 197
           T+K CL F     N+L H  G    +  G K L+RL +   P+KP  + 
Sbjct: 96  TAKSCLNFTNKIKNLLEHIEG----VENGSKFLERLFIYAAPKKPASFG 140

>KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277
          Length = 257

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 37/84 (44%)

Query: 579 SIYSIYNEFYQSLKPQVESFVKDFGKSRLVXXXXXXXXXXXXAFVYLAEKIAYMQNMPVE 638
           +++ +Y +F   +K  V    + +GKS               A V   +K++   ++ +E
Sbjct: 152 TVHELYYDFQNCVKETVRELKEKYGKSYFRKATNIRSYQRRRALVSEIQKLSEEYDIDIE 211

Query: 639 TVLGIIDQIRHREEKSVVWACNNL 662
             L   +++R    K+V W  +NL
Sbjct: 212 EALQCFEELRKENYKTVPWLYSNL 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,503,090
Number of extensions: 2941393
Number of successful extensions: 9399
Number of sequences better than 10.0: 78
Number of HSP's gapped: 9783
Number of HSP's successfully gapped: 84
Length of query: 685
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 569
Effective length of database: 40,180,143
Effective search space: 22862501367
Effective search space used: 22862501367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)