Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17160g8.257ON73971335620.0
Kwal_56.236078.257ON72570426660.0
TDEL0F038408.257ON72670526240.0
KLTH0G13794g8.257ON72570226160.0
ZYRO0C01782g8.257ON73070824030.0
KLLA0F19041g8.257ON76352623570.0
Suva_2.2698.257ON72570322000.0
YDR109C8.257ON71569521910.0
Smik_4.3558.257ON70470221450.0
Skud_4.3708.257ON71470421430.0
NDAI0J014008.257ON58853018080.0
Kpol_392.98.257ON59452617990.0
Ecym_43138.257ON59752217960.0
NCAS0B038708.257ON59651917430.0
TBLA0E044008.257ON58952217270.0
KAFR0B055608.257ON60552117070.0
CAGL0B01727g8.257ON57752116760.0
KNAG0H032608.257ON58051816380.0
AGR092W8.257ON59652316330.0
TPHA0B032408.257ON58552215200.0
Skud_14.891.111ON5695305032e-54
Suva_14.931.111ON5435314987e-54
Smik_14.861.111ON5435384723e-50
YNL249C (MPA43)1.111ON5425324653e-49
TDEL0C059001.111ON5435494027e-41
ZYRO0F16016g1.111ON5424834027e-41
Kwal_33.135301.111ON5345524019e-41
SAKL0C03432g1.111ON5475313949e-40
KLTH0F03080g1.111ON5335353921e-39
KNAG0F006601.111ON5355353771e-37
KLLA0C02937g1.111ON5165032661e-23
NCAS0A007801.111ON5495221628e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17160g
         (739 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...  1376   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...  1031   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...  1015   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...  1012   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   930   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   912   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   852   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   848   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   830   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   830   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   701   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   697   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   696   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    676   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   669   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   662   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   650   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   635   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   633   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   590   0.0  
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   198   2e-54
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   196   7e-54
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   186   3e-50
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   183   3e-49
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   159   7e-41
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   159   7e-41
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   159   9e-41
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   156   9e-40
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   155   1e-39
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   149   1e-37
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   107   1e-23
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    67   8e-11

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score = 1376 bits (3562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/713 (93%), Positives = 666/713 (93%)

Query: 27  MEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAIC 86
           MEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAIC
Sbjct: 27  MEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAIC 86

Query: 87  YCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRA 146
           YCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRA
Sbjct: 87  YCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRA 146

Query: 147 IDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKAT 206
           IDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKAT
Sbjct: 147 IDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKAT 206

Query: 207 GLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXX 266
           GLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKL           
Sbjct: 207 GLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGG 266

Query: 267 XTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN 326
            TFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN
Sbjct: 267 STFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN 326

Query: 327 EKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGAL 386
           EKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGAL
Sbjct: 327 EKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGAL 386

Query: 387 LAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHG 446
           LAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHG
Sbjct: 387 LAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHG 446

Query: 447 NRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFM 506
           NRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFM
Sbjct: 447 NRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFM 506

Query: 507 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHXXXXXXXXX 566
           SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNH         
Sbjct: 507 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHKSGSLSRRR 566

Query: 567 XXXXXXXYEEFKDSMEIPKKNFLSKLGGTASGDLXXXXXXXXXXXXXXXXXXXVGGFPFP 626
                  YEEFKDSMEIPKKNFLSKLGGTASGDL                   VGGFPFP
Sbjct: 567 KSSLSGKYEEFKDSMEIPKKNFLSKLGGTASGDLPSPYTAPSATASTSQIASTVGGFPFP 626

Query: 627 VTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNMTGG 686
           VTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNMTGG
Sbjct: 627 VTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNMTGG 686

Query: 687 GKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVENQRQTIDPRWP 739
           GKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVENQRQTIDPRWP
Sbjct: 687 GKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVENQRQTIDPRWP 739

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/704 (72%), Positives = 572/704 (81%), Gaps = 9/704 (1%)

Query: 27  MEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAIC 86
           +EQ KM YY+GVDVGTGSARACIID+MGNILSLAERPIQR++LKP++ITQSSQEIW A+C
Sbjct: 27  LEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVC 86

Query: 87  YCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRA 146
           +CVKSVV+DSGV  EKIHGIGFDATCSLVVVE+ S+KEVAVGPDF NT QNIILWMDHRA
Sbjct: 87  HCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRA 146

Query: 147 IDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKAT 206
           I+ET++INAT DKCLKYVGGQMSVEMEIPKIKWLKN+LP  KF++CKFFDLADYLTFKA+
Sbjct: 147 IEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKAS 206

Query: 207 GLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXX 266
           G ETRS+CSTVCKQGLLPVGVE SK+GWS+EFLT IGLED  +DDFRK+           
Sbjct: 207 GKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGK 266

Query: 267 XTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN 326
             FLSAGE +G++DP+ AEELGL  HCVVGSGVIDAYAGWVGTVAARTDV IP LV+ D 
Sbjct: 267 -NFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQ 325

Query: 327 EKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGAL 386
           EK G+D ATGRLAAVAGTSTCHIAMS+DPIFVDGVWGPYRD +A  FWCAEGGQSCTGAL
Sbjct: 326 EKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGAL 385

Query: 387 LAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHG 446
           LAHV+T HPAYTELS L+DAASVSKFDYLNSRLE L QQ+ +RSVV LA+HLFFYGDYHG
Sbjct: 386 LAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHG 445

Query: 447 NRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFM 506
           NRSPIADPSMRAA+IGQSMDNSIDDLA+MYLGACEFIAQQTRQIVEKM+ SGH +AAIFM
Sbjct: 446 NRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFM 505

Query: 507 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHXXXXXXXXX 566
           SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF+L+          
Sbjct: 506 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVSR 565

Query: 567 XXXXXXXYEEFKDSMEIPKKNFLSKLGGTASGDLXXXXXXXXXXXXXXXXXXXVGGFPFP 626
                    +       PKK+ +SKLG   S DL                   V GFPFP
Sbjct: 566 KSSIAGHPTDGSQ----PKKSAVSKLGQFGSDDLPSPYTAPSATASTSQIASTV-GFPFP 620

Query: 627 VTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEK--EKSASGKGDALWDVMYNMT 684
            T DD  A+ E+ +P+  N   S  + KA ++ +  +E   +  +S  GDA+W+VMYNMT
Sbjct: 621 -TPDDPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMT 679

Query: 685 GGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
           GGGKVVQP  +D+PDR LLD KYKIFLDMAETQR+YR  V++VE
Sbjct: 680 GGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/705 (71%), Positives = 563/705 (79%), Gaps = 17/705 (2%)

Query: 29  QNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYC 88
           +  M YYVGVDVGTGSARACIIDN GNILSLAE+PIQR+ELKP+YITQSSQEIW +IC+C
Sbjct: 29  EQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHC 88

Query: 89  VKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAID 148
           VKSVV+DSGV  E+IHGIGFDATCSLVVV DD DKEV VGP F N +QNI+LWMDHRAI 
Sbjct: 89  VKSVVRDSGVPVERIHGIGFDATCSLVVV-DDEDKEVGVGPVFANNDQNIVLWMDHRAIA 147

Query: 149 ETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGL 208
           ET EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLP+E+F+KCKFFDLADYLTFKAT  
Sbjct: 148 ETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNK 207

Query: 209 ETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDF--RKLXXXXXXXXXXX 266
           +TRS+CSTVCKQGL+P+GVE SK+GWSK+FL  I L +L ++ F   +            
Sbjct: 208 DTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTT 267

Query: 267 XTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN 326
            +FLSAGE +G+LD  AAEELGLP HCVVGSGVIDAYAGWVGTVAA+TDV++P+L EAD 
Sbjct: 268 HSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADR 327

Query: 327 EKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGAL 386
            K GID ATGRLAAVAGTSTCHIA+S+DP+FV+GVWGPYRDVMA GFW AEGGQSCTGAL
Sbjct: 328 TKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGAL 387

Query: 387 LAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHG 446
           LAHV++ HPA+TELSHLSDAA++SKFDYLNSRLE L QQRG RSVVALAKHL+FYGDYHG
Sbjct: 388 LAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHG 447

Query: 447 NRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFM 506
           NRSPIADPSMRAA+IGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKM  +GH+I+ IFM
Sbjct: 448 NRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFM 507

Query: 507 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHXXXXXXXXX 566
           SGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASESFN +H         
Sbjct: 508 SGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSEITRRR 567

Query: 567 XXXXXXXYEEFKDSMEIPK---KNFLSKLGGTASGDLXXXXXXXXXXXXXXXXXXXVGGF 623
                       D   +P    K  LS+LG     DL                    G F
Sbjct: 568 KSSLTNL-----DPSSLPSASGKGPLSQLGKMKP-DLPSPYTAPHATSSTSQIAATSGSF 621

Query: 624 PFPVTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNM 683
           PFPV  + S AI EE +  E    +SF   +AT+QE LA    ++    GDALWDVMY M
Sbjct: 622 PFPVVGESSEAITEEANDSE--GPVSFKPTRATSQEGLAT---RNPPNNGDALWDVMYQM 676

Query: 684 TGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
           TGGGKVV+PS +D PDRVLL+AKYKIFLDMA++QRRYREA+DKVE
Sbjct: 677 TGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score = 1012 bits (2616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/702 (71%), Positives = 568/702 (80%), Gaps = 11/702 (1%)

Query: 27  MEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAIC 86
           +EQ KM YYVGVDVGTGSARACIID+MGNILSLAERPIQR++LK ++ITQSSQEIW A+C
Sbjct: 27  LEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVC 86

Query: 87  YCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRA 146
           +CVKSVV+DSGV  EKIHGIGFDATCSLVVVE+ ++KEVAVGPDF NT+QNIILWMDHRA
Sbjct: 87  HCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRA 146

Query: 147 IDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKAT 206
           I+ET+ INAT DKCLKYVGGQMSVEMEIPKIKWLKN+LP  KF +CKFFDLADYLTFKA+
Sbjct: 147 IEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKAS 206

Query: 207 GLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXX 266
           G ETRS+CSTVCKQGLLPVGVE S +GWS+EFLT IGLE+L +DDFR++           
Sbjct: 207 GKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGK 266

Query: 267 XTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN 326
             FLSAGE IG++D + AEELGL  HCVVGSGVIDAYAGWVGTVAARTDV IP LV+ D 
Sbjct: 267 -NFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQ 325

Query: 327 EKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGAL 386
           EK G+D ATGRLAAVAGTSTCHIAMS+DPIFVDGVWGPYRD +A  FWCAEGGQSCTGAL
Sbjct: 326 EKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGAL 385

Query: 387 LAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHG 446
           LAHVLT HPAYTELS L+DAASVSKFDYLNSRLE L QQ+ ARSVV LAKHLFFYGDYHG
Sbjct: 386 LAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHG 445

Query: 447 NRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFM 506
           NRSPIADPSMRAA+IGQSMDNSIDDLA+MYLGACEFIAQQTRQIV+KM  SGH ++AIFM
Sbjct: 446 NRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFM 505

Query: 507 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHXXXXXXXXX 566
           SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF+L+          
Sbjct: 506 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVSR 565

Query: 567 XXXXXXXYEEFKDSMEIPKKNFLSKLGGTASGDLXXXXXXXXXXXXXXXXXXXVGGFPFP 626
                    E  ++ + PKK+ +SK G     DL                   + GFPFP
Sbjct: 566 KSSIAG---EPANAGQ-PKKSAVSKFGQLGGDDLPSPYTAPSATASTSQIASTI-GFPFP 620

Query: 627 VTSDDSVAI---IEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNM 683
            T +D+ AI   +E++  E  +  L+F +     ++     K +S S  GDA+W+VMYNM
Sbjct: 621 -TPEDAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRS-SDNGDAMWNVMYNM 678

Query: 684 TGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVD 725
           TGGGKVVQP+++++ DRVLL+AKYKIFLDMAETQR+YR  VD
Sbjct: 679 TGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/708 (65%), Positives = 536/708 (75%), Gaps = 22/708 (3%)

Query: 29  QNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYC 88
           + +M YY+GVDVGTGSARAC+ID+MGNI+SLAE+PIQR+ELKP+YITQSS+EIW AICYC
Sbjct: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87

Query: 89  VKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAID 148
           VK+VV+DSGV  E+IHGIGFDATCSLV V      +V VGPDF N +QNIILWMDHRA+ 
Sbjct: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147

Query: 149 ETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGL 208
           ET EIN+TN   LKYVGGQMS+EMEIPKIKWLKN++PREKF    FFDLAD+LT+KATGL
Sbjct: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207

Query: 209 ETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXT 268
            TRS+ S+VCKQGLLP+GVE S  GWS EFL  I L +L  +DF KL            +
Sbjct: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267

Query: 269 -FLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNE 327
            FLSAG+ +G+L P AA +LGL  HCVVGSGVIDAYAGWVGTVAA+TD +IPEL + +  
Sbjct: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327

Query: 328 KTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALL 387
           K G+D ATGRLAAVAGTSTCH+A+S+DPIFV GVWGPYRDVMAPGFWCAEGGQSCTGALL
Sbjct: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387

Query: 388 AHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGN 447
           AHVL+ HPAYT+L HLS++A +SKFDYLNSRLE L   R  RSVVALAKHLFFYGDYHGN
Sbjct: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447

Query: 448 RSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMS 507
           RSPIAD +MRAA+IGQSMDNS+DDLA+ YLGACEFIAQQTRQIVE M  SGH I++IFMS
Sbjct: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507

Query: 508 GGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHXXXXXXXXXX 567
           GGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASES+N +H          
Sbjct: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRA 567

Query: 568 XXXXXXYEEFKDSMEIPKKNFLSKLGGTASGDLXXXXXXXXXXXXXXXXXXXVGGFPFPV 627
                  +             L K G +   +L                    GG  FP+
Sbjct: 568 SSLGSKDQAIAG---------LGKGGLSKLSELQTDQPSPYTAPHATSSSHMGGGSYFPI 618

Query: 628 TSDDSV-------AIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVM 680
              D+        AI E +D EE    ++F S K+T QE LA EK  + S  G+ LW VM
Sbjct: 619 VGSDAAANLSPGEAIAETEDEEE---PVTFKSVKSTTQENLA-EKTDTNS-NGEELWKVM 673

Query: 681 YNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
           Y+MTGGGKVV+P+ D +PDRVLL+AKYKIFLDMA TQR+YR A+D+VE
Sbjct: 674 YDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/526 (83%), Positives = 468/526 (88%), Gaps = 6/526 (1%)

Query: 29  QNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYC 88
           + KM YYVGVDVGTGSARAC+IDN+GNILSLAERPIQR ELKP+YITQSSQEIW AICYC
Sbjct: 31  ERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYC 90

Query: 89  VKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAID 148
           VK+VV+DSGV P  IHGIGFDATCSLVVV D+++++V VGPDF +  QNIILWMDHRAI+
Sbjct: 91  VKNVVRDSGVDPRTIHGIGFDATCSLVVV-DNNNEDVGVGPDFTDNLQNIILWMDHRAIE 149

Query: 149 ETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGL 208
           ET+EINAT DKCLKYVGGQMSVEMEIPKIKWLKNN+P +KF +CKFFDLADYLTFKATG 
Sbjct: 150 ETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGS 209

Query: 209 ETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXT 268
           E RSYCSTVCKQGLLP+GVE SK GWSKEFL  IGLE+L  DDF KL            T
Sbjct: 210 EIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET-----T 264

Query: 269 FLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEK 328
           FLSAGECIG+L   +A ELGL  HCVVGSGVIDAYAGWVGTVAARTDV+IP LV++D  K
Sbjct: 265 FLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVK 324

Query: 329 TGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLA 388
            GID ATGRLAAVAGTSTCHIAMSKDPIFV GVWGPYRDVMAPGFW AEGGQSCTGALLA
Sbjct: 325 HGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLA 384

Query: 389 HVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNR 448
           HVLT HPAY ELS LSDAA+VSKFDYLNSRLE+L QQR A SVVALAKHLFFYGDYHGNR
Sbjct: 385 HVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNR 444

Query: 449 SPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSG 508
           SPIADPSMRAA+IGQSMDNSIDDL+IMYLGACEFIAQQTRQIVE+M  SGH +AAIFMSG
Sbjct: 445 SPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSG 504

Query: 509 GQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 554
           GQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN
Sbjct: 505 GQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 550

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 74/115 (64%), Gaps = 6/115 (5%)

Query: 620 VGGFPFPVTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGK------G 673
            GG+PFPV + +  AII+E + E  + +L     K    ++ A       + K       
Sbjct: 649 TGGYPFPVMASNEEAIIDEMEEENEDESLLTFDAKTEKSKEAATSAANHNNAKVLRDVTK 708

Query: 674 DALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
           D LW+VMYNMTGGGKVV P+ +D PDR+LL+AKYKIFLDMA TQ++YR+ VD+V+
Sbjct: 709 DKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/703 (60%), Positives = 512/703 (72%), Gaps = 22/703 (3%)

Query: 27  MEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAIC 86
           ++ ++  ++VGVDVGTGS RACIID  G ILSLAE+PI+R+E++ ++ITQSS+EIW A+C
Sbjct: 36  LQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVC 95

Query: 87  YCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRA 146
           +CVK+V+++S V P+K+HGIGFDATCSLVVV     K +AVGPDF N +QNIILWMDHRA
Sbjct: 96  HCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRA 155

Query: 147 IDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKAT 206
           + ET+EIN+T DKCLKYVGGQMSVEM+IPKIKWLKNNL  E F+ CKFF+L DYLTFKAT
Sbjct: 156 MKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKAT 215

Query: 207 GLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXX 266
           G E RS+ S VCKQG LP GVESSK GWS+EFL +IGL +L  +DF +L           
Sbjct: 216 GKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKK--- 272

Query: 267 XTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN 326
             FLSAGEC+G LD ++A ELGL  HC+VGSG+IDAYAGWVGTVAA+    IP L E ++
Sbjct: 273 -NFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEH 331

Query: 327 EKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGAL 386
           EK  I+ A GRLAAVAGTSTCHI +SKDPIFV GVWGPYRDV+A  FW AEGGQSCTGAL
Sbjct: 332 EKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGAL 391

Query: 387 LAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHG 446
           LAHV+  HPA+TELS L+DAAS+S F+YLNS LE L Q+R  RSVV+LAKH FFYGDYHG
Sbjct: 392 LAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHG 451

Query: 447 NRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFM 506
           NRSPIADP+MRA +IGQSMDNS++DLA+ YLGACEFI+QQTRQI+E M  +GHRI AIFM
Sbjct: 452 NRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFM 511

Query: 507 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHXXXXXXXXX 566
           SGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGA ASE+ +L +         
Sbjct: 512 SGGQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDLANEKTICQTRR 571

Query: 567 XXXXXXXYEEFKDSMEIPKKNFLSKLGGTASGDLXXXXXXXXXXXXXXXXXXXVGGFPFP 626
                   E+  +    P +N         SG+                    +     P
Sbjct: 572 SSLSQK--EKVVNDPYKPIQNL--------SGEDQNLAFDVSPPNSTPSYIKNI-----P 616

Query: 627 VTSDDSVAIIEEDDPEEANAALSFGSK-KATAQEQLALEKEKSASGKGDALWDVMYNMTG 685
            T +  ++ I E       +A +   K  +T+     L+KE+  S  GD LW VM  +TG
Sbjct: 617 ATLNSHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCNS--GDLLWKVMQELTG 674

Query: 686 GGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
             KVV P+   HPDR+LLD KY+IFLDMAE QR+YR  VD+VE
Sbjct: 675 EAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/695 (59%), Positives = 499/695 (71%), Gaps = 23/695 (3%)

Query: 34  YYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVV 93
           +YVGVDVGTGSARAC+ID  GN+LSLAE+PI+R++L  ++ITQSS+EIW A+CYCV++VV
Sbjct: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98

Query: 94  KDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEI 153
           ++SGV PE++ GIGFDATCSLVVV   + +E+AVGPDF N +QNIILWMDHRA+ ET+EI
Sbjct: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158

Query: 154 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSY 213
           N++ DKCLKYVGGQMSVEMEIPKIKWLKNNL    F+ CKFFDL DYLTFKATG E RS+
Sbjct: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 214 CSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFLSAG 273
           CS VCKQG LPVGVE S  GWSKEFL +IGL +L ++DF +L             FL+AG
Sbjct: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKK----NFLTAG 274

Query: 274 ECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDH 333
           ECI  LD  AA +LGL  HCVV SG+IDAYAGWVGTVAA+ +  +  L E +N K   + 
Sbjct: 275 ECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNG 334

Query: 334 ATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTI 393
           A GRLAAVAGTSTCHI +SK+PIFV GVWGPYRDV+A GFW AEGGQSCTG LL H++T 
Sbjct: 335 AIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITT 394

Query: 394 HPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIAD 453
           HPA+TELSH+++ A VSKF+YLN  LE L ++R  RSV++LAKHLFFYGDYHGNRSPIAD
Sbjct: 395 HPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIAD 454

Query: 454 PSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRN 513
           P+MRA +IGQSMDNSI+DLA+MYL ACEFI+QQTRQI+E M  SGH I AIFMSGGQCRN
Sbjct: 455 PNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRN 514

Query: 514 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHXXXXXXXXXXXXXXXX 573
            LLMRLLADCTGLPIVIPRY+DAAVVFGSALLGA ASE F  ++                
Sbjct: 515 SLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDF--DYTREKRTLKGQKSSQTK 572

Query: 574 YEEFKDSMEIPKKNFLSKLGGTASGDLXXXXXXXXXXXXXXXXXXXVGGFPFPVTSDDSV 633
            E F DS      + + KL                           +  +  P+ +   +
Sbjct: 573 TERFNDSY-----SSIQKLSMEDRNSTNGFVSPHNLQLSTPSAPAKINNYSLPICTQQPL 627

Query: 634 AIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPS 693
               E+  ++  A+L+ G      QE L   +    S     LW VM  +TG  ++V P+
Sbjct: 628 DKTSEESSKD--ASLTVG------QESLGEGRYNGTS----FLWKVMQELTGNARIVNPN 675

Query: 694 SDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
              HPDR+LLD KY+IFLDM ETQR+YR  VDKVE
Sbjct: 676 EKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/702 (58%), Positives = 501/702 (71%), Gaps = 29/702 (4%)

Query: 29  QNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYC 88
           +++  +YVGVDVGTGS RACIID  GNILSLAE+PI+R+EL  ++ITQSS+EIW A+CYC
Sbjct: 25  ESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84

Query: 89  VKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAID 148
           V+ V++++GV P +IHGIGFDATCSLVVV     KE+AVGPDF N +QNIILWMDHRA+ 
Sbjct: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144

Query: 149 ETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGL 208
           ET+EIN + + CLKYVGGQMSVEMEIPKIKWLKNNL    F+ CKFFDL DYLTF+ATG 
Sbjct: 145 ETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGK 204

Query: 209 ETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXT 268
           E RS+ S VCKQG LP GVE S  GWSK+FL +IGL +L  +DF KL             
Sbjct: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQK----N 260

Query: 269 FLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEK 328
           FLSAGECIG LD  AA +LGL  +CVV SG+IDAYAGWVGTVAA+ + +I  L E ++ K
Sbjct: 261 FLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYK 320

Query: 329 TGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLA 388
              + A GRLAAVAGTSTCHI +SK  IFV G+WGPYRDV+A GFW AEGGQSCTG LL 
Sbjct: 321 HDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLD 380

Query: 389 HVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNR 448
           HV+T HPA+++LS L+DAA+VSKF+YLNS LE L ++R  RSV+ LAKHLFFYGDY GNR
Sbjct: 381 HVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNR 440

Query: 449 SPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSG 508
           SPIADP+MRA +IGQSMDNSIDDLA++YLGACEFI+QQTRQI+E M  SGH I A+FMSG
Sbjct: 441 SPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSG 500

Query: 509 GQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHXXXXXXXXXXX 568
           GQCRNGLLMRLLADCTGLPIVIPRYID AVVFGSALLGA AS+ F+LN            
Sbjct: 501 GQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRRRVIKSKKSS 560

Query: 569 XXXXXYEE--FKDSMEIPKKNFLSKLGGTASGDLXXXXXXXXXXXXXXXXXXXVGGFPFP 626
                + E  +     +P +N  + +   AS  L                        FP
Sbjct: 561 LVQTEFLEGLYPSIQNLPLENHSTNV--VASYKLACSNLNAPARTSSDL---------FP 609

Query: 627 VTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNMTGG 686
           ++ +    +I     ++++  +S    +   +E+  ++K        + LW VM  +TG 
Sbjct: 610 ISKEQPADMIS----DKSSKGISLDKGRENLEEERDIDK--------NILWKVMQELTGN 657

Query: 687 GKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
            KV+ P++  HPDR+LLD KY+IFLDM ETQR YR  VDKVE
Sbjct: 658 AKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVE 699

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/704 (59%), Positives = 502/704 (71%), Gaps = 36/704 (5%)

Query: 31  KMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVK 90
           ++ +YVGVDVGTGSARACIID  GN+LSLAE+PI+R+EL+P++ITQSS+EIW A+C+CVK
Sbjct: 36  EVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVK 95

Query: 91  SVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDET 150
           +V+++S V P+++HG+GFDATCSLVVV     K VAVGPDF   +QNIILWMDHRA+ ET
Sbjct: 96  AVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKET 155

Query: 151 KEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLET 210
           +EIN++ DKCLKYVGGQMSVEMEIPKIKWLKNNL  E F+ CKFFDL DYLTFKATG E 
Sbjct: 156 EEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKEN 215

Query: 211 RSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFL 270
           RS+ S VCKQG LP GVE S  GWS+EFL  IGL +L + DF KL             FL
Sbjct: 216 RSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKK----NFL 271

Query: 271 SAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTG 330
           SAGECIGSLD  AA ELGL  +CVV SG+IDAYAGWVGTVAA+ +  I  L E ++    
Sbjct: 272 SAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYN 331

Query: 331 IDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHV 390
            + A GRLAAVAGTSTCHI +SKDPIFV G+WGPYRDV+A GFW AEGGQSCTG LL HV
Sbjct: 332 YNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHV 391

Query: 391 LTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSP 450
           + IHPAYTELS L++AA VSKF+YLNS LE + ++R  RSV++LA+HLFFYGDYHGNRSP
Sbjct: 392 IKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSP 451

Query: 451 IADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQ 510
           IAD +MRA +IGQSMDNS++DLAI YL ACEFI+QQTRQIVE M  SGH+I AIFMSGGQ
Sbjct: 452 IADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQ 511

Query: 511 CRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHXXXXXXXXXXXXX 570
           CRN LL RLLADC+GLPIVIPRYID AVVFGSALLGA ASE+F+L               
Sbjct: 512 CRNDLLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFDL---AKGRRTLTTKKS 568

Query: 571 XXXYEEFKDSMEIPK------KNFLSKLGGTASGDLXXXXXXXXXXXXXXXXXXXVGGFP 624
               E F +S   P+      +N  S +  T S +L                   +   P
Sbjct: 569 SSAQEFFINSYPSPQNSAMRHQNLASDV--TCSYNL----------------PNSISSAP 610

Query: 625 FPVTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNMT 684
             +    S  I ++   + ++   S G+    A   L   +EK   G G  LW VM  +T
Sbjct: 611 DTMNRHSST-ISKQSRGDMSSEESSKGTLNTVALRSL---EEKRYRGTG-ILWKVMQELT 665

Query: 685 GGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
           G  K V P+   HPDR+LLD KY+IFLDMAETQ+RYR  VD +E
Sbjct: 666 GDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLE 709

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/530 (62%), Positives = 415/530 (78%), Gaps = 9/530 (1%)

Query: 27  MEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAIC 86
           ME++ + YY+GVDVGTGS RACIID++G I S AE  I RQELK   ITQSSQEIW A+C
Sbjct: 1   MEKD-IYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVC 59

Query: 87  YCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRA 146
           +CVK VV + G   +++ GIGFDATCSLVVV+  +++ VAVGPDF ++ Q+IILWMDHRA
Sbjct: 60  FCVKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRA 119

Query: 147 IDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKAT 206
           + ETKEIN+TND+CLKYVGGQMS+EME+PKIKWLK ++ ++ F +C+F+DLADYLTFKAT
Sbjct: 120 LKETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKAT 179

Query: 207 GLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXX 266
           G +TRS+CS VCKQG++P+GVE SK GWSK+FL NI LE+L  +D+ KL           
Sbjct: 180 GRKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGR- 238

Query: 267 XTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN 326
             FL+AGE I  L+  A EEL L   C+VGSG+IDAYAGW+GTV + T VD+ +L     
Sbjct: 239 -NFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLF---- 292

Query: 327 EKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGAL 386
            + G+ +A GRLAAVAGTSTCHI +SKDPIFV GVWGPY+D +  G+WC EGGQSCTGAL
Sbjct: 293 -RVGMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGAL 351

Query: 387 LAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHG 446
           L HVL  HP+Y EL  +S+   ++KFDYLN+RL  + ++   RSV+ LAKH+FFYGD HG
Sbjct: 352 LQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHG 411

Query: 447 NRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFM 506
           NRSP+ADPSM+ A++G SMD S+D+LA  YL ACEFIAQQ RQI+E M  +GH I+AI+M
Sbjct: 412 NRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYM 471

Query: 507 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLN 556
           SGGQCRN LLM+LLADC+GL ++IP YID+AVVFG+A+LGA AS+ + LN
Sbjct: 472 SGGQCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLN 521

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 4/93 (4%)

Query: 641 PEEANAALSFGSK----KATAQEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDD 696
           PE  ++A+ FG+      A+   QL   +  +     + LW  M  MT  G  + P   D
Sbjct: 496 PEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMTKVGSYIMPVPKD 555

Query: 697 HPDRVLLDAKYKIFLDMAETQRRYREAVDKVEN 729
           HPDR+LLDAKYKIFLDMA+ Q+RYR  VD VE+
Sbjct: 556 HPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/526 (61%), Positives = 404/526 (76%), Gaps = 2/526 (0%)

Query: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91
           M +Y+GVDVGTGS RAC+I++ G ILSL  + I ++ELKP+YITQSS+EIW  IC CV  
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151
           V+++S ++P  + GIGFDATCSLVV++ ++ +EV VGP+F +  +NIILWMDHRA+ ET 
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 152 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETR 211
           EINAT DKCLKYVGG+MSVEME+PKIKWLKNNL    F  CKFFDL DYLT+KAT  + R
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 212 SYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFLS 271
           S+ STVCKQGLLP+GVE S  GWSKEF T I L++L  D+F  +               S
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLEN-NIRS 239

Query: 272 AGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGI 331
            GE +G L   +A+ELGLP  C+VGSG+IDAYAGWVGTVAA+ + +I  +   D+  + +
Sbjct: 240 VGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKL 298

Query: 332 DHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVL 391
           D + G LA +AGTSTCHI +S  PIFV+G+WGPYRDV++  FWCAEGGQSCTGALL H+L
Sbjct: 299 DSSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHIL 358

Query: 392 TIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPI 451
           T HPAY EL    +  SV  F++LN+RL  L ++  ARS+++L KH F YGDYHGNRSPI
Sbjct: 359 TTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPI 418

Query: 452 ADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQC 511
           +D SMRAA+IGQSMD SID LAIMYL ACEFI+QQ+RQI+ ++  +GH I  I+MSGGQ 
Sbjct: 419 SDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQA 478

Query: 512 RNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNH 557
           RN LLMRLLADCTGLP+VIPRYIDA+V+FGSA+LGAVA +++N+ H
Sbjct: 479 RNQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKH 524

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 44/56 (78%)

Query: 673 GDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
           G  LW+ M  +T  G V+ P++ +HPDRVLL+AKYKIFLDMAETQR+YR  +D++E
Sbjct: 534 GKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/522 (62%), Positives = 411/522 (78%), Gaps = 11/522 (2%)

Query: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91
           + +Y+GVDVGT S RAC++D  G ILSLA +PI RQE++P+Y+TQSS EIW AIC+C++ 
Sbjct: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61

Query: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151
           ++ DS V+ + I GIGFDATCSLVV+E+ ++K VAVGP+F + EQ+IILWMDHRAIDE  
Sbjct: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121

Query: 152 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETR 211
           EIN+T  +CLKYVGG+MS+EM+IPKIKWLKNNLP+ KF+KC+F+DL D+LT++ATG + R
Sbjct: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181

Query: 212 SYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFLS 271
           S+CSTVCK GLLP+GV+ S +GW ++   +IGL +LC+ +F KL             FLS
Sbjct: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTAS---NFLS 238

Query: 272 AGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGI 331
           AG+ +G L   AA +LGL   C+V SG+IDAYAGWVGT+AA   +       +D +++ +
Sbjct: 239 AGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLG------SDGQESEL 292

Query: 332 DHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVL 391
             A+ RLA VAGTSTCHI +SK P F+DGVWGPYRD + PG+W  EGGQSCTGALLAHVL
Sbjct: 293 --ASSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVL 350

Query: 392 TIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPI 451
             HPAY  L  L+    +SKFD++N+RLE L ++RGA+SV AL KHLFFYGDYHGNRSPI
Sbjct: 351 KSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPI 410

Query: 452 ADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQC 511
           ADP+MRA +IGQSMD S+DDLAIM LGACEFIAQQTRQIVE +  SGH I +I+MSGGQC
Sbjct: 411 ADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQC 470

Query: 512 RNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF 553
           RN +L++LLA+CT LPIV+P+YIDAAVVFGSALLG  ASE +
Sbjct: 471 RNLVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 41/58 (70%)

Query: 672 KGDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVEN 729
           K   LW VM N+TG G++++PS+    +  LLD KY+IFLDM ETQ+RYR+ V + EN
Sbjct: 538 KQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAEN 595

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/519 (60%), Positives = 403/519 (77%), Gaps = 5/519 (0%)

Query: 34  YYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVV 93
           YYVG+DVGTGS RAC++D+ GN+LSL E+ I R+ELKP++ITQS++EIW A C+CVK+ +
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 94  KDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEI 153
           +   V    + GIGFDATCSLV +E  +DK+V VGP+F N + N+ILWMDHRA+ E  EI
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 154 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSY 213
           NATNDKCLKYVGG MSVEM+IPKIKWLKNN+    F+KC+FF+LADYLTFKATG  TRS+
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 214 CSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFLSAG 273
           CS VCKQG LP GVE S +GWSKEFL++IGLEDL  + +  L             F S+G
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSL--GGALKNDSQDNFQSSG 253

Query: 274 ECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDH 333
           +C+G L   A  ELGL  +CVVG+G+IDAYAG +GT+AA ++      ++ D+   G+ +
Sbjct: 254 KCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGS--HQIKNDSS-IGLQN 310

Query: 334 ATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTI 393
           A GRLA+VAGTSTCH+ +SKDP+FV GVWGPYRDV+A G+WCAEGGQ+CTG LL++VL+I
Sbjct: 311 AIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSI 370

Query: 394 HPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIAD 453
           HPA+ EL + S  A + KF YLN+ L+ LT +    S + LAKH+FFYGDY GNRSP AD
Sbjct: 371 HPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYAD 430

Query: 454 PSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRN 513
           P M AA+IGQSM++++++LA+ YL ACEFIAQQTRQIVE +  +G  ++ I+MSGGQCRN
Sbjct: 431 PMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRN 490

Query: 514 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 552
            LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S
Sbjct: 491 KLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADAS 529

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (62%)

Query: 641 PEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDDHPDR 700
           P+  +AA+ FG+    A    + +  +     G  LW+ M  MT  G +++P+  +HPDR
Sbjct: 508 PKYVDAAVVFGAAILGATADASRKSVEIECDFGFMLWETMDRMTPHGTLLEPNDVNHPDR 567

Query: 701 VLLDAKYKIFLDMAETQRRYREAVDKVE 728
            LLD KY+IFLDMAETQR+YR+ VD ++
Sbjct: 568 KLLDVKYQIFLDMAETQRKYRQMVDDID 595

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/522 (60%), Positives = 399/522 (76%), Gaps = 2/522 (0%)

Query: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91
           M+YY+GVDVGTGSARAC+ID  G+ILS+ E  I RQELKP YITQS+ +IW  IC C+++
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 92  VVKDSGV--LPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDE 149
           ++++S V  +  KI GIGFDATCSLVV+   +D+EVAVGP+F + +QN+ILWMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 150 TKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLE 209
           T EIN+T+ KCLKYVGGQMSVEMEIPKIKWLKNN+    ++ CKF DL D+LT+KATG  
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 210 TRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTF 269
            RS+CS VCKQGLLP+GVE S +GW++EFL NIGLEDL +D+F KL            +F
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 270 LSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKT 329
            +AGE IG L   +++ +G+ + C V SG+IDAYAGW+GT+AA T   I +L    +   
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 330 GIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAH 389
           G+  ++GRLA VAGTSTCHI+++  PIFV GVWGPYRDV+   FWCAEGGQSCTGALL H
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 390 VLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRS 449
           VL  HPAY EL  +S    +S F+ LN+++  LT QR     V L K+LFFYGD+HGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 450 PIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGG 509
           P+AD +MR  +IG SMD+S++DL  MYLGACEFIAQQTR IV+ M+ SG+ + +++MSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 510 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 551
           QCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA ASE
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE 522

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 641 PEEANAALSFGSKKATA-QEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDDHPD 699
           P+  + A+ FGS    A   +L+     +       LWDVM  MTG G VV P       
Sbjct: 502 PKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQILWDVMCKMTGQGIVVSPQDPSSQV 561

Query: 700 RVLLDAKYKIFLDMAETQRRYREAVD 725
             LL  KY+I+LDM  TQ+RYR  V+
Sbjct: 562 CKLLTVKYQIYLDMIATQKRYRSMVN 587

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/521 (58%), Positives = 395/521 (75%), Gaps = 6/521 (1%)

Query: 34  YYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVV 93
           +++GVDVGTGS RAC+ID  G+IL+L ++PI R+ELKP +ITQSS+EIW +IC+CV+ V+
Sbjct: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79

Query: 94  KDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEI 153
            D+ +   K+ GIGFDATCSL VV+ D+ + +AVGP F   +QNII+WMDHRA  ET EI
Sbjct: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139

Query: 154 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSY 213
           N+  D  LKYVGG+MS+EME+PKIKWLKN++PRE F K  FFDL DYLTFKATG++ RS 
Sbjct: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199

Query: 214 CSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFLSAG 273
           CS VCKQGLLP+GVE S +GWS+ FL+N GL +L +++F ++             FLSAG
Sbjct: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSR----NFLSAG 255

Query: 274 ECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDH 333
           E + +L  S+ E+LGL   CVVGSG+IDAYAG +GT+AAR  +D     + D     + +
Sbjct: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAAR--IDESARTQDDANGQDLQN 313

Query: 334 ATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTI 393
           A GRLAAVAGTSTCHI +S  PIFV+GVWGPY+D++A  +WCAEGGQSCTG LL HV+T 
Sbjct: 314 AIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITT 373

Query: 394 HPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIAD 453
           HPAY EL   +  + +  F+ LN  +  L +Q+G  +++ L K LF YGDYHGNRSPIAD
Sbjct: 374 HPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIAD 433

Query: 454 PSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRN 513
           P MRA++IGQSMD +++ LA++YL ACEFIA QTR I+ KM+ +GH I +I+MSGGQCRN
Sbjct: 434 PRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRN 493

Query: 514 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 554
            +LM LLAD TGLP+VIP+YIDAAVVFG+AL+GA A + FN
Sbjct: 494 NILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%)

Query: 676 LWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVD 725
           LW+ M  MTG G  + P  + H  + LL+ KYKI++DMA+TQ++YR  +D
Sbjct: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/521 (59%), Positives = 387/521 (74%), Gaps = 10/521 (1%)

Query: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91
           M YY+GVDVG+GS RAC++D+ G +LS+A R I ++E  P ++TQSS EIW A+CYCVKS
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151
            + +S V    I GIGFDATCSLVV+  DS + VA GP+F N  QNII+WMDHRAI+ETK
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 152 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETR 211
           EIN + D CLKYVGGQMSVEMEIPKIKWLKN++  E+F+K  F DL DYLTF A+G+ TR
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 212 SYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFLS 271
           SYCS VCKQG LP GVE S +GWS EFLT IGLE++ Q +F  L             F  
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNAL-----GGPNESGNFTY 235

Query: 272 AGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGI 331
           AG  + ++  S  +   +   C+VGSG+IDAYAGW+GTVA+ T +++P     + E   I
Sbjct: 236 AGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVPN----NKEVVDI 290

Query: 332 DHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVL 391
           +   GRLAAVAGTSTCHI +SK  IFV GVWGPYRDV+ P +WCAEGGQS TGALLAH+L
Sbjct: 291 EECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHIL 350

Query: 392 TIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPI 451
           +IHP+  ELS+L    +V KF +LN+ +  L+++    + + L K  F YGDYHGNRSPI
Sbjct: 351 SIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPI 410

Query: 452 ADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQC 511
           ADP+MRAA+IGQSMD S+DDLA  YL ACEFIA QT+ I++ +  +GH I AI+MSGGQC
Sbjct: 411 ADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQC 470

Query: 512 RNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 552
           RN +LM+L+A+CTGLP++IP+YID+AVVFGSA+LGA+A  S
Sbjct: 471 RNNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS 511

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 641 PEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDDHPDR 700
           P+  ++A+ FGS    A    +  K  S  G  D LW  M NMT  G  V P+++D  +R
Sbjct: 490 PKYIDSAVVFGSAILGAM-AYSSSKNNSDKGGADLLWSTMSNMTPDGTTVFPATEDSIER 548

Query: 701 VLLDAKYKIFLDMAETQRRYREAVDK 726
            L++ K+KIFLDMA+TQ+ YR+ V+ 
Sbjct: 549 KLINVKHKIFLDMAKTQQTYRQLVEN 574

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/518 (58%), Positives = 377/518 (72%), Gaps = 12/518 (2%)

Query: 34  YYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVV 93
           YY+GVDVGTGSARA ++ + G  L+L E PI+RQEL+  +ITQSS EIW A+C+CV+ VV
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 94  KDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEI 153
             SGV P  + GIGFDATCSLV V+  +   V VGP+F ++ QNIILWMDHRA  ET  I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 154 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSY 213
           NAT D+CLKYVGGQMSVEME+PKIKWLK ++PR +F KCKFFDL DYLTF AT  + RS+
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 214 CSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFLSAG 273
           CS VCKQGLLP GV+ S+  WS EFL  +GL +L   +F +L             FL+AG
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPK----FLTAG 241

Query: 274 ECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDH 333
           + +G L   A+E+ GL   C+V SGVIDAYAGW+G+V A+ D          ++ +G+D 
Sbjct: 242 QPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFD--------QSHKSSGLDV 293

Query: 334 ATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTI 393
           A  RLA +AGTSTCHI +SK P FV GVWGPYRDV+ PG+WCAEGGQSCTGALLAH+L  
Sbjct: 294 AITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILET 353

Query: 394 HPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIAD 453
           HPA+ EL  L+    VS F+YL   L+ L  +R  R+V+ L++  F YGD+HGNRSP+AD
Sbjct: 354 HPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLAD 413

Query: 454 PSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRN 513
           PSMRA VIGQSMD SI+ LA+ YL ACEFIA QTRQIVE M  +GH +  ++MSGGQCRN
Sbjct: 414 PSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRN 473

Query: 514 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 551
            LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   AS+
Sbjct: 474 SLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASK 511

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%)

Query: 676 LWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKV 727
           LWD+M  MT  G  V P+ D   +R  +DAKY IFLDM E Q+ YR  +D+V
Sbjct: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/523 (58%), Positives = 380/523 (72%), Gaps = 11/523 (2%)

Query: 34  YYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVV 93
           YYVGVDVGT  ARACIID  G IL+  + PI R + K  +ITQSS EIW A+C  V++ V
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 94  KDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEI 153
            +S V  +++ GI FDATCSLVV+++DSD EVAVGPDF +  QN+ILWMDHRA+ E  EI
Sbjct: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128

Query: 154 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSY 213
           N+T    L+YVGG+MSVEM++PKIKWL+ ++PR +F KCKF+DL D+LT++ATG+E+RS+
Sbjct: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188

Query: 214 CSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFLSAG 273
           CSTVCK GL+P GV+SS  GWS+EFL  IGLE+LC+D FR+L             F SAG
Sbjct: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSE---FRSAG 245

Query: 274 ECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDH 333
           E +G L  +AA  LGL   CVVGSGVIDAYAGWVGTV A  D           E  G++ 
Sbjct: 246 EPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPD--------GARESGGVEE 297

Query: 334 ATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTI 393
             GRLAAVAGTSTC I +S+ P FV+GVWGPYRDV+A G+WC EGGQSCTGALLAH L  
Sbjct: 298 LAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHT 357

Query: 394 HPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIAD 453
           HPAYTEL   +    ++ FDY+N RL+ L  + GARS+ ALAKH F YGDYHGNRSP+AD
Sbjct: 358 HPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLAD 417

Query: 454 PSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRN 513
           PSMRAA++G SMD S DDLA+  L A EFIA Q R I++ M+ +G  +  +++SGGQ RN
Sbjct: 418 PSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARN 477

Query: 514 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLN 556
            LL +LLAD    P+V PR++ AAVVFGSALL A A E++  N
Sbjct: 478 PLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLAN 520

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 51/100 (51%), Gaps = 11/100 (11%)

Query: 641 PEEANAALSFGSK--KATAQEQLALEKEKSAS---------GKGDALWDVMYNMTGGGKV 689
           P    AA+ FGS    A A E        +AS              LW +M  +T  G V
Sbjct: 495 PRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQIMSRLTVPGNV 554

Query: 690 VQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVEN 729
           V PS D  PD  LL+AKYK+FL+MAE Q+ YR+ VD VEN
Sbjct: 555 VSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVEN 594

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/522 (55%), Positives = 372/522 (71%), Gaps = 9/522 (1%)

Query: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91
           M+ Y+GVDVGTGSARACI +  G IL++  + I +QEL+  +ITQSS EIW AI   +K 
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151
           V+  S V P  I GI FDATCSLVV + +S + +AVGP+F ++ QNIILWMDHRA  ET 
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 152 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETR 211
            IN+TNDK LKYVGG+MSVE E+PKIKWLK++L  E F +C F DLAD+LT+KATG    
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 212 SYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFLS 271
           S+ S VCKQGLLP GVE SK GWSKEFL  IGLE+L  ++F KL             FL 
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKL---GGSINLKEGNFLI 237

Query: 272 AGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN--EKT 329
            G+ +G +D   A    LP HCVVG+GVIDAY+GWVGTVA+    D+ + V +D+  E  
Sbjct: 238 PGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVAS----DVSDRVCSDSPQELN 293

Query: 330 GIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAH 389
            I+ + GR+A V+GTSTCHI +SK P+F+ GVWGPYRDV+A   W  EGGQS TGALL +
Sbjct: 294 KIEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDN 353

Query: 390 VLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRS 449
           ++  HPAY EL  ++   + + F YL+ +LE L   R   SV  L K++F YGDY+GNRS
Sbjct: 354 IIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRS 413

Query: 450 PIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGG 509
           P+ADP M   +IGQ+MD+SI+DLAI YL ACEFIA QTR I++ +   GH I AI+MSGG
Sbjct: 414 PLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGG 473

Query: 510 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 551
            C+N LLM L+++C  LP+V+ +YID++VVFG+A+LG+VA++
Sbjct: 474 HCKNKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%)

Query: 662 ALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYR 721
           ++++ K      D LW  M  MT  G ++ P S+    R  L AKY+++LDM +T  +YR
Sbjct: 518 SMKENKLEYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYR 577

Query: 722 EAVDKV 727
           + +++V
Sbjct: 578 KKMEEV 583

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  198 bits (503), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 158/530 (29%), Positives = 244/530 (46%), Gaps = 77/530 (14%)

Query: 36  VGVDVGTGSARACIIDNMGN-ILSLAERPI---QRQELKPSYITQSSQEIWLAICYCVKS 91
           +G+DVG+ SAR  I +   + +L +A+ P+   Q          Q S EI  A+  C++ 
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSSRTSWKFWQRSTEIIKALQKCLQK 93

Query: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151
           +     +    +   G  ATCSL + E D  +  ++ P  +  E N+I WMD  AIDE K
Sbjct: 94  L----KITEYNVKSCGVSATCSLAIFEKDK-RNGSLIP--YPNEDNVIFWMDSSAIDECK 146

Query: 152 EINA-TNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLET 210
           ++NA  + + L ++GG    EM IPK+K+  N     + ++   FDL  Y+ ++ + L  
Sbjct: 147 QLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLYQ 206

Query: 211 RSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFL 270
            +    + ++    VGV+    GWS  F  NI                           L
Sbjct: 207 WNNEVLLKRENNKMVGVDGEASGWSPSFYENI-------------------------MHL 241

Query: 271 SAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTG 330
            +   IGS   + A    + +  +V S  ID+YA W    +                   
Sbjct: 242 PSNVIIGS---NGATCKKIASSAIVRS-CIDSYASWFAVSSP------------------ 279

Query: 331 IDHATGRLAAVAGTSTCHIAMSKDPIF---VDGVWGPYRDVMAPG--FWCAEGGQSCTGA 385
             H    L  +AGTSTC+  M   PI    + GVWGP+  ++     F     GQSCTG 
Sbjct: 280 --HLETSLFMIAGTSTCY--MYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGK 335

Query: 386 LLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYH 445
           L+ H+   HP   E+  L   A +  +  L   +  + +Q G +SV    K +FFYGDY 
Sbjct: 336 LIEHLFVTHPCAKEI--LKRGADI--YQVLERTIHDIEKQNG-QSVHVFTKDIFFYGDYE 390

Query: 446 GNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVE--KMSVSGHRIAA 503
           GNR+P ADP M+ + IG++ D SI +L   Y+   EF++ QTR I++  K    G  I  
Sbjct: 391 GNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQE 450

Query: 504 IFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASE 551
           + +SG Q +N  L+ L++    G+ I  P+  +D   V G+ LL   A+E
Sbjct: 451 LRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANE 500

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (78%)

Query: 700 RVLLDAKYKIFLDMAETQRRYREAVDKV 727
           R LL AKY+I LDMA+ Q+RY + +D+V
Sbjct: 536 RRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  196 bits (498), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 150/531 (28%), Positives = 243/531 (45%), Gaps = 79/531 (14%)

Query: 36  VGVDVGTGSARACIIDNMGNIL-SLAERPI---QRQELKPSYITQSSQEIWLAICYCVKS 91
           +G+D+G+ SAR  I D   ++L ++A+ P+        K     Q S EI  A+  C + 
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVPYYHDSSKKSWKFWQKSTEIIKALQNCFQE 68

Query: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDD-SDKEVAVGPDFFNTEQNIILWMDHRAIDET 150
           +     +    +   G  ATCSL + + D ++  +   P+    E N+I WMD  A+DE 
Sbjct: 69  L----KITQYNVRSCGVSATCSLAIFQKDLTNGNLIPYPN----EDNVIFWMDSSAVDEC 120

Query: 151 KEINAT-NDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLE 209
           + +N   + + L Y+GG+   EM IPK+K+  N     + ++   FDL  Y+ ++   L 
Sbjct: 121 EWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELGRLY 180

Query: 210 TRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTF 269
             +      ++ +  +G +    GWS  F  +I                           
Sbjct: 181 RWNTDELSARENINGIGNDGEASGWSSSFYNDI-------------------------MK 215

Query: 270 LSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKT 329
           L +   IG    ++         C      ID+YA W         V  P L        
Sbjct: 216 LPSNVTIGLTGLNSNNSSSTTTVC----SCIDSYASWFA-------VSSPNL-------- 256

Query: 330 GIDHATGRLAAVAGTSTCHIAMSKDPIF---VDGVWGPYRDVMAPG--FWCAEGGQSCTG 384
                   L  +AGTSTC+  M   P+    + GVWGP+  ++     +     GQSCTG
Sbjct: 257 -----EASLFMIAGTSTCY--MYGSPVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTG 309

Query: 385 ALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDY 444
            L+ H+   HPA  ++    +      ++ L + ++ + +++  +S+  LAKH+FFYGDY
Sbjct: 310 KLIEHLFKSHPAARKIQRSGEDI----YEVLENSIQDI-EKKNRKSIHILAKHMFFYGDY 364

Query: 445 HGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKM--SVSGHRIA 502
            GNR+P AD  MR + IG+S D SI +L   Y+   EF++ QT+ I++      SG RI 
Sbjct: 365 EGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIE 424

Query: 503 AIFMSGGQCRNGLLMRLLADCT-GLPIVIPR-YIDAAVVFGSALLGAVASE 551
            + +SG Q +NG L+ L++    G+ I  P   ID   V G+ +LG  A+E
Sbjct: 425 ELRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANE 475

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 700 RVLLDAKYKIFLDMAETQRRYREAVDKVEN 729
           + LL  KY+I LDMA+ Q++Y   VD+  N
Sbjct: 511 KRLLSVKYRIHLDMAKQQQQYHRLVDEALN 540

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  186 bits (472), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 151/538 (28%), Positives = 240/538 (44%), Gaps = 85/538 (15%)

Query: 36  VGVDVGTGSARACIIDNMGN-ILSLAERPI---QRQELKPSYITQSSQEIWLAICYCVKS 91
           +G+D+G+ SAR  I     + +L +A+ P+   Q    K     Q S EI  A+  C + 
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151
           +     +    +   G  ATCSL + E     E  +    +  E N+I WMD  A DE +
Sbjct: 69  L----KITEYNVKSCGVSATCSLAIFERVHTSEALIP---YPNENNVIFWMDSSATDECE 121

Query: 152 EINATNDK-CLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLET 210
            +NA   K  L Y+GG+   EM IPK+K+  N     + ++   FDL  Y+ ++   L  
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLYQ 181

Query: 211 RSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFL 270
            +    +  + +  +G +    GWS  F  NI                           +
Sbjct: 182 WNIDGLLRGENINGIGNDGEASGWSSSFYKNI-------------------------MNI 216

Query: 271 SAGECIGSLDPSAAEELGLPAHCVVGSGV----IDAYAGWVGTVAARTDVDIPELVEADN 326
            +   IG +        GL +  V+ + V    ID+YA W            P  +E   
Sbjct: 217 PSNVIIGPV--------GLVSKKVISTTVVRSCIDSYASWFAVS--------PPFLERS- 259

Query: 327 EKTGIDHATGRLAAVAGTSTCHIAMSKDPIF---VDGVWGPYRDVM--APGFWCAEGGQS 381
                      L  +AGTS+C+  M   P+    + GVWGP+ +++     F     GQS
Sbjct: 260 -----------LFMIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQS 306

Query: 382 CTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFY 441
           CTG L+ H+   HP   ++  L   A +  +  L   +  + +++G  S+  LAK +FFY
Sbjct: 307 CTGKLIEHLFESHPCARKI--LKSGADI--YQVLEQTIHGIEKKKGL-SIHILAKDMFFY 361

Query: 442 GDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGH-- 499
           GDY GNR+P ADP M+ + IG++ D SI +L   Y+   EF++ QT+ I++         
Sbjct: 362 GDYEGNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACI 421

Query: 500 RIAAIFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASESFNL 555
           RI  + +SG Q RN  L+ L++    G+ I  PR  +D   + G+ +L   A+E   L
Sbjct: 422 RIQELRISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQL 479

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  183 bits (465), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 140/532 (26%), Positives = 237/532 (44%), Gaps = 73/532 (13%)

Query: 36  VGVDVGTGSARACIIDNMGN-ILSLAERPI---QRQELKPSYITQSSQEIWLAICYCVKS 91
           +G+DVG+ SAR  + +   + +L +A+ P+   Q    K     Q S EI  A+  C++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151
           +     +   ++   G  ATCSL + E D    + +    +  E N+I WMD  A++E +
Sbjct: 69  L----NIREYEVKSCGVSATCSLAIFERDRTSNMLIP---YPNEDNVIFWMDSSAVNECQ 121

Query: 152 EINAT-NDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLET 210
            +N     + L Y+GG+   EM +PK+K+  +     + +    FDL  Y+ ++ + L  
Sbjct: 122 WLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLYE 181

Query: 211 RSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFL 270
            +    + ++ L  +G +    GWS  F  NI                           L
Sbjct: 182 WNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI-------------------------INL 216

Query: 271 SAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTG 330
            +   IG+    A + +       V    ID+YA W    +                   
Sbjct: 217 PSNVSIGTTSLVANKHIS----TTVVRSCIDSYASWFAVASP------------------ 254

Query: 331 IDHATGRLAAVAGTSTCHI-AMSKDPIFVDGVWGPYRDVM--APGFWCAEGGQSCTGALL 387
             H    L  +AGTS+C++   +     + GVWGP+  ++     F     GQSCTG L+
Sbjct: 255 --HLETSLFMIAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTGKLI 312

Query: 388 AHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGN 447
            H+   HP   ++  L D A +  +  L   +  + +  G  S+  L K +FFYGDY GN
Sbjct: 313 EHLFESHPCARKI--LKDGADI--YQVLEQTIRDIEKNNGL-SIHILTKDMFFYGDYEGN 367

Query: 448 RSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMS--VSGHRIAAIF 505
           R+P ADP ++ + IG+S D S+ +L   Y+   EF++ QT+ I++      S   I  + 
Sbjct: 368 RTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELR 427

Query: 506 MSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASESFNL 555
           +SG Q +N  L+ L++    G+ I+ P+  +D   + G+ +L   A E   L
Sbjct: 428 ISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQL 479

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 700 RVLLDAKYKIFLDMAETQRRYREAVDKV 727
           R LL  KY I LDMA+ Q+RY + VD+V
Sbjct: 511 RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  159 bits (402), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 144/549 (26%), Positives = 235/549 (42%), Gaps = 112/549 (20%)

Query: 36  VGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYI----------TQSSQEIWLAI 85
           +G+D+G+ S R  +     +++      +Q  + K SY           TQS+ EI   I
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLM------VQCVKQKISYYYHGDSALWEYTQSTDEIMKVI 59

Query: 86  CYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHR 145
             C+  +  D       I   G  ATCS+ +   + +          +  QN+I WMD+ 
Sbjct: 60  ERCLHDLKIDE----YNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNS 115

Query: 146 AIDETKEINATNDKCLK-YVGGQMSVEMEIPKIKWLKNNLPR-EKFEKCKF--FDLADYL 201
           +  E K +N   +K L+ ++GG+   EM IPKI  L N L   +  +       DL  YL
Sbjct: 116 SKTECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYL 175

Query: 202 TFKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTN---------IGLEDLCQDDF 252
            ++       ++   +       +G +    GWS +F  +         IG E   +DDF
Sbjct: 176 AYEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIPSNITIGPEPPLEDDF 235

Query: 253 RKLXXXXXXXXXXXXTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAA 312
                                              G+ A C      ID Y+ W+   + 
Sbjct: 236 EYCK-------------------------------GIVASC------IDCYSSWLSLCSP 258

Query: 313 RTDVDIPELVEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVM--A 370
                 PE                 L  V GTSTC++  +     + GVWGP+ D++  +
Sbjct: 259 T-----PE---------------ESLFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNS 298

Query: 371 PGFWCAEGGQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDY------LNSRLEVLTQ 424
             +   EGGQSCTG L+ H+L  HPA         ++S++K D+      +   +  + +
Sbjct: 299 NTYAVYEGGQSCTGKLIEHLLQTHPA---------SSSIAKDDWPLLLEKIEQEISAIEE 349

Query: 425 QRGARSVVALAKHLFFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIA 484
           Q G RS+    KH+FFYGD+ GNR+P ADP M    IG++ D S ++L + Y+   EF+A
Sbjct: 350 QTG-RSIHFKTKHMFFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLA 408

Query: 485 QQTRQIVEKMSVS--GHRIAAIFMSGGQCRNGLLMRLLADC-TGLPIVIPRY-IDAAVVF 540
            Q + ++   + +    +I  I + G Q +N  L+ L++    G  I +P+  ++ + V 
Sbjct: 409 FQIKYMISIFNKAQGQDKITEIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVS 468

Query: 541 GSALLGAVA 549
           G+ LLG  A
Sbjct: 469 GAFLLGKSA 477

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 27/36 (75%)

Query: 692 PSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKV 727
           PSS + P  +LL+AKY+I LDMA+ Q  YRE ++K+
Sbjct: 502 PSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKI 537

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  159 bits (402), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 137/483 (28%), Positives = 203/483 (42%), Gaps = 86/483 (17%)

Query: 27  MEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYIT---------QS 77
           M +NK T  +G+D+G+ S R  +  N  N   +A     + +  P Y T         QS
Sbjct: 1   MVENKPTAGIGIDLGSSSVRVSLF-NFQNDQIIA----YKIKTVPYYFTPESTNWKYTQS 55

Query: 78  SQEIWLAICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQN 137
           S+EI  AI  C + +  D      +I   G  ATCSL + +   +  +    D  + ++N
Sbjct: 56  SREILTAIDQCFQELNIDK----HEIKSCGVGATCSLAIFQTKDNALIPWNLD--DPDKN 109

Query: 138 IILWMDHRAIDETKEINA-TNDKCLKYVGGQMSVEMEIPKIKW----LKNNLPREKFEKC 192
           ++ WMD  AI ET+E+N     +   ++GG    EM +PK++     LKN      FE  
Sbjct: 110 VVFWMDSIAIKETQEVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE-- 167

Query: 193 KFFDLADYLTFKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDF 252
              DL  Y+           Y +      L  +G +    GWS  F  N+ L+       
Sbjct: 168 -IIDLHRYIAMSLAQQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV-LQ------- 218

Query: 253 RKLXXXXXXXXXXXXTFLSAGECIGSLDPSA-AEELGLPAHCVVGSGVIDAYAGWVGTVA 311
                            L     IG    S  + + GL       S  ID Y+ W   + 
Sbjct: 219 -----------------LPPNIVIGPTKHSQHSSKQGLKV-----SSCIDCYSNWFALLP 256

Query: 312 ARTDVDIPELVEADNEKTGIDHATGRLAAVAGTSTCHI-AMSKDPIFVDGVWGPYRDVM- 369
           +                         L  V GTSTC++ A S+    + GVWGP+ ++  
Sbjct: 257 SNLQ--------------------NSLFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFD 296

Query: 370 -APGFWCAEGGQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGA 428
            +  F   E GQSCTG L+ H+   HPA    SH+        F  +N  +E + +Q   
Sbjct: 297 RSDQFSIYEAGQSCTGKLIEHLFKTHPAS---SHIDTRDWPHLFSQINDFIEKV-EQNTQ 352

Query: 429 RSVVALAKHLFFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTR 488
            S+    KH+FFYGD  GNR+P ADPSM    IG++ D S  +L   Y+   EFIA Q +
Sbjct: 353 DSIHMQTKHMFFYGDLDGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIK 412

Query: 489 QIV 491
            ++
Sbjct: 413 HML 415

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 669 ASGKGDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728
           AS    ++ +V +N T   +   P   D     LL+ KY+I+ +MAE QR+YR+ V+ V 
Sbjct: 476 ASTSDKSIVEVAHNQTYSYR--PPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNVI 533

Query: 729 NQRQTID 735
             R  +D
Sbjct: 534 ENRTKLD 540

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  159 bits (401), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 156/552 (28%), Positives = 226/552 (40%), Gaps = 116/552 (21%)

Query: 36  VGVDVGTGSARACIID-NMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVVK 94
           +G+D+G+   R    +      +++  R +   E +    TQSS EI  AI  C +S+  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESLNI 67

Query: 95  DSGVLPEKIHGIGFDATCSLVVVEDDSDKEV---AVGPDFFN-TEQNIILWMDHRAIDET 150
           D       +   G  ATCSL V   +S K +    V  D     +QN++ WMD  AI+E 
Sbjct: 68  DIWA----VQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 151 KEIN--ATNDKCLKYVGGQMSVEMEIPKIKWL-----KNNLPREKFEKCKFFDLADYLTF 203
             IN  A N+K   Y GG    EM +PK+        KNN     FE    FDL  Y+ +
Sbjct: 124 SNINDLAINEKA--YFGGSFIPEMGVPKLASFLKSCSKNN---SDFE---VFDLHTYVAY 175

Query: 204 KATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXX 263
                                    +++ GW   FL N    +    D            
Sbjct: 176 DL-----------------------ANRYGWDASFLINRPNHNGIGHD------------ 200

Query: 264 XXXXTFLSAGECIGSLDPSAAEELGLPAHCVVG-------------SGVIDAYAGWVGTV 310
                    GE  G  D    + L LP +  +G             +  ID Y+ W    
Sbjct: 201 ---------GEIKGWKDEFYEKTLKLPPNVRIGPLCINRRFSPVKVASCIDCYSSWFSMF 251

Query: 311 AARTDVDIPELVEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPI-FVDGVWGPYRDVM 369
           ++      PE                 L   AGTSTC++  +  P   + G+WGP+ D++
Sbjct: 252 SS-----TPER---------------SLFMAAGTSTCYLYANNKPSECLPGIWGPFTDIL 291

Query: 370 ----APGFWCAEGGQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQ 425
                P +   E GQS TG L+ H+   HPA     +L D   +  F+ L + + ++ QQ
Sbjct: 292 DSKDPPSWSVYEAGQSTTGKLIEHLFESHPAAK--PYLEDRNVL--FNRLETEINLIEQQ 347

Query: 426 RGARSVVALAKHLFFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQ 485
             A SV    KH+F YG+  GNR+P  DP M    IG+S D S  DL + Y+   EF+A 
Sbjct: 348 -SAESVHFKTKHMFNYGELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAF 406

Query: 486 QTRQIVEKMSVSGHRIAAIFMSGGQCRNGLLMRLLADCT-GLPIVIP-RYIDAAVVFGSA 543
           Q R I E +   G  I  I ++G Q +N  L+ L++    G  + IP    D   V G+ 
Sbjct: 407 QVRHIKECL---GAPINDIRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAY 463

Query: 544 LLGAVASESFNL 555
           LLG       N+
Sbjct: 464 LLGKAKHLGLNV 475

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 26/32 (81%)

Query: 694 SDDHPDRVLLDAKYKIFLDMAETQRRYREAVD 725
           ++++  R L + KYKI+L+MA+TQR+YRE V+
Sbjct: 499 NEENKLRALFEIKYKIYLNMAQTQRQYREMVN 530

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  156 bits (394), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 150/531 (28%), Positives = 234/531 (44%), Gaps = 88/531 (16%)

Query: 36  VGVDVGTGSARACI--IDNMGNILSLAERPIQRQELKPS-YITQSSQEIWLAICYCVKSV 92
           VGVD+G+ S R  I  ++N  ++L + ERP++      S   TQS+ EI  A+  C+  +
Sbjct: 13  VGVDLGSSSVRVGIYSLEN-DSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL 71

Query: 93  VKDSGVLP--EKIHGIGFDATCSLVVVEDDSDKEVAVGPDFF----NTEQNIILWMDHRA 146
               G+ P    I   G  ATCS+ V   ++        D      ++++N++ WMD  A
Sbjct: 72  ----GLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVA 127

Query: 147 IDETKEINATNDKCLKY-VGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTF-- 203
            +    ++      +K  + G    EM +PK+  L    P    E    FDL  Y+ +  
Sbjct: 128 SEACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPGRSLE---VFDLHKYIAYDL 184

Query: 204 -KATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXX 262
            +  G +  +  +     G   +G +    GW +EF  N+                    
Sbjct: 185 ARRYGWDMAALANRPNSNG---IGHDGEVGGWPQEFYRNV-------------------- 221

Query: 263 XXXXXTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELV 322
                  L A   +G       + +G+ A C      ID YA W G  + +     PE  
Sbjct: 222 -----LKLPATVAVGPASTFKGQRVGV-ASC------IDCYASWFGVCSTQ-----PEQ- 263

Query: 323 EADNEKTGIDHATGRLAAVAGTSTCHI-AMSKDPIFVDGVWGPYRDVM--APGFWCA-EG 378
                          L  VAGTSTC++ A +     + G+WGP+ +++      W   E 
Sbjct: 264 --------------SLFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEA 309

Query: 379 GQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHL 438
           GQS TG LL H+   HPA  +  +  D   +  F  L  R+  +    G  S+  LA+H+
Sbjct: 310 GQSTTGRLLEHLFETHPAARD--YAGDTGRL--FKDLEDRIADMEADSGC-SIHHLARHM 364

Query: 439 FFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSV-S 497
           F YG+  GNR+P ADP M    +G++ D S  +LA+ Y+   EF+A QTRQIVE     +
Sbjct: 365 FLYGELQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGA 424

Query: 498 GHRIAAIFMSGGQCRNGLLMRLLADCTG-LPIVIP-RYIDAAVVFGSALLG 546
              I  + ++G Q RN  L+ L++   G +P+ +P R    A V G+ LLG
Sbjct: 425 AAAIGELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLG 475

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 700 RVLLDAKYKIFLDMAETQRRYREAVDKVENQ 730
           R LL+AKY I LDMA+ Q+RYR  +D V  Q
Sbjct: 517 RRLLEAKYAIHLDMAQVQQRYRSEIDAVIAQ 547

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  155 bits (392), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 141/535 (26%), Positives = 227/535 (42%), Gaps = 84/535 (15%)

Query: 36  VGVDVGTGSARACIID-NMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVVK 94
           +G+D+G+ + R  I D     ++ +  +P+       + +TQSS +I  AI  C++ +  
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQDLNP 70

Query: 95  DSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQ----NIILWMDHRAIDET 150
           D     + +   G  ATCSL V   D +    +  D    +Q    N++ WMD  A  E 
Sbjct: 71  DL----KSVLSCGVAATCSLAVFTQDIEDLKPL--DIHGVKQEPCHNVVFWMDSSATLEC 124

Query: 151 KEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLET 210
           + +N T  +  +++GG    EM IPK+  +    P  +  K + FDL  Y+ ++      
Sbjct: 125 EIVNKTAGRLKEFMGGSFVPEMGIPKLASIFKK-PEAEGHKLEVFDLHSYIAYELAIKYG 183

Query: 211 RSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXXXTFL 270
                 + K     +G +   +GW   F  ++                           L
Sbjct: 184 WDTSRIINKPNENRIGHDGELKGWDAGFYNDV-------------------------LKL 218

Query: 271 SAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTG 330
            A   IG +     E     A C      ID Y+ W    ++  +               
Sbjct: 219 PANVKIGPIHALNTESPVRVASC------IDCYSNWFSMCSSSPN--------------- 257

Query: 331 IDHATGRLAAVAGTSTCHI-AMSKDPIFVDGVWGPYRDVM----APGFWCAEGGQSCTGA 385
                  L   AGTSTC++ A +++   + GVWGP+ +++    A  +   E GQS TG 
Sbjct: 258 -----NSLFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGK 312

Query: 386 LLAHVLTIHPAYTELSHLSDAASVSK---FDYLNSRLEVLTQQRGARSVVALAKHLFFYG 442
           L+ H+   HPA       + A S+ K   F  + S +E L Q  G  SV   +KH+F YG
Sbjct: 313 LIEHLFETHPA-------ARAYSMDKSKLFSAIESAIEKLEQDFG-ESVHFRSKHMFTYG 364

Query: 443 DYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIA 502
           +  GNR+P  D SM    IG++ D S  DL + Y+   EF+A Q + I E        I 
Sbjct: 365 ELQGNRTPYCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKA---EIK 421

Query: 503 AIFMSGGQCRNGLLMRLLADCTG-LPIVIP-RYIDAAVVFGSALLGAVASESFNL 555
            I ++G Q +N  L+ L +     + + IP +  D   V G+ LLG  A ++ N+
Sbjct: 422 DIRIAGSQAKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNINI 476

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/28 (67%), Positives = 23/28 (82%)

Query: 700 RVLLDAKYKIFLDMAETQRRYREAVDKV 727
           + LL+AKYKI+LDMA+TQ RYR  VD V
Sbjct: 506 KQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  149 bits (377), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 148/535 (27%), Positives = 225/535 (42%), Gaps = 98/535 (18%)

Query: 36  VGVDVGTGSARACIID-NMGNILSLAERPIQRQELKPSYITQSSQEIW------LAICYC 88
           +G+D+G+ S R  I   +  ++L +  +P+      P Y   +   +W        I   
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPV------PYYYESNRTSLWEYTQDSAEILTA 61

Query: 89  VKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFN----TEQNIILWMDH 144
           +K     + +    +   G  ATCSLV+ E   D       D F       +N++ WMD 
Sbjct: 62  IKECFDMADLQKYDVKSCGVAATCSLVLCERSGD-------DTFQHCEGDSRNVVFWMDS 114

Query: 145 RAIDETKEINATNDK-CLKYVGGQMSVEMEIPKI-KWLKN--NLPREKFEKCKFFDLADY 200
            A +ET  +NA   +  L ++GG    EM IPK+ ++LK+  + P+   +  + FDL  Y
Sbjct: 115 MAKEETNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQ-WEVFDLHKY 173

Query: 201 LTFKATGLETRSYCSTVCKQGLLP----VGVESSKQGWSKEFLTNIGLEDLCQDDFRKLX 256
           + +K      + YC    +    P    +G +    GWSK F   I              
Sbjct: 174 VAYKLA----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKI-------------- 215

Query: 257 XXXXXXXXXXXTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDV 316
                        L     IG   P   E        V+    ID Y+ W   +      
Sbjct: 216 -----------VRLPPNVTIGC--PKTIEN---EDSLVIVDSCIDCYSSWFSPL------ 253

Query: 317 DIPELVEADNEKTGIDHATGRLAAVAGTSTCHI---AMSKDPIFVDGVWGPYRDVMAPGF 373
                 ++ N+ T        L  VAGTSTC+I      K    V G+WGP+ D++    
Sbjct: 254 ------QSLNKNT--------LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANK 299

Query: 374 WCAEGGQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVA 433
              E G SC+G L+ H+ T HP+   L +LS    +SK   L   + +   Q  A S+  
Sbjct: 300 VVYESGSSCSGKLIEHLFTSHPSAISL-NLSTGQLISK---LEEEINIWETQN-ATSIHF 354

Query: 434 LAKHLFFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEK 493
            A + F YGD  GNR+P  DP MR   IG+S D S  DL + Y+   E +A QT+ +V+ 
Sbjct: 355 EACNNFLYGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDN 414

Query: 494 MSVSGHRIAAIFMSGGQCRNGLLMRL--LADCTGLPIVIPRYIDAAVVFGSALLG 546
                + I  +F+ G Q +N  L++L  L +   L +V     D   V G+ LLG
Sbjct: 415 FE-KLNSINELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLG 468

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 119/503 (23%), Positives = 206/503 (40%), Gaps = 91/503 (18%)

Query: 36  VGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSY------ITQSSQEIWLAICYCV 89
           +GVD+G+   R  I D   +  SL +   + +E  P +      ITQ + +I  A    V
Sbjct: 6   IGVDLGSTEFRIGIFDYYTD--SLVK---ETKEKVPYFRHGNGIITQCTSDILTA----V 56

Query: 90  KSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVG--PDFFNTEQNIILWMDHRAI 147
           +       +    I  +G  ATCS+VV +   +  +      D      +II WM   AI
Sbjct: 57  EKAFNTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAI 116

Query: 148 DETKEIN-ATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKAT 206
           +ET+ +N  T++  L + GG+   EM IPK+  L N L ++  +     DL  +L +K +
Sbjct: 117 EETEYLNNITDESILCHFGGKFFPEMAIPKLLHL-NKLYKD--DGLTVLDLHIWLLWKIS 173

Query: 207 GLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLXXXXXXXXXXX 266
                     V +     +G +    GWSKEF  ++ L  +                   
Sbjct: 174 LKLGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKI------------------- 214

Query: 267 XTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN 326
             F+     I   +               G   ID YA W    +               
Sbjct: 215 --FIGNNAVIKKNEQ-------------FGDSCIDCYASWFQCWS--------------- 244

Query: 327 EKTGIDHATGRLAAVAGTSTCHIAMSK-DPIFVDGVWGPYRDVMAP--------GFWCAE 377
             T + + T  L  VAGTSTC +  S     F+ G+WGP++D++           +   E
Sbjct: 245 --TAMLNRT--LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYE 300

Query: 378 GGQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKH 437
            G S TG LL  +L+ HPA  +       + V+  + +  +++ L +Q   +S+  + K+
Sbjct: 301 AGISRTGVLLEKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMIKN 352

Query: 438 LFFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVS 497
            FF+ DY    S         +++ +  + ++ DLA+ Y+   E +A Q   ++      
Sbjct: 353 TFFHEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEG 412

Query: 498 GHRIAAIFMSGGQCRNGLLMRLL 520
              I+ + ++G Q +N  L+++L
Sbjct: 413 HITISKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 113/522 (21%), Positives = 198/522 (37%), Gaps = 100/522 (19%)

Query: 36  VGVDVGTGSARACIID--NMGNILSLAERPIQRQE--LKPSYITQSSQEIWLAICYCVKS 91
           +G+DVG+ S R  I +  +   I ++ +  + + E   K  + TQ++  +  +I   ++ 
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAFVMRDSIFTALEE 64

Query: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSD----KEVAVGPDFFNTEQNIILWMDHRAI 147
           +  +S ++  KI G+   ATCS+V ++ DS     + + +  +  N   +II W DH A 
Sbjct: 65  LHVNSYIV--KICGVS--ATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTAQ 120

Query: 148 DETKEIN-----------ATNDKCLKYVGGQMSV--EMEIPKIKWLKNNLPREKFEKCKF 194
            E + +N              +K L  +G +     EM IPK+  L N +    +E    
Sbjct: 121 PEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETPHI 180

Query: 195 FDLADYLTFKATGLETRSYCSTV---CKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDD 251
            ++ D   + A  L  +   +TV    K  +  +G++   QGW   F      E      
Sbjct: 181 LEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFYVWALPET----- 235

Query: 252 FRKLXXXXXXXXXXXXTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVA 311
                              S   CIG         +  P  C      ID YA W  T A
Sbjct: 236 -------------------SFPICIGPSKVINETSIVRPKSC------IDCYASWFSTDA 270

Query: 312 ARTDVDIPELVEADNEKTGIDHATGRLAAVAGTSTCHI-AMSKDPIFVDG--------VW 362
              D                      L   AGTSTC + AM +  +   G         W
Sbjct: 271 CTKD--------------------DTLFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFW 310

Query: 363 GPYRDVMAPGFWCA-EGGQSCTGALLAHVLTIHPAYTELSHLSDAASVSK-FDYLNSRLE 420
           GP+ +V+      + E G S TG LL  +   H        ++ + SV++  +Y+ +++ 
Sbjct: 311 GPFTNVLDKDKKSSFEIGFSETGILLEKLFNKH-------QITASWSVAESINYVENQIA 363

Query: 421 VLTQQRGARSVVALAKHLFFYGDYHGNRSPIA--DPSMRAAVIGQSMDNSIDDLAIMYLG 478
           +   +R     + L   ++ +  Y     P     P          + +S   L   Y+ 
Sbjct: 364 IY--ERKKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIA 421

Query: 479 ACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRNGLLMRLL 520
             E++A Q   ++ +       I  + +SG Q +N  L+ L+
Sbjct: 422 ILEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,253,864
Number of extensions: 2728647
Number of successful extensions: 6287
Number of sequences better than 10.0: 32
Number of HSP's gapped: 6345
Number of HSP's successfully gapped: 69
Length of query: 739
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 622
Effective length of database: 40,065,477
Effective search space: 24920726694
Effective search space used: 24920726694
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)