Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17138g8.258ON41941922750.0
KLTH0G13772g8.258ON42042116190.0
Kwal_56.238328.258ON41942015870.0
Smik_12.1448.258ON43843915390.0
Ecym_43128.258ON41141615340.0
ZYRO0C01738g8.258ON41442015310.0
TDEL0F038508.258ON41942015290.0
YLR085C (ARP6)8.258ON43843915280.0
Suva_10.1698.258ON43844015240.0
Skud_12.1538.258ON43843915210.0
KAFR0B027008.258ON42042315170.0
AGR091W8.258ON41041615140.0
NDAI0B019608.258ON43944014910.0
NCAS0B049908.258ON42042414890.0
Kpol_543.368.258ON42742814510.0
TBLA0H014608.258ON44244314500.0
CAGL0L12166g8.258ON42142114450.0
KNAG0G020108.258ON42442214320.0
KLLA0F19063g8.258ON41542314240.0
TPHA0A018308.258ON42142413240.0
TBLA0C004408.23ON3754102701e-25
NCAS0C037008.23ON3754102683e-25
TPHA0D002508.23ON3754102657e-25
ZYRO0F02772g8.23ON3754102649e-25
SAKL0B00968g8.23ON3754102631e-24
KLLA0D05357g8.23ON3754102631e-24
TDEL0C004708.23ON3754102631e-24
CAGL0K12694g8.23ON3754102631e-24
Suva_6.188.23ON3754102631e-24
Smik_6.398.23ON3754102631e-24
YFL039C (ACT1)8.23ON3754102631e-24
ABR222W8.23ON3764102631e-24
KNAG0L002508.23ON3754102622e-24
KAFR0D009408.23ON3754102622e-24
NDAI0G030408.23ON3754102622e-24
KLTH0G18832g8.23ON3754102587e-24
Kpol_1058.158.23ON3754102587e-24
Ecym_15208.23ON3764132578e-24
Skud_6.318.23ON3603532498e-23
NDAI0G029003.161ON3913712463e-22
Kwal_14.11098.23ON3603532444e-22
KLTH0F06490g3.161ON3913712437e-22
ADR316W3.161ON3913702383e-21
SAKL0C07370g3.161ON3913712341e-20
TBLA0F008703.161ON3913712322e-20
ZYRO0B04928g3.161ON3913712304e-20
NCAS0C035503.161ON3923712279e-20
KLLA0C03850g3.161ON3913712261e-19
Ecym_52373.161ON3913712224e-19
Suva_4.2203.161ON3913702207e-19
TDEL0D046103.161ON3913702181e-18
KNAG0K01130na 1ON3933732182e-18
CAGL0K01595g3.161ON3913702172e-18
Kpol_479.253.161ON3913692162e-18
YDL029W (ARP2)3.161ON3913702163e-18
Smik_4.2063.161ON3913702153e-18
Skud_4.2223.161ON3913702153e-18
Kwal_33.141773.161ON3373072101e-17
KLLA0E22925g2.117ON3804252031e-16
TPHA0A009203.161ON3913712012e-16
Ecym_63852.117ON3774252012e-16
SAKL0E11814g2.117ON3794272003e-16
Kpol_1023.188.23ON3193241922e-15
KAFR0C01040na 1ON3373071904e-15
AFR051W2.117ON4054251914e-15
Suva_15.3262.117ON3843641906e-15
NCAS0B071302.117ON3814221898e-15
NDAI0B044602.117ON3813661889e-15
ZYRO0G05676g2.117ON3814101862e-14
KAFR0D037001.514ON4494161872e-14
Smik_8.2102.117ON3843681852e-14
TDEL0B048102.117ON3734161834e-14
KNAG0B001701.514ON4532481836e-14
ZYRO0G01936g1.514ON4613831811e-13
Skud_8.1902.117ON3843701801e-13
TPHA0O010401.514ON4582541811e-13
TBLA0D036801.514ON4583681801e-13
KLLA0B13904g1.514ON4562491802e-13
YJR065C (ARP3)1.514ON4492481792e-13
SAKL0D12804g1.514ON4562481782e-13
Suva_12.1541.514ON4492481783e-13
Smik_10.3551.514ON4492481773e-13
AFR419C1.514ON4551871764e-13
Kpol_1056.161.514ON4602481764e-13
TDEL0F004701.514ON4613691764e-13
Skud_10.2891.514ON4492481765e-13
CAGL0F00517g1.514ON4541871755e-13
Ecym_31531.514ON4582491756e-13
KLTH0B05940g2.117ON3834231746e-13
NCAS0A122701.514ON4541871749e-13
NDAI0A039701.514ON4622481749e-13
Kwal_33.146422.117ON3834271721e-12
YHR129C (ARP1)2.117ON3843631711e-12
KNAG0H036502.117ON3874211684e-12
TPHA0I013002.117ON3794181674e-12
Kwal_27.99581.514ON4451881659e-12
KLTH0C02508g1.514ON4513541659e-12
CAGL0H09042g2.117ON3874151641e-11
TBLA0B010702.117ON3834111532e-10
KNAG0I018602.248ON7531511544e-10
SAKL0E08602g2.248ON7471351525e-10
KLTH0G09482g2.248ON7451521517e-10
Skud_14.2722.248ON7551561482e-09
ADL253C2.248ON7511561463e-09
Kwal_23.48482.248ON7451521463e-09
NDAI0D010602.248ON7531561445e-09
YNL059C (ARP5)2.248ON7551561437e-09
Suva_14.2812.248ON7551561429e-09
TDEL0C041402.248ON7491511411e-08
Smik_14.2672.248ON7551571383e-08
Ecym_32852.248ON7461411374e-08
KAFR0F005902.117ON3864131337e-08
TBLA0E038602.248ON7592251331e-07
KLLA0F03421g2.248ON7471351322e-07
Kpol_1003.162.248ON7491331251e-06
CAGL0J10054g2.248ON7541521232e-06
TPHA0C031602.248ON7551301214e-06
Kpol_282.41.287ON5011061195e-06
NDAI0G055801.287ON5152241187e-06
CAGL0M03201g1.287ON4932301152e-05
Kwal_14.23771.287ON4812201133e-05
ZYRO0A01584g2.248ON7481341133e-05
YJL081C (ARP4)1.287ON4892151123e-05
Ecym_63301.287ON4803321114e-05
AFR105C1.287ON4792201106e-05
KNAG0B019201.287ON5052371098e-05
KLLA0D02288g1.287ON5203161071e-04
KAFR0A015601.287ON4851631052e-04
Smik_10.1611.287ON4892181043e-04
Skud_10.1321.287ON4882181043e-04
Suva_6.1541.287ON4892151034e-04
KLTH0H09702g1.287ON4811051034e-04
SAKL0F13772g7.448ON4223941026e-04
TPHA0I010301.287ON5031061026e-04
NCAS0B060601.287ON4972251017e-04
TBLA0D053601.287ON596164990.001
KAFR0J011602.248ON751227950.005
SAKL0D05874g1.287ON497105930.006
NCAS0G030502.248ON743224940.007
ZYRO0G21428g1.287ON483225900.016
ACR184C7.448ON401256810.16
KLTH0C05324g7.448ON399216790.29
Kpol_520.117.448ON488203780.52
KNAG0B040205.477ON934143751.1
ABR194C8.574ON45094741.2
Ecym_35058.251ON305106741.2
CAGL0K05335g7.448ON52986741.6
NDAI0A002001.11ON33033722.3
TDEL0B023305.689ON70275722.4
NCAS0C018808.587ON79875713.1
Kpol_1030.78.381ON149045704.7
KLTH0F14960g5.477ON775163687.7
Kwal_55.212505.477ON775143679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17138g
         (419 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   880   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   628   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   615   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   597   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   595   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   594   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   593   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   593   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   591   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   590   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   588   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   587   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   578   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   578   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   563   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   563   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   561   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   556   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   553   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   514   0.0  
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   108   1e-25
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   107   3e-25
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   106   7e-25
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   106   9e-25
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   105   1e-24
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   105   1e-24
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   105   1e-24
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   105   1e-24
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   105   1e-24
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   105   1e-24
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   105   1e-24
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   105   1e-24
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   105   2e-24
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   105   2e-24
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   105   2e-24
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   103   7e-24
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   103   7e-24
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   103   8e-24
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   100   8e-23
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    99   3e-22
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    99   4e-22
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    98   7e-22
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    96   3e-21
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    95   1e-20
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    94   2e-20
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    93   4e-20
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    92   9e-20
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    92   1e-19
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    90   4e-19
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    89   7e-19
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    89   1e-18
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    89   2e-18
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    88   2e-18
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    88   2e-18
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    88   3e-18
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    87   3e-18
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    87   3e-18
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    86   1e-17
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    83   1e-16
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    82   2e-16
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    82   2e-16
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    82   3e-16
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    79   2e-15
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    78   4e-15
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    78   4e-15
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    78   6e-15
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    77   8e-15
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    77   9e-15
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    76   2e-14
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    77   2e-14
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    76   2e-14
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    75   4e-14
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    75   6e-14
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    74   1e-13
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    74   1e-13
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    74   1e-13
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    74   1e-13
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    74   2e-13
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    74   2e-13
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    73   2e-13
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    73   3e-13
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    73   3e-13
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    72   4e-13
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    72   4e-13
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    72   4e-13
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    72   5e-13
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    72   5e-13
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    72   6e-13
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    72   6e-13
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    72   9e-13
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     72   9e-13
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    71   1e-12
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    70   1e-12
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    69   4e-12
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    69   4e-12
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    68   9e-12
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    68   9e-12
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    68   1e-11
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    64   2e-10
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    64   4e-10
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    63   5e-10
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    63   7e-10
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    62   2e-09
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    61   3e-09
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    61   3e-09
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    60   5e-09
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    60   7e-09
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    59   9e-09
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    59   1e-08
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    58   3e-08
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    57   4e-08
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    56   7e-08
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    56   1e-07
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    55   2e-07
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    53   1e-06
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    52   2e-06
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    51   4e-06
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    50   5e-06
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    50   7e-06
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    49   2e-05
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    48   3e-05
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    48   3e-05
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    48   3e-05
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    47   4e-05
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    47   6e-05
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    47   8e-05
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    46   1e-04
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    45   2e-04
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    45   3e-04
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    45   3e-04
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    44   4e-04
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    44   4e-04
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    44   6e-04
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    44   6e-04
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    44   7e-04
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    43   0.001
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    41   0.005
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    40   0.006
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    41   0.007
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    39   0.016
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    36   0.16 
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    35   0.29 
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    35   0.52 
KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.4...    33   1.1  
ABR194C Chr2 complement(769476..770828) [1353 bp, 450 aa] {ON} S...    33   1.2  
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    33   1.2  
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    33   1.6  
NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11         32   2.3  
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    32   2.4  
NCAS0C01880 Chr3 complement(346987..349383) [2397 bp, 798 aa] {O...    32   3.1  
Kpol_1030.7 s1030 complement(13601..18073) [4473 bp, 1490 aa] {O...    32   4.7  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...    31   7.7  
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...    30   9.8  

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/419 (100%), Positives = 419/419 (100%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFE 120
           HELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFE
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFE 120

Query: 121 EYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNC 180
           EYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNC
Sbjct: 121 EYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNC 180

Query: 181 TWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240
           TWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMSP
Sbjct: 181 TWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240

Query: 241 VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHP 300
           VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHP
Sbjct: 241 VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHP 300

Query: 301 EIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTD 360
           EIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTD
Sbjct: 301 EIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTD 360

Query: 361 WDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
           WDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL
Sbjct: 361 WDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/421 (69%), Positives = 348/421 (82%), Gaps = 3/421 (0%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M++ PI+IDNGSYE+KFG A+++ PF ALN++A+DKYGN HLSNQV  +KDIS+V F RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           H+LGQL SWEL+S IWDYCL+NPDEF+ W +  TK KHL+ SE CM++PELSK  DQVVF
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDS-VYRKDSTGERNEYNDFQLVIDSGF 178
           EEYE+ S FK PV  FVPFN +    +++ AKED+ V   D   +  +Y D++LVIDSGF
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180

Query: 179 NCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFM 238
           NCTWVVP++KG+PYYKA+KKLDIGGRFLNGFL+E LSFRHYNVMDETILVN+IKEKCLFM
Sbjct: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240

Query: 239 SPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFF 298
           SP SYF+SFQ +  T  EYVLPDF TSFQGY+++  Q +PEDSQTI L DELF++PETFF
Sbjct: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFF 300

Query: 299 HPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCP 358
           HPEIASLL PGI+E ILESISMLPEA+RPL+V N VVTGGNFNI NFA RLATELQRQCP
Sbjct: 301 HPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQCP 360

Query: 359 TDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKW 418
           TDW   VSVP   D  L+GW  M++FS+T AY+++RV+REEYYEHGVDWCT +RFGYQ W
Sbjct: 361 TDWSCRVSVPTG-DARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQAW 419

Query: 419 L 419
           L
Sbjct: 420 L 420

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/420 (69%), Positives = 339/420 (80%), Gaps = 2/420 (0%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M+++P+IIDNGSYE+KFG  +   P RALN++A+DKYGN HLSNQV  +KDIS+V F RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HELGQL SWEL++ IWDYCL+NPD+FN W I  TKGKHL+ SE CM++PELSK  DQVVF
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179
           EEYEF + FK PV  FVPFN      +M+ AKEDS   +        YNDFQLVIDSGFN
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180

Query: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239
           C+W+VP++KG+PYYKA+KKLDIGGRFLNGFL+E LSFRHYNVMDETILVN+IKE CLFMS
Sbjct: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240

Query: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFH 299
           P +YF SFQ +  T  EYVLPDF TSFQGY+++  Q +P +SQTI L DELF++PETFFH
Sbjct: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300

Query: 300 PEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPT 359
           PEIASLL  GIVETILESISMLPEAIRPLMV N V+TGGNFNI NFA RLATELQRQCPT
Sbjct: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360

Query: 360 DWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
           DW   VS+P   D  L+GW  M++FS+T  Y ++RVTR+EYYEHGVDWCT +RFGYQ WL
Sbjct: 361 DWSCRVSLPKG-DAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/439 (64%), Positives = 345/439 (78%), Gaps = 21/439 (4%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M+  PI+IDNGSYE+KFGP+TN  PFRALNALA+DK+G  +LSN +  +KDIS+V FRRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HELGQLT WEL+SCIWDYC +NP EF+ +++   KG HLV SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 120 EEYEFGSCFKGPVAGFVPFN------WQAL-----EHNMIYAKED-----SVYRKDSTGE 163
           EEYEF S FK PVA FVPF        +A+     + +++ +K +     S   +D+   
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 164 RNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMD 223
            ++Y+DFQLVIDSGFNCTW++P++KGIPYYKA+KKLD+GGRFL G LKETLSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 224 ETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK---IPED 280
           ETILVNNIKEKCLF+SPVSYF+SF+ K+    EYVLPDFQTSF GYV+ ++++   + ED
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 281 SQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNF 340
           +QTI L DELF+IPETFFHPEIA + KPGIVE ILES+SMLPE +RPLMV N V TGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 341 NIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEY 400
           N+ NFA+RLA ELQRQ PTDW   VSVP  SD ALFGW+ M QFS T +Y+  RVTREEY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPE-SDCALFGWEVMSQFSSTASYRNARVTREEY 419

Query: 401 YEHGVDWCTKQRFGYQKWL 419
           YEHG DWCTK RFGYQ W+
Sbjct: 420 YEHGSDWCTKHRFGYQNWI 438

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/416 (66%), Positives = 338/416 (81%), Gaps = 7/416 (1%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHEL 63
            PIIIDNGSYE+KFGP++  +P+RALN LARDKYG  HLSNQ+ +++++SN   RRP EL
Sbjct: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62

Query: 64  GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEYE 123
           GQL SWEL+  IWDYCL+N DEF+W++ ++K   L++SE CMS+PE+SK  DQVVFEEYE
Sbjct: 63  GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122

Query: 124 FGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNCTWV 183
           FGS  K PVA ++PF+  A ++ +  +    V RK     +++YNDFQLV+DSGFNCTWV
Sbjct: 123 FGSLMKCPVAQYIPFDNMA-DYKVYGSDGLPVVRK-----KDDYNDFQLVVDSGFNCTWV 176

Query: 184 VPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSY 243
           +P++KG+PYYKA+KKLDIGGRFL G LKET+SFRHYN+MDETIL NNIKE+C FM PVSY
Sbjct: 177 IPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSY 236

Query: 244 FNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHPEIA 303
           F+SFQKK +T  +YVLPDFQTS  GYV+Q KQ IPEDSQT+ L DELF+IPETFFHPEIA
Sbjct: 237 FDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIA 296

Query: 304 SLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDV 363
           ++LKPG++ET+LESISMLPE IRPLMVSN  V GGNFNI NFA RLATELQRQCPTDW V
Sbjct: 297 NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSV 356

Query: 364 CVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
            V +P   DT L GW +M +FS T +Y+Q RVTR EY EHGVDWCTK RFGY++W+
Sbjct: 357 RVHLPKG-DTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/420 (66%), Positives = 332/420 (79%), Gaps = 7/420 (1%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M+  PI++DNGSYE+KFG     TP RA NALARDK+G+ +LSNQ+  +KDIS+V FRRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HE GQLTSWEL+S IWDYC +NPDEFN +++ ++KG+HLV+SE CM++PELSK  DQVVF
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179
           EEYEF S FK P+AGF PF   ++    I  K D   + +   E + Y  FQLVID GFN
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRPSI---AISGKGDD--QPNRKAEPDAYEPFQLVIDVGFN 175

Query: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239
           CTWVVP++KGIPYYKA+KKLDIGGRFLNG LKETLSFRHYNVMDETILVNNIKE CLF+S
Sbjct: 176 CTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVS 235

Query: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFH 299
           PVSYF SF+ KE T  EYVLPDFQTSF GYVK  K+ +P+DSQT++L DELFS+PETFFH
Sbjct: 236 PVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFH 295

Query: 300 PEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPT 359
           PEI  LLKPGI+ETILES+S+LPE +RPLM+ N V TGGNFN+ NFA RLATELQRQ PT
Sbjct: 296 PEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT 355

Query: 360 DWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
           DW   V +P+     L+GW SM  F+ +  Y   RVTREEY+EHGVDWCT+ RFGYQ W+
Sbjct: 356 DWTCTVHLPSGP-KELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/420 (65%), Positives = 336/420 (80%), Gaps = 2/420 (0%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M+  P+++DNGSYEVKFG +T S PFRALNALARDK+G  +LSNQ++++KDIS+V F+RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HE GQLTSWELQSC+WDYC +NP+EF+ +++ ++KG+HL+ SE CM++PELSK  DQVVF
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179
           EEYEF S  K P++GF+PF+       +I  K DS     ST E  +Y  FQ+VIDSGFN
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDS-ESGTSTSETKDYEPFQMVIDSGFN 179

Query: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239
           CTWVVPI+KG+P+YKA+KKLD+GGRF+NG LKETLSFRHYNVMDETILVNNIKEKCLFMS
Sbjct: 180 CTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMS 239

Query: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFH 299
           PVSYF+SF KK+ T  EYVLPDFQT+F GYV  +K    +D+QT+ L DELFS+PETFFH
Sbjct: 240 PVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFH 299

Query: 300 PEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPT 359
           PEIA LLKPGI+ETILES+S++PE +RPLMVSN + TGGNFN+ +F  RLATELQRQ PT
Sbjct: 300 PEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPT 359

Query: 360 DWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
           DW   + +P      L GW SM  F+ T  Y+  RV+R+EYYEHGV+W TK RFGYQ W+
Sbjct: 360 DWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/439 (64%), Positives = 341/439 (77%), Gaps = 21/439 (4%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M+  PI+IDNGSYE+KFGP+TN  PFRALNALA+DK+G  +LSN +  +KDIS++ FRRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HELGQLT WEL+SCIWDYCL+NP EF+ +++   KG HLV SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQ-ALEHNMIYAKEDSV---------------YRKDSTGE 163
           EEYEF S FK PVA FVPF      E   I  K++ +                 K++   
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 164 RNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMD 223
            ++Y+DFQLVIDSGFNCTW++P++KGIPYYKA+KKLDIGGRFL G LKETLSFRHYN+MD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 224 ETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK---IPED 280
           ETILVNNIKE+CLF+SPVSYF+SF+ K+    EYVLPDFQTSF GYV+  +++   +PED
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 281 SQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNF 340
           +Q I L DELF+IPETFFHPEI+ + KPGIVE ILES+SMLPE +RPLMV N V TGGNF
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 341 NIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEY 400
           N+ NFA+RLA ELQRQ PTDW   VSVP   D ALFGW+ M QF++T +Y++ RVTREEY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEG-DCALFGWEVMSQFAKTDSYRKARVTREEY 419

Query: 401 YEHGVDWCTKQRFGYQKWL 419
           YEHG DWCTK RFGYQ W+
Sbjct: 420 YEHGPDWCTKHRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/440 (64%), Positives = 339/440 (77%), Gaps = 23/440 (5%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M+  PI+IDNGSYE+KFGP+TN  PFRALNALA+DK+G  +LSN +  +KDIS+V FRRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HELGQLT WEL+SCIWDYCL+NP EF+ +++   KG HLV SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNM-------------IYAKEDSVYRK----DSTG 162
           EEYEF S FK PVA FVPF  ++ +  M             I   +D  +      D T 
Sbjct: 121 EEYEFDSLFKSPVAVFVPFT-KSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETN 179

Query: 163 ERNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVM 222
             N+Y+DFQLVIDSGF+CTW++P++KGIPYYKA+KKLDIGGRFL G LKETLSFRHYN+M
Sbjct: 180 SNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMM 239

Query: 223 DETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVK---QQKQKIPE 279
           DETILVNNIKEKCLF+SP SYF+SF+ K     EYVLPDFQTSF GYV+   ++   +P 
Sbjct: 240 DETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPT 299

Query: 280 DSQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGN 339
           D+Q+I L DELF+IPETFFHPEI+ ++KPGIVE ILES+SMLPE +RPLM+ N V TGGN
Sbjct: 300 DAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGN 359

Query: 340 FNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREE 399
           FN+ NFA+RLA ELQRQ PTDW   VSVP   D  LFGW+ M QF++T +YQ+ RVTREE
Sbjct: 360 FNLPNFAQRLARELQRQLPTDWTCNVSVPEG-DCTLFGWEVMSQFAKTESYQRARVTREE 418

Query: 400 YYEHGVDWCTKQRFGYQKWL 419
           YYEHG DWCTK RFGYQ W+
Sbjct: 419 YYEHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/439 (63%), Positives = 342/439 (77%), Gaps = 21/439 (4%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M+ +PI+IDNGSYE+KF P+TN  PFRALNALA+DK+G  +LSN +  +KDIS++ FRRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEF-NWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HELGQLT WEL+SCIWDYC +NP EF  +++   KG HLV SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 120 EEYEFGSCFKGPVAGFVPF--NWQALEHNMIYAKEDSVYRKDSTG--------------E 163
           EEYEF S FK PVA FVPF  +++     +    E++     ++G               
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 164 RNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMD 223
            ++Y+DFQLVIDSGFNCTW++P++KGIPYYKA+KKLDIGGRFL G LKETLSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 224 ETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK---IPED 280
           ETILVNN+KEKCLF+SPVSYF+SF+ K+    EYVLPDFQTSF GYV+  +++   +PED
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 281 SQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNF 340
           +QTI L DELF+IPETFFHPEI+ + KPGIVE ILES+SMLPE +RPLMV N V TGGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 341 NIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEY 400
           N+ NFA+RLA ELQRQ PTDW   VSVP   D ALFGW+ M QF++T +Y++ RVTR+EY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVP-IGDCALFGWEVMSQFAKTESYRRARVTRDEY 419

Query: 401 YEHGVDWCTKQRFGYQKWL 419
           YEHG DWCTKQRFGYQ W+
Sbjct: 420 YEHGPDWCTKQRFGYQNWI 438

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/423 (64%), Positives = 339/423 (80%), Gaps = 7/423 (1%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M++TP++IDNGSY VKFGPA+   P+ ALNA+A DKY   +LSNQ+  +KDIS+V  +RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           H LGQLTSWE+Q+ IWDYCLYNPDEFN + IG+TK KHL+ SE CM++PEL K  DQV+F
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179
           EEYEFGS  K PVAG++PF     +  +I  ++   + +  + E  EY DFQLV+DSGFN
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTE--EYRDFQLVVDSGFN 178

Query: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239
           CTW++P++KGIPYYKA+KKLDIGGRFLNG LKETLSFRHYNVMDETILVNNIKEKCLF+S
Sbjct: 179 CTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVS 238

Query: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVK---QQKQKIPEDSQTIKLYDELFSIPET 296
           P SYF+SF+ K+ T+ EYVLPDFQTSF GYV+   +Q + +PEDSQ+I L DELF++PET
Sbjct: 239 PASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPET 298

Query: 297 FFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQ 356
           FFHPEI+ +LKPG+VETILES+SM+PE IRPLMVSN +  GGNFN+ +FA R+A ELQRQ
Sbjct: 299 FFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQ 358

Query: 357 CPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQ 416
            PTDW   +++ +  ++ L GW +M  F+ T  Y+ TRVTREEYYEHG+DWCTK RFGYQ
Sbjct: 359 LPTDWKCRITI-SKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQ 417

Query: 417 KWL 419
            W+
Sbjct: 418 NWV 420

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/416 (65%), Positives = 333/416 (80%), Gaps = 8/416 (1%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHEL 63
            P++++NGSYE+KFGPA   TP+RA N L RD+YG  HLSNQ+ +++DIS+   RRP EL
Sbjct: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62

Query: 64  GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEYE 123
           GQL SWEL+  IWDYCL+NPDEF WE+ ++K   L+ SE CM++PE+SK  DQVVFEEYE
Sbjct: 63  GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122

Query: 124 FGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNCTWV 183
           FGS  K PVA FVPF+ +A +++++    + V  K        YN+FQLV+DSGFNCTWV
Sbjct: 123 FGSMMKCPVAQFVPFD-RARDYDIVGGAGEVVEAKSG------YNNFQLVVDSGFNCTWV 175

Query: 184 VPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSY 243
           +P++KG+PYYKA KKLDIGGRFLNG LKET+SFRHYNVMDETIL+NNIKE+C FM PVSY
Sbjct: 176 MPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSY 235

Query: 244 FNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHPEIA 303
           F+SFQ+KE+T  EY+LPDFQTS  GYV+Q KQ IP+ SQ ++L DELF++PETFFHPEI+
Sbjct: 236 FDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEIS 295

Query: 304 SLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDV 363
           ++LKPG+VETILE +SM+PE +RPL+VSN V  GGNFNI NFA RLATELQRQCPTDW V
Sbjct: 296 NILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKV 355

Query: 364 CVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
            V  P   D AL GW SMRQFSQT +Y+ +RVTR EY EHG DWCTK RFGY++W+
Sbjct: 356 RVHQPKL-DAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/440 (60%), Positives = 342/440 (77%), Gaps = 22/440 (5%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           MD TP+++DNGSYE+KFG + +  P+RALN  A DKYG+ +LSNQ+ +++++S V  RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HELGQLTSWEL+SCIWDYCLYNPDEF+ +E+G +  KHL++SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEH--------------NMIYAKEDSVYRKDSTGE-- 163
           EEYEF S FK P AG++PF  QA +               +MI   E+     D+  +  
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 164 ---RNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN 220
               N+Y D++LVIDSGFNCTW++P++KG+PYYKAIKKLDIGGRFL G LKETLSFRHY+
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 221 VMDETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK-IPE 279
           +MDET+LVNNIKEKCLF+SP SYF+SF+ KE+T+ EY+LPD  +S+ GY ++ K K +PE
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300

Query: 280 DSQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGN 339
            SQ +KLYDELFS+PETFFHPEI+ +LKPGIVETILES+SM+PE +RPL+V+N V TGGN
Sbjct: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360

Query: 340 FNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREE 399
           FN+ +FA RLA ELQRQ PTDW   +SVP   +  LF W SM QF+ T +Y++TR+++EE
Sbjct: 361 FNLPHFAARLAAELQRQLPTDWTCRISVPK-KECELFSWKSMCQFANTDSYKKTRISKEE 419

Query: 400 YYEHGVDWCTKQRFGYQKWL 419
           YYEHG DW TK +FGYQ WL
Sbjct: 420 YYEHGPDWLTKHKFGYQNWL 439

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/424 (63%), Positives = 337/424 (79%), Gaps = 9/424 (2%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M+ +PI IDNGSYE+KFG    S+P+RA+NA A DKY   +LSNQ+  +KDI++V FRRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEF-NWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HELGQLTSWEL+S IWDY L+NPDEF  +++ + KGKHL+ SE CM++PELSK  DQVVF
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHN--MIYAKEDSVYRKDSTGE--RNEYNDFQLVID 175
           EEYEF S +K  +AGF+ F   A + N  +I  K +     DS  +    EYND+QLVID
Sbjct: 121 EEYEFDSYYKSSIAGFIQF---ADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVID 177

Query: 176 SGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKC 235
           SGFNCTW++P++KG+PYYKA+KKLDIGGRFL+G LKETLSFRHY+VMDETILVNNIKE C
Sbjct: 178 SGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENC 237

Query: 236 LFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPE 295
           LF+SP SYF+SF+ K +T  EYVLP+FQT+F G+V+ + + +PE++QTIKLYDELFS+PE
Sbjct: 238 LFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPE 297

Query: 296 TFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQR 355
           TFFHPEIA +LKPG+VETILES+SM+PE +RPL+V N V TGGNFN+ +FA RL +ELQR
Sbjct: 298 TFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQR 357

Query: 356 QCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGY 415
           Q PTDW    SVP   +  LFGW +M QF+ T +Y++TRVTREEYYEHG DW TK RFGY
Sbjct: 358 QLPTDWICRTSVP-TKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGY 416

Query: 416 QKWL 419
           Q W+
Sbjct: 417 QNWI 420

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/428 (63%), Positives = 328/428 (76%), Gaps = 10/428 (2%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M+  PI+IDNGSYEVKFG +    P RALNALA+DKYG  +LSNQ++ +KDIS+V  RRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEF-NWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           HELGQL SWEL+  +WDYC +NPDEF N+ +  TKG HLV+SE CM++PELS   DQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVY-----RKDSTGERNEYNDFQLVI 174
           EEYEF S FK PVAGFVPF        MI  K D V        DS   +N Y+DF LVI
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180

Query: 175 DSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEK 234
           DSGFNCTW++PI+KG+PYYKA+KK+++GGRFLNG  KET+S+RHY+V DETILVNNIKEK
Sbjct: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQK--QKIPEDSQTIKLYDELFS 292
           CLFMSP SY +SF+ K+  + +YVLPDFQTSF GYVK +K   ++PE+SQ I L DELFS
Sbjct: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300

Query: 293 IPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATE 352
           +PET FHPE+A LLKPGIVETILES+S++PE IRPL+V+N V  GGNFN+ NF  RLATE
Sbjct: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360

Query: 353 LQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTT-AYQQTRVTREEYYEHGVDWCTKQ 411
           LQRQ PTDW   + +P   D  L GW SM QF+Q T  Y++ R++REEYYEHG DW TK+
Sbjct: 361 LQRQLPTDWVCNIYIP-EKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKK 419

Query: 412 RFGYQKWL 419
           RFGYQ W+
Sbjct: 420 RFGYQNWI 427

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/443 (58%), Positives = 330/443 (74%), Gaps = 25/443 (5%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           MDD PI+IDNGSYE+KFG + +  PFRA+NA+A+DKY   +LSNQ+  +KDIS+V FRRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           +ELGQLTSWEL+S IWDYC YNP+EF+ +++ +T  KHLV+SE C+S+PE S+  D ++F
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 120 EEYEFGSCFKGPVAGFVPF--------------------NWQALEHNMIYAKEDSVYRKD 159
           EEY +GS +K PVAGF+PF                    N    +  ++    ++    +
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 160 --STGERNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFR 217
             S  +  EY DFQL+IDSGFNCTW++P++KGIPYYKAIKK+DIGGRFL G LKETLSFR
Sbjct: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240

Query: 218 HYNVMDETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVK-QQKQK 276
           HYNV DETILVNNIKEKCLF++P SY  SF+ K  T  EYVLPDF T+F GY+K   K K
Sbjct: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300

Query: 277 IPEDSQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVT 336
           +P+++Q I L DELFS+ ET FHPEI+ +LKPGI+ETI+ES+SMLPE IRPLMV+N V  
Sbjct: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360

Query: 337 GGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVT 396
           GGNFN+ NF++RL +ELQRQ PTDW   V +P   D  LFGW +M QFS T +Y++ R+T
Sbjct: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKI-DAELFGWKAMAQFSDTDSYRKARIT 419

Query: 397 REEYYEHGVDWCTKQRFGYQKWL 419
           REEY EHGV+WCTK RFGYQ W+
Sbjct: 420 REEYMEHGVEWCTKHRFGYQNWI 442

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/421 (62%), Positives = 323/421 (76%), Gaps = 7/421 (1%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHE 62
           D  I+IDNGSY+VKFG A+   P  ALNALA+DKYG  HLSNQV  +KDIS+V FRRPHE
Sbjct: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHE 63

Query: 63  LGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEY 122
           LGQLTSWEL+SCIWDYCLYNPDEF  +  + + +H+VLSE CM++PELSK TDQV+FEEY
Sbjct: 64  LGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEY 123

Query: 123 EFGSCFKGPVAGFVPFNWQALEHNMIYAKED----SVYRKDSTGERNEYNDFQLVIDSGF 178
           E  S +K P A ++PF         I  K D     +  K   G+  EYNDF LVIDSGF
Sbjct: 124 EVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGK--EYNDFSLVIDSGF 181

Query: 179 NCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFM 238
           NCTWV+PIVKG+PYYKA+KKLD+GGRFLNG LKET+SFRHYNVMDE+ILVNNIKE+CL++
Sbjct: 182 NCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYV 241

Query: 239 SPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFF 298
            PVSYF +F+ K     ++VLPDFQTSFQGYV+  K  +P+++Q + L DE FS+PE FF
Sbjct: 242 DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFF 301

Query: 299 HPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCP 358
           HPEI+  LKPGI+ET+LESI MLPE +RPLM SN V  GGNFN+  F  RL +ELQRQ P
Sbjct: 302 HPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLP 361

Query: 359 TDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKW 418
           TDW VC +  ++ D +L GW +M +F+ T AY++ RVT+E+Y+EHG+DW TK+RFGYQ W
Sbjct: 362 TDW-VCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNW 420

Query: 419 L 419
           +
Sbjct: 421 V 421

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/422 (61%), Positives = 324/422 (76%), Gaps = 7/422 (1%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHELG 64
           P +IDNGSYE+KFG A   TPFRA N +A+DKYG  +LSN +  ++DIS+   RRPHELG
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLTSWELQSCIWDYCLYNPDEFN-WEIG-NTKGKHLVLSEMCMSMPELSKGTDQVVFEEY 122
           QL SWEL+ CIWDYCLYNPDEF+ + +G NT+ + L+L+E C ++PELSK +DQVVFEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 123 EFGSCFKGPVAGFVPFNWQALEHNM--IYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNC 180
           EF + FK P +GF+PF       NM  +  K+ +V    +T    EY DFQLVIDSGFNC
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFNC 182

Query: 181 TWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240
           TWVVPI+KG+P+YKAIKK+DIGGRFLNG LKETLSFRHYN+MDETIL+NNIKEKCLF+SP
Sbjct: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242

Query: 241 VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDS---QTIKLYDELFSIPETF 297
           VSYF+SF+ K+    EYVLPDFQTSF GY+  +  +   D    QTI L DE F++PETF
Sbjct: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302

Query: 298 FHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQC 357
           FHPE+A++LKPG+VETILE+ISM+PE +RP++VSN V  GGNF + + + RL +ELQRQ 
Sbjct: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362

Query: 358 PTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQK 417
           PTDW   V+VP++SD  L  W++M QFS T  Y+ TRVTREEY EHG DWC+K RF YQ 
Sbjct: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422

Query: 418 WL 419
           W+
Sbjct: 423 WI 424

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/423 (61%), Positives = 320/423 (75%), Gaps = 12/423 (2%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M +  ++IDNGSYE+KFG +    P RALN L +DKY   HLSNQ  +++DIS    RRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEFNWEI---GNTKGKHLVLSEMCMSMPELSKGTDQV 117
           HELGQL SWEL+S +WDYC YN D+F+W +    +TK  HLV+SE  M++PELSK  DQV
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120

Query: 118 VFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSG 177
           +FEEY+F S FKGPVA ++PF     + + + A ED   +K S+     Y DFQLVIDSG
Sbjct: 121 IFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAED---KKTSS-----YKDFQLVIDSG 172

Query: 178 FNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLF 237
           FNCTW VPI+KG+PYYKAIKKLDIGGRFL G L+ET+SFRHYNVM+ETILVNNIKE+C F
Sbjct: 173 FNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTF 232

Query: 238 MSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQ-KQKIPEDSQTIKLYDELFSIPET 296
           + P SYF+SF  K +T  EYVLPDFQTSF GYVK+  K+K+ +D+QT+ L DE+FS+PET
Sbjct: 233 VPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPET 292

Query: 297 FFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQ 356
           FFHPEIA +LKPGIVETILE I+M PE +RPL+V+N V TGGNFNI NF  RL TELQRQ
Sbjct: 293 FFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQ 352

Query: 357 CPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQ 416
           CP DW   V  P   D +L GW+SM+ F+ +  ++  RVTREEY EHG+DWCTK RFGYQ
Sbjct: 353 CPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQ 412

Query: 417 KWL 419
           +WL
Sbjct: 413 QWL 415

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/424 (58%), Positives = 319/424 (75%), Gaps = 8/424 (1%)

Query: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           M + P++IDNGSYE+KFG +   TPF ALNALA+DKY   +LSNQ++ +KDIS+V  +RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLTSWELQSCIWDYCLYNPDEF-NWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
           H+LGQL SWEL+  IWDYC YN D+F  +E+      HLVL+E  M++PELS+ TDQVVF
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179
           EEY F S +K P A F+PF  +  +++ I     S    D + E N Y DF LVIDSG+N
Sbjct: 121 EEYGFDSLYKAPAANFIPF-IKNDDNSFIRLSGKSKTYLDGSKENN-YQDFNLVIDSGYN 178

Query: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239
           C+W++P++KG+PYYKA+KK+D+GGRFLNG LKET+S+RHY+V DE++LVNNIKE C+F+S
Sbjct: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFIS 238

Query: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK--IPEDSQTIKLYDELFSIPETF 297
           PVSY  SF+KK  T  EYVLPDFQTSF GYV+  K+   +PE SQ+I L DELFS+PE F
Sbjct: 239 PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGF 298

Query: 298 FHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQC 357
           FHPE+A++LKPGI+ETILES+ +LPE++R LMV+N V TGGNFNI NF  R+ TELQ+Q 
Sbjct: 299 FHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358

Query: 358 PTDWDVCVSVPNASDTALFGWDSMRQFSQTTA--YQQTRVTREEYYEHGVDWCTKQRFGY 415
            T+W   VS+P A +  L  W +M+ F++     Y+ TRVT++EY EHG +W TKQRFGY
Sbjct: 359 QTEWVCDVSIPKA-NAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGY 417

Query: 416 QKWL 419
           Q WL
Sbjct: 418 QNWL 421

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  108 bits (270), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 174/410 (42%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP + SL   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+  +V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMEVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  107 bits (268), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 107/410 (26%), Positives = 173/410 (42%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP I SL   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  106 bits (265), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 173/410 (42%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP + SL   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  106 bits (264), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 173/410 (42%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSVEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP + SL   G+ +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 ILFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR +  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSAIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 173/410 (42%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKNNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 ILFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR +  +L + L+ R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTASQSSAVEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP + SL   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 68

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 69  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 122

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 123 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 156

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR +  +L + LS R Y+     E  +V +IKEK
Sbjct: 157 GDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEK 216

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 217 LCYVA-----LDFEQ-----------EMQTAAQSSAIEKSYELP-DGQVITIGNERFRAP 259

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 260 EALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 319

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 320 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 367

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 172/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 173/410 (42%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTASQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG+      A R+  E+ 
Sbjct: 259 EALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  103 bits (258), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 103/410 (25%), Positives = 171/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 ILFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G      I ++D+ GR +  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSAIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  103 bits (258), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 171/410 (41%), Gaps = 62/410 (15%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNIKEK 234
           G   T VVPI  G      I ++D+ GR L  +L + LS R Y+     E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           E  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  E+ 
Sbjct: 259 EALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT 318

Query: 355 RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
              P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 319 ALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  103 bits (257), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 175/413 (42%), Gaps = 68/413 (16%)

Query: 6   IIIDNGSYEVKFGPATNSTPFRAL--NALARDKY---------GNPHLSNQVSRLKDISN 54
           ++IDNGS   K G A +  P RA+  + + R ++          + ++ ++    + I  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRGI-- 65

Query: 55  VQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKG 113
           +  R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     + 
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREK 119

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
             Q++FE                 FN  A      Y    +V    S+G         +V
Sbjct: 120 MTQIMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIV 153

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNI 231
           +DSG   T VVPI  G     AI ++D+ GR +  +L + LS R Y+     E  +V +I
Sbjct: 154 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDI 213

Query: 232 KEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELF 291
           KEK  +++ + Y                 + QT+ Q    ++  ++P D Q I + +E F
Sbjct: 214 KEKLCYVA-LDYDQ---------------EMQTAAQSSAIEKSYELP-DGQVITIGNERF 256

Query: 292 SIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLAT 351
             PE  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  
Sbjct: 257 RAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQK 316

Query: 352 ELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
           E+    P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 317 EITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 367

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  100 bits (249), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 92/353 (26%), Positives = 149/353 (42%), Gaps = 54/353 (15%)

Query: 55  VQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKG 113
           +  R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     + 
Sbjct: 50  LTLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREK 103

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
             Q++FE                 FN  A      Y    +V    S+G         +V
Sbjct: 104 MTQIMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIV 137

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNI 231
           +DSG   T VVPI  G     AI ++D+ GR L  +L + LS R Y+     E  +V +I
Sbjct: 138 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 197

Query: 232 KEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELF 291
           KEK  +++       F++           + QT+ Q    ++  ++P D Q I + +E F
Sbjct: 198 KEKLCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERF 240

Query: 292 SIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLAT 351
             PE  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  
Sbjct: 241 RAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQK 300

Query: 352 ELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
           E+    P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 301 EITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 351

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 156/371 (42%), Gaps = 72/371 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52
           +PI++D G+  VK G A  + P     ++     G P L     +N  + L+DI      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERANITTPLRDIMIGDEA 60

Query: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
               S +Q   P E G + +W     +WDY  +N  + N    NT G  ++L+E  M+  
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLN----NTSGGKILLTEPPMNPL 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
           +  +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
            V  IKEK  ++S     ++   +E TT    Y LP                   D +TI
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRTI 251

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           K+  E F  PE  F P +  + +PG+ E +  +I      +R  +    V++GG+     
Sbjct: 252 KVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPG 311

Query: 345 FARRLATELQR 355
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 98.6 bits (244), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 90/353 (25%), Positives = 148/353 (41%), Gaps = 54/353 (15%)

Query: 55  VQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKG 113
           +  R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     + 
Sbjct: 50  LTLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREK 103

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
             Q++FE                 FN  A      Y    +V    S+G         +V
Sbjct: 104 MTQILFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIV 137

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYN--VMDETILVNNI 231
           +DSG   T VVPI  G      I ++D+ GR +  +L + LS R Y+     E  +V +I
Sbjct: 138 LDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDI 197

Query: 232 KEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELF 291
           KEK  +++       F++           + QT+ Q    ++  ++P D Q I + +E F
Sbjct: 198 KEKLCYVA-----LDFEQ-----------EMQTAAQSSAIEKSYELP-DGQVITIGNERF 240

Query: 292 SIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLAT 351
             PE  FHP +  L   GI +T   SI      +R  +  N V++GG       A R+  
Sbjct: 241 RAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQK 300

Query: 352 ELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHG 404
           E+    P+   V +  P     ++  W      +  T +QQ  ++++EY E G
Sbjct: 301 EITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 351

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 98.2 bits (243), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 155/371 (41%), Gaps = 72/371 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52
           TPI++D G+  VK G A  + P     ++     G P L     +N V+ LKDI      
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERANVVTPLKDIMIGDEA 60

Query: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
               S +Q   P E G + +W     +WDY  Y+      ++ +T G  ++L+E  M+  
Sbjct: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYD----QMKLPSTSGGKVMLTEPPMNPL 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
              +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 RNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
            V  IKEK  ++S     ++   +E TT    Y LP                   D + I
Sbjct: 211 TVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVI 251

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           K+  E F  PE  F P +  + +PG+ E +  +I      +R  +    V++GG+     
Sbjct: 252 KVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPG 311

Query: 345 FARRLATELQR 355
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 94/370 (25%), Positives = 153/370 (41%), Gaps = 72/370 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------- 52
           PI++D G+  VK G A  + P     ++     G P L     +N  + LKDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRADERANVSTPLKDIMIGDEAS 61

Query: 53  ---SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPE 109
              S +Q   P E G +  W     +WDY  Y       ++ +T G  ++L+E  M+   
Sbjct: 62  QVRSYLQISYPMENGIIRDWADMELLWDYAFYE----QMKLPSTSGGKVLLTEPPMNPLR 117

Query: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169
             +   +V+FE+Y+FG  + G +   +    Q L                S+G       
Sbjct: 118 NREQMCEVMFEKYDFGGVYVG-IQAVLALYAQGL----------------SSG------- 153

Query: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETIL 227
             +V+DSG   T +VP+ + +      ++LD+ GR +  +L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFET 211

Query: 228 VNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285
           V  IKEK  ++S     ++   +E TT   +Y LP                   D + IK
Sbjct: 212 VRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELP-------------------DGRVIK 252

Query: 286 LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNF 345
           +  E F  PE  F P +  + +PGI E +  +I      I   +    V++GG+      
Sbjct: 253 VGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPGL 312

Query: 346 ARRLATELQR 355
             RL  EL++
Sbjct: 313 PSRLEKELKQ 322

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 92/371 (24%), Positives = 152/371 (40%), Gaps = 72/371 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQ-----VSRLKDI------ 52
           TPI++D G+  VK G A  + P     ++     G P L  +      + LKDI      
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASITTPLKDIMIGDEA 60

Query: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
               S +Q   P E G + +W     +WDY  Y       ++ +T G  ++L+E  M+  
Sbjct: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYE----QMKLPSTSGGKVLLTEPPMNPL 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
              +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 RNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +V+DSG   T +VP+ + +      K+LD+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
            V  IKEK  ++S     ++   +E TT    Y LP                   D + I
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVI 251

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           K+  E F  PE  F P +  + +PG+ E +  ++      +R  +    V++GG+     
Sbjct: 252 KVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPG 311

Query: 345 FARRLATELQR 355
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 92/371 (24%), Positives = 153/371 (41%), Gaps = 72/371 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQ-----VSRLKDI------ 52
           +PI++D G+  VK G A  + P     ++     G P L  +      + LKDI      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGTISTPLKDIMIGDEA 60

Query: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
               S +Q   P E G + +W     +WDY  +N      ++  T G  ++L+E  M+  
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFN----QMKLPTTSGGKVLLTEPPMNPV 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
           +  +   +V+FE Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 KNRERMCEVMFERYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
            V  IKEK  ++S     ++   +E TT   EY LP                   D + I
Sbjct: 211 TVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELP-------------------DGRII 251

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           K+  E F  PE  F P++  +  PG+ E +  +I      +R  +    V++GG+     
Sbjct: 252 KVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPG 311

Query: 345 FARRLATELQR 355
              RL  EL++
Sbjct: 312 LPSRLERELKQ 322

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 93.2 bits (230), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 155/371 (41%), Gaps = 72/371 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQ-----VSRLKDI------ 52
           +PI++D G+  VK G A  + P     ++     G P L  +      + LKDI      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGSISTPLKDIMIGEEA 60

Query: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
               S +Q   P E G + +W+    +WDY  YN  +F     +T G  ++L+E  M+  
Sbjct: 61  SDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFP----STSGGKILLTEPPMNPL 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
           +  +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 KNRELMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDT--TAEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
            V  IKEK  ++S     ++   +E T     Y LP                   D + I
Sbjct: 211 TVRQIKEKLSYVSYDLNLDTKLARETTVLVENYELP-------------------DGRVI 251

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           K+  E F  PE  F P++  + +PGI E +  +I      IR  +    V++GG+     
Sbjct: 252 KVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPG 311

Query: 345 FARRLATELQR 355
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 92.0 bits (227), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 90/371 (24%), Positives = 154/371 (41%), Gaps = 72/371 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52
           +PI++D G+  VK G A  + P     ++     G P L     +N  + LKDI      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERANITTPLKDIMIGDEA 60

Query: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
               S +Q   P E G + +W     +WDY  +       ++  T    ++L+E  M+  
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFE----QMKLPTTSNGKILLTEPPMNPT 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
           +  +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
            V  IKEK  ++S     ++   +E TT    Y LP                   D +TI
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRTI 251

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           K+  E F  PE  F P +  + +PG+ E + +++      +R  +    V++GG+     
Sbjct: 252 KVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPG 311

Query: 345 FARRLATELQR 355
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 92/371 (24%), Positives = 152/371 (40%), Gaps = 72/371 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52
           TPI++D G+  VK G A  + P     ++     G P L      +  + LKDI      
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGHASTPLKDIMIGDEA 60

Query: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
               S +Q   P E G + +W     +WDY  +       ++  T G  ++L+E  M+  
Sbjct: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFE----QMKLPTTSGGKVLLTEPPMNPI 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
           +  +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 KNREQMCEVMFEKYDFGGTYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
            V  IKEK  ++S     ++   +E TT    Y LP                   D + I
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRVI 251

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           K+  E F  PE  F P +  + +PG+ E +  +I      IR  +    V++GG+     
Sbjct: 252 KVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPG 311

Query: 345 FARRLATELQR 355
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 96/371 (25%), Positives = 153/371 (41%), Gaps = 72/371 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52
            PI++D G+  VK G A  + P     ++     G P L     SN  + LKDI      
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAGERSNISTPLKDIMIGDEA 60

Query: 53  SNV----QFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
           SNV    Q   P E G + +W     +WDY  Y+      +I +T G  ++L+E  M+  
Sbjct: 61  SNVRSYLQISYPMENGIIKNWADMEQLWDYAFYD----QMKIPSTAGHKVLLTEPPMNPL 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
           +  +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 KNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +V+DSG   T +VP+ + +      ++LD+ GR +  +L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
            V  IKEK  ++S     ++    E TT    Y LP                   D + I
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTKLAHETTTLVETYELP-------------------DGRVI 251

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           K+  E F  PE  F P +  + + GI E +  +I      I   +    V++GG+     
Sbjct: 252 KVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPG 311

Query: 345 FARRLATELQR 355
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 89.4 bits (220), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 90/370 (24%), Positives = 153/370 (41%), Gaps = 72/370 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------- 52
           PI++D G+  VK G A  + P     ++     G P L     ++  + LKDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVTTPLKDIMIGDEAS 61

Query: 53  ---SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPE 109
              S +Q   P E G + +W     +WDY  +       ++ +T    ++L+E  M+  +
Sbjct: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFE----QMKLQSTSNGKILLTEPPMNPLK 117

Query: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169
             +   +V+FE+Y+FG  +   +   +    Q L                S+G       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------- 153

Query: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETIL 227
             +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 228 VNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285
           V  IKEK  ++S     ++   +E TT    Y LP                   D +TIK
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRTIK 252

Query: 286 LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNF 345
           +  E F  PE  F P +  + +PG+ E +  ++      IR  +    V++GG+      
Sbjct: 253 VGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGL 312

Query: 346 ARRLATELQR 355
             RL  EL++
Sbjct: 313 PSRLEKELKQ 322

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 90/370 (24%), Positives = 151/370 (40%), Gaps = 72/370 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------- 52
           PI++D G+  VK G A  + P     ++     G P L     +N  + LKDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIV----GRPILRAEERANVSTPLKDIMIGDEAS 61

Query: 53  ---SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPE 109
              S +Q   P E G + +W     +WDY  ++      ++  T    ++L+E  M+  +
Sbjct: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFD----QMKLPTTSNGKILLTEPPMNPVK 117

Query: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169
             +   +V+FE+Y+FG  +   +   +    Q L                S+G       
Sbjct: 118 NREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------- 153

Query: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETIL 227
             +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFET 211

Query: 228 VNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285
           V  IKEK  ++S     ++   +E TT    Y LP                   D + IK
Sbjct: 212 VRQIKEKVCYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIK 252

Query: 286 LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNF 345
           +  E F  PE  F P +  + + G+ E +  +I      IR  +    V++GG+      
Sbjct: 253 VGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGL 312

Query: 346 ARRLATELQR 355
             RL  EL++
Sbjct: 313 PSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 91/373 (24%), Positives = 153/373 (41%), Gaps = 74/373 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLS-------NQVSRLKDI---- 52
           +PI++D G+  VK G A  + P     ++     G P L        +  + +KDI    
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDFTFPSIV----GRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 53  ------SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMS 106
                 S +Q   P E G +  W     +WD+  +       ++ +T G  ++L+E  M+
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFE----KMKLPSTSGGKILLTEPPMN 116

Query: 107 MPELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNE 166
             +  +   QV+FE+Y+FG  +   +   +    Q L                S+G    
Sbjct: 117 PLKNREMMCQVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG---- 155

Query: 167 YNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDE 224
                +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +
Sbjct: 156 -----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSAD 210

Query: 225 TILVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQ 282
              V  IKEK  ++S    F++   +E TT    Y LP                   D +
Sbjct: 211 FETVRQIKEKLSYVSYDLDFDTKLARETTTLVENYELP-------------------DGR 251

Query: 283 TIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNI 342
            IK+  E F  PE  F P +  + +PG+ E +  +I      IR  +    V++GG+   
Sbjct: 252 IIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSMY 311

Query: 343 RNFARRLATELQR 355
                RL  EL++
Sbjct: 312 PGLPSRLEKELKQ 324

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 91/370 (24%), Positives = 150/370 (40%), Gaps = 72/370 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSR-----LKDI------- 52
           PI++D G+  VK G A  + P     ++     G P L  +        LKDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERATINKPLKDIMIGDEAS 61

Query: 53  ---SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPE 109
              S +Q   P E G + +W     +WDY  +N      ++  T G  ++L+E  M+  +
Sbjct: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFN----QMQLPTTSGGKILLTEPPMNPVK 117

Query: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169
             +   +V+FE+Y+FG  +   +   +    Q L                S+G       
Sbjct: 118 NREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------- 153

Query: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETIL 227
             +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFET 211

Query: 228 VNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285
           V  IKEK  ++S     ++   +E TT    Y LP                   D + IK
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP-------------------DGRIIK 252

Query: 286 LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNF 345
           +  E F  PE  F P +  + + GI E +  +I      +R  +    V++GG+      
Sbjct: 253 VGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGL 312

Query: 346 ARRLATELQR 355
             RL  EL++
Sbjct: 313 PSRLEKELKQ 322

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 89/369 (24%), Positives = 153/369 (41%), Gaps = 68/369 (18%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQ-----VSRLKDI------ 52
           +PI++D G+  VK G A  + P     ++     G P L  +      + LKDI      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASISTPLKDIMIGDEA 60

Query: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
               S +Q   P E G + +W     +WDY  Y       ++ +T G  ++L+E  M+  
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYE----QMKLPSTSGGKVLLTEPPMNPL 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
           +  +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 KNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKL 286
            V  IKEK  ++S     ++   +E TT                  +K ++P D + IK+
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTRLARETTTL----------------VEKYELP-DGRIIKV 253

Query: 287 YDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFA 346
             E F  PE  F P +  +   G+ E +  +I      +R  +    V++GG+       
Sbjct: 254 GQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLP 313

Query: 347 RRLATELQR 355
            RL  EL++
Sbjct: 314 SRLEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 89/370 (24%), Positives = 152/370 (41%), Gaps = 72/370 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------- 52
           PI++D G+  VK G A  + P     ++     G P L     ++  + LKDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVATPLKDIMIGDEAS 61

Query: 53  ---SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPE 109
              S +Q   P E G + +W     +WDY  +       ++ +T    ++L+E  M+  +
Sbjct: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFE----QMKLPSTSNGKILLTEPPMNPLK 117

Query: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169
             +   +V+FE+Y+FG  +   +   +    Q L                S+G       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------- 153

Query: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETIL 227
             +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 228 VNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285
           V  IKEK  ++S     ++   +E T     Y LP                   D +TIK
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTALVESYELP-------------------DGRTIK 252

Query: 286 LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNF 345
           +  E F  PE  F P +  + +PG+ E +  ++      IR  +    V++GG+      
Sbjct: 253 VGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGL 312

Query: 346 ARRLATELQR 355
             RL  EL++
Sbjct: 313 PSRLEKELKQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 89/370 (24%), Positives = 152/370 (41%), Gaps = 72/370 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------- 52
           PI++D G+  VK G A  + P     ++     G P L     ++  + LKDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVTTPLKDIMIGDEAS 61

Query: 53  ---SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPE 109
              S +Q   P E G + +W     +WDY  +       ++ +T    ++L+E  M+  +
Sbjct: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFE----QMKLPSTSNGKILLTEPPMNPLK 117

Query: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169
             +   +V+FE+Y+FG  +   +   +    Q L                S+G       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------- 153

Query: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETIL 227
             +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 228 VNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285
           V  IKEK  ++S     ++   +E T     Y LP                   D +TIK
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTALVESYELP-------------------DGRTIK 252

Query: 286 LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNF 345
           +  E F  PE  F P +  + +PG+ E +  ++      IR  +    V++GG+      
Sbjct: 253 VGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGL 312

Query: 346 ARRLATELQR 355
             RL  EL++
Sbjct: 313 PSRLEKELKQ 322

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 89/370 (24%), Positives = 152/370 (41%), Gaps = 72/370 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------- 52
           PI++D G+  VK G A  + P     ++     G P L     ++  + LKDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVATPLKDIMIGDEAS 61

Query: 53  ---SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPE 109
              S +Q   P E G + +W     +WDY  +       ++ +T    ++L+E  M+  +
Sbjct: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFE----QMKLPSTSNGKILLTEPPMNPLK 117

Query: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169
             +   +V+FE+Y+FG  +   +   +    Q L                S+G       
Sbjct: 118 NREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------- 153

Query: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETIL 227
             +V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 228 VNNIKEKCLFMSPVSYFNSFQKKEDT--TAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285
           V  IKEK  ++S     ++   +E T     Y LP                   D +TIK
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTVLVESYELP-------------------DGRTIK 252

Query: 286 LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNF 345
           +  E F  PE  F P +  + +PG+ E +  ++      IR  +    V++GG+      
Sbjct: 253 VGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYPGL 312

Query: 346 ARRLATELQR 355
             RL  EL++
Sbjct: 313 PSRLEKELKQ 322

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 129/307 (42%), Gaps = 53/307 (17%)

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
           S +Q   P E G + +W     +WDY  Y+      ++ +T G  ++L+E  M+  +  +
Sbjct: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYD----QMQLPSTSGGKVMLTEPPMNPVKNRE 66

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
              +V+FE+Y+FG  +   +   +    Q L                S+G         +
Sbjct: 67  QMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG---------V 100

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETILVNN 230
           V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   V  
Sbjct: 101 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQ 160

Query: 231 IKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
           IKEK  ++S     ++   +E TT    Y LP                   D + IK+  
Sbjct: 161 IKEKLSYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIKVGS 201

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARR 348
           E F  PE  F P +  + +PG+ E +  +I      +R  +    V++GG+        R
Sbjct: 202 ERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSR 261

Query: 349 LATELQR 355
           L  EL++
Sbjct: 262 LEKELKQ 268

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 97/425 (22%), Positives = 175/425 (41%), Gaps = 69/425 (16%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRALNALAR-DKY---------GNPHLSNQVSRLKDI 52
           + PI++DNGS  +K G      P    ++L    KY         GN  + NQ   ++ +
Sbjct: 10  NQPIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL 69

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
             ++ R P E G +T W     +W +      E   ++ + +   ++++E  ++  +  +
Sbjct: 70  --LKLRHPLEHGVVTDWNALEQLWGHVF----EKGLQLSSLQDHPVLVTEAPLNPKKNRE 123

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
              +++FE +             VP          +Y    +V    ++G          
Sbjct: 124 QMCELLFETFS------------VP---------AVYVSIQAVLSLYASGRTT-----GC 157

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVM----DETILV 228
           V+DSG  C+  VP+  G     AI+++DI GR ++  L + L  +   V      E  +V
Sbjct: 158 VLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELL-QVLIRKSTGVSLLSSSEREIV 216

Query: 229 NNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
             IKEK  +++          KE+    Y +   QT F         ++P D + I+L +
Sbjct: 217 RIIKEKACYIA-------LDPKEEE-KNYTMHGKQTMF---------RLP-DGKQIELDN 258

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARR 348
           E F  PE  F+P++       + E + ESI  +   +R  + SN V +GG   I  F  R
Sbjct: 259 EKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDR 318

Query: 349 LATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWC 408
           +  EL+  C     + +  P     +   W      S  + +++  VT++E+ E+    C
Sbjct: 319 VLKELKLSCEPQTKIKIFAPPERKYST--WIGGSILSGLSTFKKIWVTKKEWEEN--PRC 374

Query: 409 TKQRF 413
              RF
Sbjct: 375 VHARF 379

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/371 (23%), Positives = 149/371 (40%), Gaps = 72/371 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52
           +PI++D G+  VK G A  + P     ++     G P L      N    LKD+      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIV----GRPILRAEERGNLNIPLKDVMIGEEA 60

Query: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
               S +Q   P E G + +W     +WDY  Y       ++ +T G  ++L+E  ++  
Sbjct: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYE----QMKLPSTSGGKVLLTEPPLNPL 116

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
           +  +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226
              +VIDSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFE 210

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
            V  IKEK  ++S     ++   +E TT    Y LP                   D + I
Sbjct: 211 TVRQIKEKLCYVSYDLELDTKLARETTTLVENYELP-------------------DGRVI 251

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           K+  E F   E  F P +  +   G+ E +  +I      +R  +    V++GG+     
Sbjct: 252 KVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPG 311

Query: 345 FARRLATELQR 355
              R+  EL++
Sbjct: 312 LPSRIEKELKQ 322

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 97/425 (22%), Positives = 172/425 (40%), Gaps = 69/425 (16%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTP----------FRALNALARDKYGNPHLSNQVSRLKDI 52
           + PI++DNGS  +K G +    P           +    +A    G+  + NQ   L+ +
Sbjct: 7   NQPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL 66

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
             ++ R P E G + +W     IW Y ++N    + ++ N +   ++++E  ++     +
Sbjct: 67  --LKLRHPVEHGIVKNWSDMEHIWSY-VFNK---SLQLQNVEDHPILITEAPLNPRNNRE 120

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
              +++FE                 FN  AL     Y    +V    ++G          
Sbjct: 121 RMCELLFES----------------FNVPAL-----YVSIQAVLSLYASGRTT-----GC 154

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGR----FLNGFLKETLSFRHYNVMDETILV 228
           V+D G  C   VP+  G     +I+++DI GR    FL   L++T      +  +  + V
Sbjct: 155 VVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV-V 213

Query: 229 NNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
             IKEK  +++           +D   E      + +F       K K+P D +TI L  
Sbjct: 214 RIIKEKACYVA-----------KDPHIE------EQNFSINPNYTKFKLP-DGKTIDLGQ 255

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARR 348
           E F  PE  F PE+       + +   +SI  +   +R L+ SN +++GG   +  F  R
Sbjct: 256 EKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGDR 315

Query: 349 LATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWC 408
           L +EL+    +   + +  P     +   W      S  + +++  VTR E +E   D C
Sbjct: 316 LLSELKSLSDSQTKIKIFAPPERKYST--WIGGSILSGLSTFKKLWVTRAE-WEEAAD-C 371

Query: 409 TKQRF 413
              RF
Sbjct: 372 IHSRF 376

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 97/427 (22%), Positives = 170/427 (39%), Gaps = 73/427 (17%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPF----------RALNALARDKYGNPHLSNQVSRLKDI 52
           + PI++DNGS  +K G +    P           +    +A    G   + NQ   L+ +
Sbjct: 9   NQPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL 68

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
             ++ R P E G + +W     IW++  +   + N    N +   ++ +E  ++  +  +
Sbjct: 69  --LKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLN----NIEEHPVLATEAPLNPLKNRE 122

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
              +++FE                 FN  A     +Y    +V    ++G          
Sbjct: 123 AMCEMLFET----------------FNVPA-----VYVSIQAVLSLYASGRTT-----GC 156

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGR----FLNGFLKETLSFRHYNVMDETILV 228
           V+D G  C   VP+  G     +I+++D+ GR    FL   L++T      +  +  I V
Sbjct: 157 VLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI-V 215

Query: 229 NNIKEKCLFMSPVSYFNSFQKKEDTTAE--YVLPDFQTSFQGYVKQQKQKIPEDSQTIKL 286
             IKEK  +++          ++  T E  Y L    T F         K+P D + + L
Sbjct: 216 RIIKEKACYVA----------RDPLTEEQTYHLTPTSTIF---------KLP-DGKVLDL 255

Query: 287 YDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFA 346
            +E F  PE  F P++       I E   +SIS +   +RP ++SN V++GG      F 
Sbjct: 256 KNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFG 315

Query: 347 RRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVD 406
            RL TEL+        + +  P     +   W      S  + +++  VT+ E+ E+   
Sbjct: 316 DRLLTELRNLSEPQTKIKIFAPPERKYST--WIGGSILSGLSTFKKIWVTKSEWQEN--P 371

Query: 407 WCTKQRF 413
            C   RF
Sbjct: 372 DCVHSRF 378

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 136/324 (41%), Gaps = 60/324 (18%)

Query: 6   IIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLSNQVSRLKDISN-----VQF 57
           ++IDNGS   K G A +  P   F ++    R +     +  + S + D +      +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTL 67

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSKGTDQ 116
           R P E G +T+W+    IW +  YN      E+     +H ++L+E  M+     +   Q
Sbjct: 68  RYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE                 FN  A      Y    +V    S+G         +V+DS
Sbjct: 122 IMFET----------------FNVPAF-----YVSIQAVLSLYSSGRTT-----GIVLDS 155

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETILVNNIKEK 234
           G   T VVPI  G      I ++D+ GR L  +L + LS R Y  +   E  +V +IKEK
Sbjct: 156 GDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK 215

Query: 235 CLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIP 294
             +++       F++           + QT+ Q    ++  ++P D Q I + +E F  P
Sbjct: 216 LCYVA-----LDFEQ-----------EMQTAAQSSSIEKSYELP-DGQVITIGNERFRAP 258

Query: 295 ETFFHPEIASLLKPGIVETILESI 318
           E  FHP +  L   GI +T   SI
Sbjct: 259 EALFHPSVLGLESSGIDQTTYNSI 282

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 125/307 (40%), Gaps = 53/307 (17%)

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
           S +Q   P E G + +W     +WDY  Y       ++ +T    ++L+E  M+  +  +
Sbjct: 11  SYLQISYPMENGIIKNWTDMELLWDYAFYE----QMKLPDTSNGKILLTEPPMNPIKNRE 66

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
              +V+FE+Y FG  +   +   +    Q L                S+G         +
Sbjct: 67  KMCEVMFEKYNFGGVYVA-IQAVLALYAQGL----------------SSG---------V 100

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETILVNN 230
           V+DSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   V  
Sbjct: 101 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQ 160

Query: 231 IKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
           IKEK  ++S     ++   +E TT    Y LP                   D + IK+  
Sbjct: 161 IKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRVIKVGS 201

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARR 348
           E F  PE  F P +  + + G+ E +  +I      IR  +    V++GG+        R
Sbjct: 202 ERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSSMYPGLPSR 261

Query: 349 LATELQR 355
           L  EL++
Sbjct: 262 LEKELKQ 268

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 94/425 (22%), Positives = 169/425 (39%), Gaps = 69/425 (16%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTP----------FRALNALARDKYGNPHLSNQVSRLKDI 52
           + P+++DNGS  +K G +    P           +    +A    G+  + NQ   L+ +
Sbjct: 35  NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL 94

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
             ++ R P + G +T+W     +W Y        + ++ N +    +++E  ++  +  +
Sbjct: 95  --LKLRYPLQHGIVTNWADMEQVWGYVFNK----SLQLQNVEDHPNLVTEAPLNPHKNRE 148

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
              +++FE                 FN  AL     Y    +V    ++G          
Sbjct: 149 KMCELLFES----------------FNVPAL-----YVSVQAVLSLYASGRTT-----GC 182

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGR----FLNGFLKETLSFRHYNVMDETILV 228
           V+D G  C   VP+  G     +I+++DI GR    FL   L++T      +  +  I V
Sbjct: 183 VVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI-V 241

Query: 229 NNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
             IKEK  F++          K+    E   P    SF  +      K+P D +TI+L  
Sbjct: 242 RTIKEKACFVT----------KDPKLEEQNFP-MNPSFSKF------KLP-DGKTIELGQ 283

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARR 348
           E +  PE  F PE+       + +   +SI  +   +R L+ SN +++GG   +  F  R
Sbjct: 284 ERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGDR 343

Query: 349 LATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWC 408
           L  EL+    +   + +  P     +   W      S  + +++  VT+ E+ E     C
Sbjct: 344 LLKELKSLSGSRTKIKIFAPPERKYST--WIGGSILSGLSTFKKLWVTKSEWEE--FPDC 399

Query: 409 TKQRF 413
              RF
Sbjct: 400 IHSRF 404

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 88/364 (24%), Positives = 153/364 (42%), Gaps = 63/364 (17%)

Query: 5   PIIIDNGSYEVKFGPATNSTP----FRALNALARDKY------GNPHLSNQVSRLKDISN 54
           PI+IDNGS  +K G +    P    +  +     DK       G+  + N+  RL+ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  VQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGT 114
           +Q+  P E G +  W+    IW + L        ++ N +   L+++E  M+  +  +  
Sbjct: 74  LQY--PIEHGVVEDWDSMELIWAHILNEV----LQLQNIEEHPLLITEAPMNPLKNREVM 127

Query: 115 DQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVI 174
            QV+FE                 FN  AL     Y    +V    ++G          VI
Sbjct: 128 AQVLFE----------------TFNLPAL-----YVSNPAVLSLYASGRTT-----GCVI 161

Query: 175 DSGFNCTWVVPIVKGIPYYKAIKKLDIGGR----FLNGFLKETLSFRHYNVMDETILVNN 230
           D G      VPI  G     ++ ++DIGGR     L   L+++     ++  +  I V  
Sbjct: 162 DCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREI-VRT 220

Query: 231 IKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDEL 290
           IKEK      V Y  +  KKE+ T      D  + F         K+P D + I++ ++ 
Sbjct: 221 IKEK------VCYLATDIKKEENTYMQESQDLTSVF---------KLP-DGKCIEIGNDR 264

Query: 291 FSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLA 350
           +  PE  F P+I      G+ +  ++SI  +   +R  ++S+ +++GG   +R F  R+ 
Sbjct: 265 YRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFGDRML 324

Query: 351 TELQ 354
            +L+
Sbjct: 325 HDLE 328

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 97/422 (22%), Positives = 169/422 (40%), Gaps = 78/422 (18%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTP-FRALNALARDKYGNPHLSNQVSR--LKDISN----- 54
           + P+++DNGS  +K G +  + P     N +   KY    L+N +S   L  I N     
Sbjct: 8   NQPVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKS 67

Query: 55  ---VQFRRPHELGQLTSWELQSCIWDYCLYNPDEFN--WEIGNTKGKHLVLSEMCMSMPE 109
              ++ R P   G + +W+    +W +       FN   +I +     L+++E  ++  +
Sbjct: 68  RGLLRLRHPMNRGIVENWDDMETLWSHT------FNDILKINDFDEHPLLITEAPLNPEK 121

Query: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169
                 +V FE+++F +                     +Y    S     ++G       
Sbjct: 122 NRDKMCEVFFEKFDFAA---------------------VYIANPSTLSLYASGRTT---- 156

Query: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMD-----E 224
              V+D G      VPI +G     +I+++D+GGR +   L+     R Y  +      E
Sbjct: 157 -GCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQIRKYTGISLYSSSE 213

Query: 225 TILVNNIKEKCLFMSPVSYFNSFQKKEDTT---AEYVLPDFQTSFQGYVKQQKQKIPEDS 281
             +V N+KEK  ++S       F   ED +    E +   F             K+P D 
Sbjct: 214 HEIVKNVKEKACYVS-----TDFAHDEDMSNLNPEKIRCQF-------------KLP-DG 254

Query: 282 QTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFN 341
           + + L    F  PE  F P+I  L    + +   ESIS +   +RP + S+ ++ GG+  
Sbjct: 255 KDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTM 314

Query: 342 IRNFARRLATELQ-RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEY 400
            R F  RL  ELQ R    +    ++ P    T+  G   +   S    ++Q  +T+ E+
Sbjct: 315 FRGFGDRLLKELQIRTGNKNLIKIIAPPERKYTSWIGGSILTGLS---TFKQLWMTKAEW 371

Query: 401 YE 402
            E
Sbjct: 372 QE 373

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 90/366 (24%), Positives = 156/366 (42%), Gaps = 61/366 (16%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFR-ALNALARDKYGNPHLSNQVSRL-KDISN------ 54
           + PI+IDNGS  +K G +    P     N     KY    ++ Q+  L K I N      
Sbjct: 9   NQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIR 68

Query: 55  --VQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
             ++ + P   G + +W+    +W + ++N D  N  + N +   L+++E  +++ +   
Sbjct: 69  GLLRLQHPMNRGVVDNWDDMELLW-WHIFN-DTLN--VQNIEEHPLLITEAPLTIEKQRH 124

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
              + +FE +   S                     +Y    SV    ++G     N    
Sbjct: 125 IMCERLFETFNIPS---------------------LYVANPSVLSLYASG-----NTTGC 158

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFL----KETLSFRHYNVMDETILV 228
           V+D G       PI +G     +I+K+++GGR +   L    +++     Y+  +E  +V
Sbjct: 159 VVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSS-NEKEIV 217

Query: 229 NNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
             IKEK  ++S       F K E++   Y L   + S        K K+P D + + L  
Sbjct: 218 RTIKEKVCYIS-----EDFNKSEES---YYLRQDEMSC-------KFKLP-DGKELTLNK 261

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARR 348
           E F  PE  F+P++  L    +     ESIS +   +RP + SN ++TGG+   + F  R
Sbjct: 262 ERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFKGFGSR 321

Query: 349 LATELQ 354
           L  +LQ
Sbjct: 322 LLGDLQ 327

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 91/410 (22%), Positives = 168/410 (40%), Gaps = 62/410 (15%)

Query: 5   PIIIDNGSYEVKFGPATNSTP-FRALNALARDKYG--------NPHLSNQVSRLKDISNV 55
           P+++DNGS  +K G +    P F   + +   ++G        +  + N     + I  +
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI--L 69

Query: 56  QFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTD 115
           Q R P + G + +W     IWDY   +      ++ +     ++++E  ++         
Sbjct: 70  QLRHPVDHGVVKNWNDMELIWDYMFKD----KLKLKDVDEHPVLITEAPLNPVSNRDEMC 125

Query: 116 QVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVID 175
            ++FE                 F  QAL     Y    +V    ++G+ +       V+D
Sbjct: 126 DLLFES----------------FGVQAL-----YVANPAVLSLYASGKIS-----GCVLD 159

Query: 176 SGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETL---SFRHYNVMDETILVNNIK 232
            G   +  VP+ +G     AIK++D+GGR L   L+  L   +        E  LV  IK
Sbjct: 160 CGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIK 219

Query: 233 EKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFS 292
           EK  +++                +  + + + +++G     K K+P D + I L  + F 
Sbjct: 220 EKSCYVA---------------VDLDIEEEKCNYEGDQVGLKFKLP-DGKFITLSKDRFQ 263

Query: 293 IPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATE 352
           +PE  F P + S     I E I +S+S L   +RP M S+ +++GG   ++ F  RL  E
Sbjct: 264 VPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGNRLVQE 323

Query: 353 LQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYE 402
           L +       V +  P   +     W      ++ + +Q+  VT+ ++ E
Sbjct: 324 LDKLNQAQSRVKIWAP--PERKYTSWIGGSILAELSTFQKIIVTKSQWQE 371

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 96/416 (23%), Positives = 173/416 (41%), Gaps = 74/416 (17%)

Query: 17  FGPATNSTPFRALNA---LARDKYGNP-------HLSNQVSRLKDISNVQFRRPHELGQL 66
           FG +T++T F +LNA   L+ +  G         ++ N+        +     P   GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 67  TSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEYEFGS 126
            +W+     W+  +     F +     +    +L+E  ++ PE  +   ++ FE +    
Sbjct: 122 ENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAG 176

Query: 127 CF-KGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNCTWVVP 185
            +        +  +W +            V  +  TG          VIDSG   T V+P
Sbjct: 177 LYIAVQAVLALAASWTS----------SKVTDRSLTG---------TVIDSGDGVTHVIP 217

Query: 186 IVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNIKEKCLFMSP--VS 242
           + +G     AIK + I GR +  F++  L  R     D ++     IK++  ++ P  V 
Sbjct: 218 VAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGETDTSLRTAERIKQEYCYVCPDIVK 275

Query: 243 YFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHPEI 302
            FN F +  D  A++++ +         +++ QK     + + +  E F  PE FF+PEI
Sbjct: 276 EFNKFDRNPDKFAQFIVEN---------QEKTQK-----KIVDVGYERFLAPEIFFNPEI 321

Query: 303 AS--LLKPGIVETILE-SISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQC-- 357
           AS   L P  + TI++ +I   P  +R  + +N V++GG+   ++F RRL  +++     
Sbjct: 322 ASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDIKSIVNN 379

Query: 358 ------------PTDWDVCVSVPNASDTAL-FGWDSMRQFSQTTAYQQTRVTREEY 400
                        T  DV V        A+ FG   + Q ++  +Y  T+   EEY
Sbjct: 380 RIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQTAEFKSYCHTKKDYEEY 435

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 87/368 (23%), Positives = 155/368 (42%), Gaps = 71/368 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRAL--NALARDKY---------GNPHLSNQVSRLKDIS 53
           PI+IDNGS  +K G +    P +AL  + +   KY         G+  + N+  +L+ + 
Sbjct: 14  PIVIDNGSGIIKAGFSGEERP-KALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL- 71

Query: 54  NVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKG 113
            ++ R P + G +  W+    IW Y L        ++ N +   L+++E  M+  +  + 
Sbjct: 72  -LRLRYPMKHGVVEDWDSMELIWSYVLNEV----LQLQNIEEHPLLITEAPMNPLKNREM 126

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
             QV+FE                 FN  A     IY  + +V    ++G          V
Sbjct: 127 IAQVMFE----------------TFNLSA-----IYVSDPAVLSLYASGRTT-----GCV 160

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI------- 226
           +D G      VPI  G     +I ++DIGG    G + E L F+       ++       
Sbjct: 161 VDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSSERE 216

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKL 286
           +V  IKEK      V Y     KKE+        D  ++F         K+P D ++I++
Sbjct: 217 IVRTIKEK------VCYLAKDAKKEEDKYLQGTQDLISAF---------KLP-DGKSIEV 260

Query: 287 YDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFA 346
            ++ +  PE  F P+I      G+    ++SI  +   +R  ++S+ +++GG   ++ F 
Sbjct: 261 GNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKGFG 320

Query: 347 RRLATELQ 354
            R+  +L+
Sbjct: 321 DRMLHDLE 328

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 97/416 (23%), Positives = 166/416 (39%), Gaps = 67/416 (16%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGN----------PHLSNQVSRLKDI 52
           + P++IDNGS  VK G      P     +L  D   N            + N+  RL+ +
Sbjct: 9   NQPVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL 68

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
             ++ + P E G ++ W+    +W + L++    + ++ +     L+++E  ++ PE +K
Sbjct: 69  --LKLKHPMERGVVSDWDDMELLWSHILFD----SLQLTSGMEHPLLITEAPLN-PESNK 121

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
                VF               F  FN  A     I      V    ++G          
Sbjct: 122 EKMLEVF---------------FETFNIPA-----ICVSIPGVLSLYASGRTT-----GC 156

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNV----MDETILV 228
           V+D G      VP+ +G     +IK++++GG  +   L+  L  +   V      E  LV
Sbjct: 157 VVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLR-KESGVWLFSSGERELV 215

Query: 229 NNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
             +KEK  ++S     N  + +E  T E       T+F         K+P D   + L  
Sbjct: 216 RTMKEKSCYVS----LNQLKDEEKFTFEP--GKMNTNF---------KLP-DGNMLTLSK 259

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARR 348
             F  PE  F P+I +  +P + E  L+SI  +   +RP ++S   ++GG    R F  R
Sbjct: 260 SRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFGDR 319

Query: 349 LATELQ-RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEH 403
              ELQ   C       ++ P    TA   W      +  T +++   T+ ++ EH
Sbjct: 320 FLQELQISTCKKSNIRILAPPERKYTA---WIGGSMLAGLTTFRKMLTTKSDWREH 372

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 114/248 (45%), Gaps = 37/248 (14%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     I
Sbjct: 209 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRTAERI 266

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +  +  A+YV+ +         +++ QK     + + +  E
Sbjct: 267 KQEYCYVCPDIVKEFNKFDRDPEKFAQYVVEN---------QEKTQK-----KVVDVGYE 312

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++F R
Sbjct: 313 RFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 371

Query: 348 RLATELQRQC--------------PTDWDVCVSVPNASDTAL-FGWDSMRQFSQTTAYQQ 392
           RL  +L+                  T  DV V        A+ FG   + Q ++  +Y  
Sbjct: 372 RLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKSYCH 431

Query: 393 TRVTREEY 400
           T+   EEY
Sbjct: 432 TKKDYEEY 439

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/383 (22%), Positives = 156/383 (40%), Gaps = 66/383 (17%)

Query: 41  HLSNQVSRLKDISNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVL 100
           ++ N+       +N     P   GQ+ +W+     W+  +     F +     +    +L
Sbjct: 108 YIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLL 162

Query: 101 SEMCMSMPELSKGTDQVVFEEYEFGSCF-KGPVAGFVPFNWQALEHNMIYAKEDSVYRKD 159
           +E  ++ PE  +   ++ FE +     +        +  +W +            V  + 
Sbjct: 163 TEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTS----------SKVVDRS 212

Query: 160 STGERNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY 219
            TG          VIDSG   T V+P+ +G     A+K + I GR +  F++  L  R  
Sbjct: 213 LTG---------TVIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL--RER 261

Query: 220 NVMDETI-LVNNIKEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK 276
             +D ++     IK++  ++ P  V  FN F +  +  A+YV+ +          + +QK
Sbjct: 262 GEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVEN--------QDKTRQK 313

Query: 277 IPEDSQTIKLYDELFSIPETFFHPEIAS--LLKPGIVETIL-ESISMLPEAIRPLMVSNT 333
           +      + +  E F  PE FF+PEIAS   L P  + T+L ++I   P  +R  + +N 
Sbjct: 314 V------VDIGYERFLAPEIFFNPEIASSDFLTP--LPTVLDQTIQACPIDVRKGLYNNI 365

Query: 334 VVTGGNFNIRNFARRLATELQ----------------RQCPTDWDVCVSVPNASDTALFG 377
           V++GG+   ++F RRL  +L+                R    D  V +S     +   FG
Sbjct: 366 VLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLSGARSTGVDVQV-ISHRKQRNAVWFG 424

Query: 378 WDSMRQFSQTTAYQQTRVTREEY 400
              + Q  +   Y  T+   EEY
Sbjct: 425 GSLLAQTPEFKGYCHTKKDYEEY 447

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 89/370 (24%), Positives = 152/370 (41%), Gaps = 71/370 (19%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRAL--NALARDKY---------GNPHLSNQVSRLKD 51
           + PI+IDNGS  +K G +    P +AL  + +   KY         G+  + N+  +L+ 
Sbjct: 12  NQPIVIDNGSGIIKVGFSGEERP-KALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRG 70

Query: 52  ISNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELS 111
           +  ++ R P   G +  W+    IW Y L        ++ N +   L+++E  M+  +  
Sbjct: 71  L--LRLRYPMTHGVVEDWDSMELIWSYMLNEV----LQLQNIEEHPLLITEAPMNPLKNR 124

Query: 112 KGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQ 171
           +   QV+FE                 FN  AL     Y    +V    ++G         
Sbjct: 125 EVMAQVLFE----------------TFNLPAL-----YISNPAVLSLYASGRTT-----G 158

Query: 172 LVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVM-------DE 224
            V+D G      VPI  G     +I ++DIGGR +     E L F+             E
Sbjct: 159 CVVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT----EQLQFQLRKSAGISLFSSSE 214

Query: 225 TILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
             +V  IKEK      V Y     KKE+        D  + F         K+P D + I
Sbjct: 215 LEVVRMIKEK------VCYLAKNIKKEEDRYLQGHHDLGSVF---------KLP-DGKCI 258

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
           ++ ++ +  PE  F P+I      G+ +  ++SI  +   +R  ++S+ +++GG   +R 
Sbjct: 259 EIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRG 318

Query: 345 FARRLATELQ 354
           F  R+  +L+
Sbjct: 319 FGERMLHDLE 328

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 115/254 (45%), Gaps = 44/254 (17%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKTAERI 271

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD- 288
           K++  ++ P  V  FN F ++ +  A++++ +                 +D  T K+ D 
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN-----------------QDKTTKKVIDI 314

Query: 289 --ELFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
             E F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++
Sbjct: 315 GYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKD 373

Query: 345 FARRLATELQRQC--------------PTDWDVCVSVPNASDTALFGWDSMRQFSQTTAY 390
           F+RRL  +++                  T  DV V        A+  W      +QT  +
Sbjct: 374 FSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAV--WFGGSLLAQTAEF 431

Query: 391 QQTRVTREEYYEHG 404
           +    T+++Y EHG
Sbjct: 432 KGYCHTKKDYEEHG 445

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 84/368 (22%), Positives = 155/368 (42%), Gaps = 70/368 (19%)

Query: 10  NGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQF------------ 57
           NGS    FG +T++T F  L        G   LSN ++  +   ++ F            
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTG------GKMLLSNNLAGKRGTEDLDFYIGNEALVAAQS 116

Query: 58  -----RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
                  P   GQ+ +W+     W+  +     F +     +  + +L+E  ++ PE  +
Sbjct: 117 PSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHYFLLTEPPLNPPENRE 171

Query: 113 GTDQVVFEEYEFGSCF-KGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQ 171
              ++ FE +     +        +  +W +            V  +  TG         
Sbjct: 172 QVAEIFFESFNCAGLYIAVQAVLALAASWTS----------SKVIDRSLTG--------- 212

Query: 172 LVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNN 230
            VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     
Sbjct: 213 TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGEADTSLRTAER 270

Query: 231 IKEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
           IK++  ++ P  V  FN F ++ +  A++++   +        + KQK+      + +  
Sbjct: 271 IKQEYCYVCPDIVKEFNKFDRQPEKFAQFIVESQE--------KTKQKV------VDVGY 316

Query: 289 ELFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFA 346
           E F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++F+
Sbjct: 317 ERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFS 375

Query: 347 RRLATELQ 354
           RRL  +++
Sbjct: 376 RRLQRDMK 383

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 112/249 (44%), Gaps = 39/249 (15%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     I
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDASLRTAERI 269

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +  +  A++++ +         K++  K     + + +  E
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDSEKFAQFIVEN---------KERTTK-----KVVDVGYE 315

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P  V  + E+I   P  +R  + +N V++GG+   ++F R
Sbjct: 316 RFLAPEIFFNPEIASSDFLTPLPV-VVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 374

Query: 348 RLATELQ----------------RQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQ 391
           RL  +L+                R    D  V +S     +   FG   + Q  +  +Y 
Sbjct: 375 RLQRDLKGIVNDRISQSEKLSGTRSTGVDVSV-ISHKRQRNAVWFGGSLLAQTGEFKSYC 433

Query: 392 QTRVTREEY 400
            T+   EEY
Sbjct: 434 HTKQDYEEY 442

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 111/248 (44%), Gaps = 37/248 (14%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F K     A++V+ +          Q+K +     + + +  E
Sbjct: 263 KQEYCYVCPDIVKEFNKFDKDPSKFAQFVVEN----------QEKTR----RKVVDIGYE 308

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++F R
Sbjct: 309 RFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 367

Query: 348 RLATELQRQC--------------PTDWDVCVSVPNASDTAL-FGWDSMRQFSQTTAYQQ 392
           RL  +L+                  T  DV V        A+ FG   + Q ++   Y  
Sbjct: 368 RLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH 427

Query: 393 TRVTREEY 400
           T+   EEY
Sbjct: 428 TKKDYEEY 435

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 115/248 (46%), Gaps = 37/248 (14%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R    +D ++     I
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 269

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +     A++++ + +++        K+KI      + +  E
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSEST--------KKKI------VDVGYE 315

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++F R
Sbjct: 316 RFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 374

Query: 348 RLATELQRQC--------------PTDWDV-CVSVPNASDTALFGWDSMRQFSQTTAYQQ 392
           RL  +L+                  T  DV  +S     +   FG   + Q ++  +Y  
Sbjct: 375 RLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYCH 434

Query: 393 TRVTREEY 400
           T+   EEY
Sbjct: 435 TKQDYEEY 442

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 111/248 (44%), Gaps = 37/248 (14%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +     A++V+ +          Q+K +     + + +  E
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVVEN----------QEKTR----RKAVDIGYE 308

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++F R
Sbjct: 309 RFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 367

Query: 348 RLATELQRQC--------------PTDWDVCVSVPNASDTAL-FGWDSMRQFSQTTAYQQ 392
           RL  +L+                  T  DV V        A+ FG   + Q ++   Y  
Sbjct: 368 RLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH 427

Query: 393 TRVTREEY 400
           T+   EEY
Sbjct: 428 TKKDYEEY 435

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 111/248 (44%), Gaps = 37/248 (14%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +     A++V+ +          Q+K +     + + +  E
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVVEN----------QEKTR----RKVVDIGYE 308

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++F R
Sbjct: 309 RFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 367

Query: 348 RLATELQRQC--------------PTDWDVCVSVPNASDTAL-FGWDSMRQFSQTTAYQQ 392
           RL  +L+                  T  DV V        A+ FG   + Q ++   Y  
Sbjct: 368 RLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH 427

Query: 393 TRVTREEY 400
           T+   EEY
Sbjct: 428 TKKDYEEY 435

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 95/187 (50%), Gaps = 22/187 (11%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R    +D ++     I
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 268

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +     A++++ +         K++ QK     + + +  E
Sbjct: 269 KQEYCYVCPDIVKEFNKFDRDATKFAQFIVEN---------KEKTQK-----KVVDVGYE 314

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++F R
Sbjct: 315 RFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 373

Query: 348 RLATELQ 354
           RL  +L+
Sbjct: 374 RLQRDLR 380

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 114/248 (45%), Gaps = 37/248 (14%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     I
Sbjct: 216 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 273

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F ++ +  A++++ +          + KQK+      + +  E
Sbjct: 274 KQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN--------QDKTKQKV------VDIGYE 319

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   +  +I   P  +R  + +N V++GG+   ++F+R
Sbjct: 320 RFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSR 378

Query: 348 RLATELQRQC--------------PTDWDV-CVSVPNASDTALFGWDSMRQFSQTTAYQQ 392
           RL  +++                  T  DV  +S     +   FG   + Q ++  +Y  
Sbjct: 379 RLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH 438

Query: 393 TRVTREEY 400
           T+   EEY
Sbjct: 439 TKKDYEEY 446

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 85/369 (23%), Positives = 158/369 (42%), Gaps = 72/369 (19%)

Query: 10  NGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQF------------ 57
           +GS    FG +T++T F +L++      G+  +SN ++  +   ++ F            
Sbjct: 66  SGSGRQYFGNSTSATAFNSLSS------GSALMSNNLAGKRGTEDLDFYIGNEALIAAQG 119

Query: 58  -----RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
                  P   GQ+ +W+     W+  +     F +     +    +L+E  ++ PE  +
Sbjct: 120 PSYGLSYPIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHCFLLTEPPLNPPENRE 174

Query: 113 GTDQVVFEEYEFGSCF-KGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQ 171
              ++ FE +     +        +  +W +            V  +  TG         
Sbjct: 175 QVAEIFFESFNCAGLYIAVQAVLALAASWTS----------SKVIDRSLTG--------- 215

Query: 172 LVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNN 230
            VIDSG   T V+P+ +G     AIK + I GR +  F+++ L  R     D ++     
Sbjct: 216 TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEEDTSLRTAER 273

Query: 231 IKEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
           IK++  ++ P  V  FN F +  +  A++V+            Q+K +     + + +  
Sbjct: 274 IKQEYCYVCPDIVKEFNKFDRDSEKFAQFVVE----------SQEKTR----RKVVDVGC 319

Query: 289 ELFSIPETFFHPEIAS--LLKPGIVETILE-SISMLPEAIRPLMVSNTVVTGGNFNIRNF 345
           E F  PE FF+PEIAS   L P  + TI++ +I   P  +R  + +N V++GG+   ++F
Sbjct: 320 ERFMAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDF 377

Query: 346 ARRLATELQ 354
            RRL  +L+
Sbjct: 378 GRRLQRDLK 386

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 111/248 (44%), Gaps = 37/248 (14%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +     A++V+ +          Q+K +     + + +  E
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVVEN----------QEKTR----RKVVDIGYE 308

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++F R
Sbjct: 309 RFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 367

Query: 348 RLATELQRQC--------------PTDWDVCVSVPNASDTAL-FGWDSMRQFSQTTAYQQ 392
           RL  +L+                  T  DV V        A+ FG   + Q ++   Y  
Sbjct: 368 RLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH 427

Query: 393 TRVTREEY 400
           T+   EEY
Sbjct: 428 TKKDYEEY 435

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 93/187 (49%), Gaps = 22/187 (11%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F+++ L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +     A++V+            Q+K +     + + +  E
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDASKFAQFVVE----------SQEKTR----KKIVDVGYE 313

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   + E+I   P  +R  + +N V++GG+   ++F R
Sbjct: 314 RFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 372

Query: 348 RLATELQ 354
           RL  +++
Sbjct: 373 RLQRDMK 379

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 116/249 (46%), Gaps = 39/249 (15%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R    +D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 271

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +     +++++ +     QG  K QK       + + +  E
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN-----QG--KTQK-------KIVDVGYE 317

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILE-SISMLPEAIRPLMVSNTVVTGGNFNIRNFA 346
            F  PE FF+PEIAS   L P  + TI++ +I   P  +R  + SN V++GG+   ++F 
Sbjct: 318 RFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKDFG 375

Query: 347 RRLATELQRQC--------------PTDWDV-CVSVPNASDTALFGWDSMRQFSQTTAYQ 391
           RRL  +L+                  T  DV  +S     +   FG   + Q ++  +Y 
Sbjct: 376 RRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYC 435

Query: 392 QTRVTREEY 400
            T+   EEY
Sbjct: 436 HTKRDYEEY 444

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 93/423 (21%), Positives = 165/423 (39%), Gaps = 61/423 (14%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTP-FRALNALARDKYGNPHLSNQVSRLKDISN------- 54
           + P+++DNGS  +K G +    P     + +   KY         S  + I N       
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKMRG 68

Query: 55  -VQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKG 113
            ++   P E G +  W     +W +  YN    + ++ N +   ++++E  ++  +    
Sbjct: 69  LLKLHYPLEHGVVQDWPGLEQLWTHVFYN----SLKLANIEEHPMLITEAPLNPMKNRNK 124

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
             +++FE   FGS                     +Y    +V    + G          V
Sbjct: 125 MCEMLFET--FGS-------------------PAVYVSIQAVLALYAGGRTT-----GCV 158

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETL---SFRHYNVMDETILVNN 230
           ID G  C   VP+  G     AI+++D+ GR +  FL+  L   S    +   E  +V  
Sbjct: 159 IDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREIVRM 218

Query: 231 IKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDEL 290
           IKEK  F++     N  Q  E   +     + +T F         K+P D + + L  E 
Sbjct: 219 IKEKACFVA-TDVGNEEQNYEGANS----AELETRF---------KLP-DGKILTLGAEK 263

Query: 291 FSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLA 350
           F  PE  F P +       I E   +SIS +   +R  + S+ V++GG+     F  RL 
Sbjct: 264 FRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGDRLL 323

Query: 351 TELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTK 410
           +E+++    +  + +  P     +   W      +  + +++  VTR E+ E+    C  
Sbjct: 324 SEIRKTSEPNTKIKIFAPPERKYST--WIGGSILAGLSTFEKLWVTRAEWQEN--PQCIH 379

Query: 411 QRF 413
            RF
Sbjct: 380 SRF 382

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 96/187 (51%), Gaps = 22/187 (11%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 267

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +  +  A++V+ + +++        ++KI      + +  E
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST--------RKKI------VDVGYE 313

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   + ++I   P  +R  + +N V++GG+   ++F R
Sbjct: 314 RFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 372

Query: 348 RLATELQ 354
           RL  +L+
Sbjct: 373 RLQRDLK 379

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 113/248 (45%), Gaps = 37/248 (14%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R    +D ++     I
Sbjct: 218 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 275

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++ P  V  FN F +     A++++ +         ++Q +K     + + +  E
Sbjct: 276 KQEYCYVCPDIVKEFNKFDRDGSKFAQFIVEN---------QEQTRK-----KVVDVGYE 321

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            F  PE FF+PEIAS   L P +   +  +I   P  +R  + +N V++GG+   ++F R
Sbjct: 322 RFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 380

Query: 348 RLATELQRQC--------------PTDWDV-CVSVPNASDTALFGWDSMRQFSQTTAYQQ 392
           RL  +L+                  T  DV  +S     +   FG   + Q ++  +Y  
Sbjct: 381 RLQRDLKSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH 440

Query: 393 TRVTREEY 400
           T+   EEY
Sbjct: 441 TKKDYEEY 448

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 94/427 (22%), Positives = 176/427 (41%), Gaps = 69/427 (16%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTP----FRALNALARDKYGNPHLS-------NQVSRLKD 51
           + P+++DNGS  +K G +    P    +  +     DK     LS       N+  + + 
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRG 68

Query: 52  ISNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELS 111
           +  +Q+  P E G +  W     +W +  Y+  + N    N     ++++E  ++  E  
Sbjct: 69  LLRLQY--PVEHGIVQDWSGLEQLWTHVFYSSLKLN----NIGDHPMLVTEAPLNPLENR 122

Query: 112 KGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNM-IYAKEDSVYRKDSTGERNEYNDF 170
               ++++E +             VP  + +++  + +YA         +TG        
Sbjct: 123 DKMCEMLYETFN------------VPAVYVSIQAVLALYAG------GRTTG-------- 156

Query: 171 QLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGR----FLNGFLKETLSFRHYNVMDETI 226
             VID G  C   VP+  G     AI+++D+ GR    FL   L++++     +  +  I
Sbjct: 157 -CVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREI 215

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKL 286
            V  IKEK  +++P           +  AE        S +G  +  K K+P D + + L
Sbjct: 216 -VRMIKEKACYVAP-----------EVAAE---EQKYASSRGSEELTKFKLP-DGKILSL 259

Query: 287 YDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFA 346
             E F  PE  F P++       I +   +SIS +   +R  + S+ V++GG+     F 
Sbjct: 260 GAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAGFG 319

Query: 347 RRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVD 406
            RL  EL+ +C  +  + +  P     ++  W      +  + +++  VTR E+ E+   
Sbjct: 320 DRLLNELRSRCEPNVKIKIFAPPERKYSV--WIGGSILAGLSTFEKIWVTRSEWQEN--P 375

Query: 407 WCTKQRF 413
            C   RF
Sbjct: 376 QCVHSRF 382

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/363 (21%), Positives = 151/363 (41%), Gaps = 61/363 (16%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALN--ALARDKY---------GNPHLSNQVSRLKDIS 53
           P++IDNGS  +K G +    P +AL    +   KY         G+  + N   +L+ + 
Sbjct: 14  PVVIDNGSGIIKAGFSGEERP-KALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL- 71

Query: 54  NVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKH-LVLSEMCMSMPELSK 112
            ++ R P + G +  W+    IW Y L    +         G+H L+++E  M+  +  +
Sbjct: 72  -LKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQ-----NIGEHPLLITEAPMNPLKNRE 125

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
              QV+FE ++  +                     +Y    +V    ++G          
Sbjct: 126 QMAQVLFETFDVSA---------------------LYVSNPAVLSLYASGRTT-----GC 159

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIK 232
           V+D G      VPI  G     ++ ++DIGG      + E L F+       ++  ++ +
Sbjct: 160 VVDCGEGYCSTVPIYDGFALPASMMRMDIGG----ADITEQLQFQLRKSAGVSLFSSSER 215

Query: 233 EKCLFMS-PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELF 291
           E    M   V Y     KKE+        D  ++F         K+P D + I++ ++ +
Sbjct: 216 EIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTF---------KLP-DGRCIEVGNDRY 265

Query: 292 SIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLAT 351
             PE  F P+I  L   G+ +  ++SI  +   +R  ++S+ +++GG   ++ F  R+  
Sbjct: 266 RAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLW 325

Query: 352 ELQ 354
           +L+
Sbjct: 326 DLE 328

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 88/421 (20%), Positives = 176/421 (41%), Gaps = 79/421 (18%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSN-QVSRLKDISNV-------- 55
           P+++DNGS  +K G + + TP      +A    G P       + L+D + V        
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMA----GKPRYKKVMTTGLEDRTFVGNEAQRLR 68

Query: 56  ---QFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTK-GKH-LVLSEMCMSMPEL 110
                RRP   G++T+W+    +W +  Y+  +     GN++ G H L+++E  ++  + 
Sbjct: 69  GLLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQ--GNSQIGDHPLLITEAPLNSTKN 126

Query: 111 SKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDF 170
            +   ++++E                 FN+ AL     Y    +V    +TG+       
Sbjct: 127 RETMCEILYE----------------TFNFDAL-----YVAHPAVLSLYATGQTT----- 160

Query: 171 QLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGR----FLNGFLKETLSFRHYNVMDETI 226
             V++ G   +   P+ +G     +I+++DIGGR     L  +++++     ++  ++ I
Sbjct: 161 GCVLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEI 220

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQ-----KIPEDS 281
            V  IKEK                    A YV  D++   + +   +++     K+P D 
Sbjct: 221 -VRTIKEK--------------------ANYVALDYKFEEEKFFIHERENTSTVKLP-DG 258

Query: 282 QTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFN 341
           Q +      +   E  F P++       + E +LESI+ +   +R  ++ N V++GG   
Sbjct: 259 QELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTM 318

Query: 342 IRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYY 401
           ++ F +R  +E ++  P      V + + ++ +   W      S    ++   +TRE Y 
Sbjct: 319 LKGFDQRTMSETKKMLPK--HTKVKIRSLAERSYIAWIGGSILSGLYGFRNLWLTREMYE 376

Query: 402 E 402
           E
Sbjct: 377 E 377

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 85/418 (20%), Positives = 173/418 (41%), Gaps = 73/418 (17%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTP--FRALNALARDKYG---------NPHLSNQVSRLKD 51
           + P++IDNG+  +K G   +  P  F+  N +   K+          N ++ N+    + 
Sbjct: 8   NQPVVIDNGTGVLKVGFVGDDKPKCFQH-NIVGTPKFDKVMIGGLDDNMYIGNKAQENRG 66

Query: 52  ISNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELS 111
           +  ++ R P E G++  W+    +W + L +    +  I + +   ++++E  ++  +  
Sbjct: 67  L--LRLRHPMEHGEVKHWDEMEAVWKHTLLH----DLNIQHIEEHPILITEAPLNSSKNR 120

Query: 112 KGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQ 171
           +   +++FE                 FN  A     I+ +  +V    S G         
Sbjct: 121 EHMCEILFES----------------FNIPA-----IHVENPAVLALYSGGRTT-----G 154

Query: 172 LVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVM-------DE 224
            VID G      VPI +G     +I+++DIGGR +     E L F+    +       +E
Sbjct: 155 CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQFQIRKSVGMSLFSSNE 210

Query: 225 TILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
             +V  IKE+  +++     +   K+E    +Y+L     S        K K+P D +++
Sbjct: 211 KEIVRTIKERACYVA-----DDISKEEH---KYILDSESNS-------SKFKLP-DGKSL 254

Query: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344
            + +  F   E  F+P +       + E + +++S +   +RP++  + V+ GG   +  
Sbjct: 255 SIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPG 314

Query: 345 FARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYE 402
           F  R+  EL  Q  T  D  + +  + +     W      +  + +Q+  VT+  + E
Sbjct: 315 FGNRILKEL--QILTKQDTKLRIIASPERKYTTWIGGSILAGLSTFQKILVTKSNWNE 370

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 96/188 (51%), Gaps = 24/188 (12%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNI 231
           VIDSG   T V+P+ +G     AIK + I GR +  F++  L  R     D T+     I
Sbjct: 201 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERI 258

Query: 232 KEKCLFMSP--VSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
           K++  ++    V  FN F +  +  A++++ + +        + ++K+      I +  E
Sbjct: 259 KQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSE--------KTRRKV------IDVGYE 304

Query: 290 LFSIPETFFHPEIAS--LLKPGIVETIL-ESISMLPEAIRPLMVSNTVVTGGNFNIRNFA 346
            F  PE FF+PEIAS   L P  + TI+ ++I   P  +R  + +N V++GG+   ++F 
Sbjct: 305 RFLAPEIFFNPEIASSDFLTP--LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 362

Query: 347 RRLATELQ 354
           RRL  +L+
Sbjct: 363 RRLQRDLK 370

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 81/354 (22%), Positives = 148/354 (41%), Gaps = 57/354 (16%)

Query: 17  FGPATNSTPFRALNALA------RDKYGNP----HLSNQVSRLKDISNVQFRRPHELGQL 66
           FG +T++T F +L + A        K G      ++ N+        +     P   GQ+
Sbjct: 64  FGNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSYSLSYPIRHGQV 123

Query: 67  TSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEYEFGS 126
            +W+     W+  +     F +     +    +L+E  ++ PE  +   ++ FE +    
Sbjct: 124 ENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAG 178

Query: 127 CF-KGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNCTWVVP 185
            +        +  +W +            V  +  TG          VIDSG   T V+P
Sbjct: 179 LYIAVQAVLALAASWTS----------SKVVDRSLTGT---------VIDSGDGVTHVIP 219

Query: 186 IVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-LVNNIKEKCLFMSP--VS 242
           + +G     AIK + I GR +  F++  L  R     D T+     IK++  ++    V 
Sbjct: 220 VAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERIKQEYCYVCSDIVK 277

Query: 243 YFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHPEI 302
            FN F +     A++++ + +        + K+K+      I +  E F  PE FF+PEI
Sbjct: 278 EFNKFDRDPQKFAQFIVENSE--------KTKRKV------IDVGYERFLAPEIFFNPEI 323

Query: 303 AS--LLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQ 354
           AS   L P +   + ++I   P  +R  + +N V++GG+   ++F RRL  +L+
Sbjct: 324 ASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 376

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 81/415 (19%), Positives = 162/415 (39%), Gaps = 72/415 (17%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKD----ISNVQFR 58
           + P+I+DNGS  +K G A +  P    + L     GNP     +  + +    I N  + 
Sbjct: 10  NQPVILDNGSSVIKAGFAGSQQP----DVLEYAWIGNPLAERSMVTVSNKETYIGNSAYE 65

Query: 59  R--------PHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPEL 110
           R        P+    + SW+    +WDY L N      EI   +   +VL+    +  + 
Sbjct: 66  RRATLHLESPYSTNAIMSWDRLEDLWDYVLLN----KLEIEQLQEHPVVLTNSMSTSKKE 121

Query: 111 SKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDF 170
            +   +V+FE++   +                     IY   D +      G     +  
Sbjct: 122 EEKMCEVLFEKFSIPA---------------------IYCSRDPIMSLYGLGRTTGCS-- 158

Query: 171 QLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH---YNVMDETIL 227
              +  G     +  ++ G+    + +  + GG  +   + + L   H    N  +   L
Sbjct: 159 ---VSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIEL 215

Query: 228 VNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLY 287
           + +IKE+C  +S   ++N  +  E  T++                 K ++P D   I++ 
Sbjct: 216 IRSIKERCCVLSK-DFYNEIRAYELITSK-------------TSNNKYRLP-DGNIIEIG 260

Query: 288 DELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFAR 347
            E F  PE  F+P+     +  + + I+ SIS      R  ++ + V++GG+  I+ F  
Sbjct: 261 SERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGE 320

Query: 348 RLATELQRQCPTDWDVCVSVPN-------ASDTALFGWDSMRQF-SQTTAYQQTR 394
           RL  E++++   +  + ++ P+          + L G  +M+      +AY++ +
Sbjct: 321 RLTKEIRKEIDGNQKIMLNAPHERRFLPWIGGSVLSGLSTMKLLWKSKSAYREDK 375

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 91/411 (22%), Positives = 164/411 (39%), Gaps = 63/411 (15%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNV------- 55
           + PI++DNGS  +K G   +  P     +L      +  +   V + K + N+       
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL 70

Query: 56  -QFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGT 114
            + R P + G + +WE    +WD+   +      ++ N     LV++E  ++     +  
Sbjct: 71  LKLRYPMDHGIIENWEHMETVWDHIFKD----CLKVSNLGEHPLVVTEAPLNPKPNREKM 126

Query: 115 DQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVI 174
            + +FE                 FN  AL     Y    +V    ++G          V+
Sbjct: 127 CETLFES----------------FNIPAL-----YIANPAVLSLYASGRTT-----GCVV 160

Query: 175 DSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVM-----DETILVN 229
           ++G      VPI +G     +I+++DIGGR +   L+  L  R    M      E  +V 
Sbjct: 161 EAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLRKSTGMWLYSSSEQEIVR 218

Query: 230 NIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
            IKE         Y  S  KKE+   E  L D +       K    K+P D + + +   
Sbjct: 219 LIKENG------CYICSNHKKEE---EKFLLDQEK------KSISFKLP-DGKNLVIGPG 262

Query: 290 LFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRL 349
            F  PE  F+P +       + + I++SIS +   +R  +++N  ++GG+   + F  RL
Sbjct: 263 RFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMFQGFCDRL 322

Query: 350 ATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEY 400
            TEL         V +  P     + F   S+   +  + ++   VT++++
Sbjct: 323 ITELDFSVDKTTKVRILAPPERKYSAFIGGSI--LANLSTFRNMWVTKDQW 371

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 66/151 (43%), Gaps = 16/151 (10%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIVE----TILESISMLP---EA 324
           P DS+ +       L  E   +PE  F P IA   + GI E     +L+     P    A
Sbjct: 596 PHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSA 655

Query: 325 IRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQF 384
               MV+N  +TGGN  I     R+  E     P      +SV  + D +L  W  M + 
Sbjct: 656 ASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAG--TPLSVHMSEDPSLDAWKGMAKL 713

Query: 385 SQT-TAYQQTRVTREEYYEHGVDWCTKQRFG 414
           +   T Y+ T VTR+EY E+G D+  + + G
Sbjct: 714 ANNETDYKNTAVTRKEYEEYGPDYIKEHKLG 744

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 12/135 (8%)

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESISMLP--------EAIRPLMVSNTVVTGGNF 340
           E   +PE  F P +  L + GI+E + E+I M           ++   M +N  +TGGN 
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIE-LSETIIMNKFGSSRRQLSSVSQEMANNVFLTGGNV 668

Query: 341 NIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQT-TAYQQTRVTREE 399
            +     R+  E     P      + V  ASD A+  W  M +F+Q+ T Y+ + VT++E
Sbjct: 669 RVPGLRDRIVREFTEFLPVGTKYNIKV--ASDPAIDAWKGMAKFAQSSTDYKGSYVTKKE 726

Query: 400 YYEHGVDWCTKQRFG 414
           Y E+G D+  + + G
Sbjct: 727 YEEYGPDYIKEHKLG 741

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 87/222 (39%), Gaps = 34/222 (15%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLS--NQVSRLKDISNVQF 57
           + PI ID GS EV+ G    S P   F       RD+  N   +     + L+     Q 
Sbjct: 36  NVPIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTFTFVGNDTNLEQTLRTQS 95

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWE-IGNTKGKHLVLSEMCMSMPELSKGTDQ 116
           R P +   +T+W+    + +Y   +      + I N     ++L+E   ++        Q
Sbjct: 96  RSPFDGPMITNWDYVEDMMEYTFNHLGVVGHDGISNP----ILLTEKMATLQSQRSNWYQ 151

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE      CF  P   F       ++    Y   +   + DSTG         LVI S
Sbjct: 152 LMFE------CFGVPKLTF------GIDSLFSYFANN---QSDSTG---------LVISS 187

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           G   T V+P+V G       K+++ GGR    +    LS ++
Sbjct: 188 GNEDTNVIPVVCGKGILSEAKRINWGGRHSVEYTTNLLSLKY 229

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 68/152 (44%), Gaps = 18/152 (11%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIVE--------TILESISMLPE 323
           P DS+ I       L  E   +PE  F P +A L + G+ E            + S L E
Sbjct: 592 PHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSE 651

Query: 324 AIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQ 383
             + L  +N  +TGGN  +     R+  E     P   ++ V +  ASD+A+  W  M +
Sbjct: 652 GSKKL-AANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRM--ASDSAVDAWRGMAK 708

Query: 384 FSQT-TAYQQTRVTREEYYEHGVDWCTKQRFG 414
            SQ  + Y+ + +TR+EY E G D+  +   G
Sbjct: 709 LSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 93/221 (42%), Gaps = 32/221 (14%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRAL-NALAR--DKYGNPHLS--NQVSRLKDISNVQF 57
           + PI ID GS EV+ G      P     N ++R  D+  N +L+     + L      Q 
Sbjct: 36  NVPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQA 95

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQV 117
           + P++   +++W+    I +Y  ++         +     ++++E   ++    +   Q+
Sbjct: 96  KSPYDGAIVSNWDYTEEIMEYTFHH---LGVNGNDGVSNPILMTEKLATLQSQRENWYQL 152

Query: 118 VFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSG 177
           +FE      CF  P    V F   +L     YA  D+     ++G         LVI+SG
Sbjct: 153 LFE------CFGVPQ---VTFGIDSL--FSFYANNDAT----ASG---------LVINSG 188

Query: 178 FNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
              T V+P++ G       K+++ GGR    +L   L+ ++
Sbjct: 189 NEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLLALKY 229

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 73/156 (46%), Gaps = 18/156 (11%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIVETILESISMLP--------E 323
           P DS+ I       L  E   +PE  F P +    + GI E + E+I M           
Sbjct: 600 PHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICE-LSETILMKKFGSQRGKLS 658

Query: 324 AIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQ 383
           +    MV+N ++TGGN  +     R+  E     P   +V V++  +S+ +L  W  M  
Sbjct: 659 STSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNI--SSNPSLDAWRGMAA 716

Query: 384 FSQTTA-YQQTRVTREEYYEHGVDWCTKQRFGYQKW 418
            ++  A Y++T +++EEY E+G D+  + + G  K+
Sbjct: 717 LARNKAEYKKTVISKEEYEEYGPDYIKEHKLGNTKY 752

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 86/225 (38%), Gaps = 43/225 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRAL-NALA--RDK--------YGNPHLSNQVSRLKDIS 53
           PI ID GS  ++ G    +TP     N L   RD+         GN  L +Q  R     
Sbjct: 39  PIAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVR----- 93

Query: 54  NVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKG 113
             Q R P +   +T+W     I DY  ++         N     ++L+E   ++      
Sbjct: 94  -SQSRSPFDGPFVTNWNFTEEIMDYTFHH---LGVLPNNGISNPILLTERMATVQSQRAN 149

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
             Q++FE Y         V G V F   +L          S Y  + +G     N   LV
Sbjct: 150 WYQILFETYN--------VPG-VTFGIDSLY---------SFYNNNPSG-----NKTGLV 186

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           ID     T VVPIV G       K+++ GG     +L + ++ ++
Sbjct: 187 IDCSHEDTSVVPIVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 71/156 (45%), Gaps = 16/156 (10%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIVE---TIL----ESISMLPEA 324
           P DS+ I       +  E   +PE  F P I  L + G+VE   T+L    +S      A
Sbjct: 597 PHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSA 656

Query: 325 IRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQF 384
               M  N  +TGGN  +     R+  E     P   ++ V++  A D +L  W  M +F
Sbjct: 657 TCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTL--AKDPSLSAWKGMAKF 714

Query: 385 -SQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
            S  T+Y+ + +T+ EY E+G ++  +   G  K++
Sbjct: 715 ASDPTSYKSSILTKREYEEYGPEYIKEHNLGNAKFM 750

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 84/222 (37%), Gaps = 32/222 (14%)

Query: 2   DDTPIIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLS--NQVSRLKDISNVQ 56
           D  PI ID GSYEV+ G   N  P   F    A  RD+  +   +   + + L      Q
Sbjct: 39  DGGPIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYTFVGRDTGLDASIRTQ 98

Query: 57  FRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQ 116
            R P +   +T+W+    +  Y  ++        G      +VL+E   ++        +
Sbjct: 99  SRSPFDGPMVTNWDYVDDMLAYTFHH---LGVRGGGGVPNAVVLTERLATLQSQRANWYE 155

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           +++E Y       G  + F  +  +                  STG         LV+ S
Sbjct: 156 LLYEAYNLQEVTFGIDSLFSFYGERG---------------PGSTG---------LVVSS 191

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           G   T VVP+V G       K+++ GG+    +L   L+ ++
Sbjct: 192 GNEDTCVVPVVDGRGVVSEAKRINWGGQQAVDYLTGLLALKY 233

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 71/152 (46%), Gaps = 18/152 (11%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIVETILES--------ISMLPE 323
           P DS+ I       L  E   +PE  F P +  L + GI+E I E+              
Sbjct: 592 PHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSELS 650

Query: 324 AIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQ 383
           +I   + SN  +TGGN  +     R+  E +   P   ++ V +  A+D AL  W  M +
Sbjct: 651 SISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRM--ANDCALDAWRGMAK 708

Query: 384 FSQTTA-YQQTRVTREEYYEHGVDWCTKQRFG 414
            S+T + ++ T VTR+EY+E+G D+  +   G
Sbjct: 709 LSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLG 740

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 96/225 (42%), Gaps = 40/225 (17%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRAL-NALARDKYGNPHLSNQVSRLKDISNV------ 55
           +T I ID GS EV+ G      P     N +AR  + +  L+  ++ + + +N+      
Sbjct: 36  ETAIAIDFGSSEVRAGYGNQERPSHIFPNRIAR--WRDRKLNRNLTFIGNDTNLDLSVRS 93

Query: 56  QFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKG--KHLVLSEMCMSMPELSKG 113
           Q R P++   +T+W+    I +Y  ++       +  T G    ++++E   ++      
Sbjct: 94  QSRSPYDGALVTNWDYTEDIMEYTFHH-----LGVKGTDGIPNPIIMTEKLGALHSQRDN 148

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
             Q++FE      CF  P    V F   +L     YA  D+     ++G         LV
Sbjct: 149 WYQLLFE------CFGAPQ---VTFGLDSL--FSFYANNDA----SASG---------LV 184

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           I SG   T ++P+V G       K+++ GGR    +L   L+ ++
Sbjct: 185 ISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLLALKY 229

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 71/156 (45%), Gaps = 16/156 (10%)

Query: 278 PEDSQ------TIKLYDELFSIPETFFHPEIASLLKPGIVE----TILESISMLPEAIRP 327
           P DS+       I L  E   +PE  F P +  L + GI E     +L      P+ +  
Sbjct: 599 PHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSE 658

Query: 328 L---MVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQF 384
           L   M +N  +TGGN  I     R+  E +   P +    V++   SD     W+ M + 
Sbjct: 659 LSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNM--TSDPTFDAWNGMAKL 716

Query: 385 SQT-TAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
           +Q  T Y++T ++++EY E+G ++  + + G  K+ 
Sbjct: 717 AQNETDYKKTIISKKEYEEYGPEYIKEHKLGNMKYF 752

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 72/156 (46%), Gaps = 16/156 (10%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIVE----TILESISMLPEAIRP 327
           P DS+ I       L  E   +PE  F P +    + GI E     +L+     P  +  
Sbjct: 600 PHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQ 659

Query: 328 L---MVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQF 384
               MV+N ++TGGN  +     R+  E     PT  ++ V++  +SD +L  W  M   
Sbjct: 660 TSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNM--SSDPSLDAWKGMAAL 717

Query: 385 SQTTA-YQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
           ++    Y++T ++++EY E+G ++  + + G  K+ 
Sbjct: 718 ARNEEQYRKTVISKKEYEEYGPEYIKEHKLGNTKYF 753

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 90/230 (39%), Gaps = 51/230 (22%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRAL-NALA--RDK--------YGNPHLSNQVSRLKDI 52
           +PI ID GS +++ G   ++TP     NAL   RD+         GN  L +Q  R    
Sbjct: 38  SPIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVR---- 93

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYN----PDEFNWEIGNTKGKHLVLSEMCMSMP 108
              Q R P +   +T+W L   I DY  ++    PD       N     ++L+E   ++ 
Sbjct: 94  --SQSRSPFDGPFVTNWNLTEEILDYTFHHLGVVPD-------NGIPNPILLTERLATVQ 144

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
                  Q++FE Y       G  + F                  S Y  + +G     N
Sbjct: 145 SQRTNWYQILFETYNVPGVTFGIDSLF------------------SFYNYNPSG-----N 181

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
              LVI  G   T V+P+V G       K+++ GG     +L + ++ ++
Sbjct: 182 KTGLVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 69/156 (44%), Gaps = 16/156 (10%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIVE----TILESISMLPEAIRP 327
           P DS+ I       L  E   +PE  F P +    + GI E     +L+     P  +  
Sbjct: 600 PHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSS 659

Query: 328 L---MVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQF 384
               MV+N  +TGGN  +     R+  E     P   +  V++  +SD +L  W  M   
Sbjct: 660 TSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNM--SSDPSLDAWKGMAAL 717

Query: 385 SQTTA-YQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
           +Q    Y++T ++++EY E+G D+  + + G  K+ 
Sbjct: 718 AQNKEEYKKTVISKKEYEEYGPDYIKEHKLGNMKYF 753

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 90/225 (40%), Gaps = 43/225 (19%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRAL-NALA--RDK--------YGNPHLSNQVSRLKDIS 53
           PI ID GS +++ G    + P     N L   RD+         GN  L +Q  R     
Sbjct: 39  PIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVR----- 93

Query: 54  NVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKG 113
             Q R P +   +T+W     I DY  ++         N     ++L+E   ++      
Sbjct: 94  -SQSRSPFDGPFVTNWNFTEEIMDYTFHH---LGVSPNNGVRNPILLTERMATVQSQRAN 149

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
             Q++FE Y         V G V F   +L     Y      Y ++++G     N   LV
Sbjct: 150 WYQIMFETYN--------VPG-VTFGIDSL-----YG----FYNQNTSG-----NKTGLV 186

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           ID G   T V+P+V G       K+++ GGR    +L + ++ ++
Sbjct: 187 IDCGHEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 69/151 (45%), Gaps = 16/151 (10%)

Query: 278 PEDSQT------IKLYDELFSIPETFFHPEIASLLKPGIVE----TILESISMLPE---A 324
           P DS+       + L  E   +PE FF P +    + G+ E     +L      P    +
Sbjct: 595 PHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSS 654

Query: 325 IRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQF 384
           I   M  N  VTGGN  I     R+  E     P +    V++  +SD +L  W  M ++
Sbjct: 655 ITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNI--SSDPSLDAWRGMAKY 712

Query: 385 SQT-TAYQQTRVTREEYYEHGVDWCTKQRFG 414
           +Q  T Y+++ ++++EY E+G D+  + + G
Sbjct: 713 AQNETDYKKSFISKKEYEEYGPDYIKEHKLG 743

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 85/222 (38%), Gaps = 34/222 (15%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRAL-NALARDKYGN-----PHLSNQVSRLKDISNVQ 56
           D PI +D GS +++ G    +TP     N + R +          + N V+ L      Q
Sbjct: 36  DVPIAVDFGSNQLRAGLINRATPSHVFTNRITRFRDRKLMKTMTFIGNDVN-LDQAVRAQ 94

Query: 57  FRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQ 116
            + P +   +T+W+    I +Y     +       N     ++++E   ++        Q
Sbjct: 95  SKSPFDGPMVTNWDYVEDILEYTF---NHLGSTPNNGISNPILVTERLATLQTQRSSWYQ 151

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           V+FE      CF  P   F       ++    Y +  +    +STG         LVI  
Sbjct: 152 VLFE------CFNVPGVTF------GIDSLFAYYQNTTA---NSTG---------LVIGC 187

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           G   T ++P+V G       K+++ GG     +L   ++ ++
Sbjct: 188 GNEDTNIIPVVDGQGMLTEAKRINWGGSQAADYLTNLMTLKY 229

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 18/157 (11%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPL--- 328
           P DS+ I       L  E   +PE  F P +    + GI E + E+I +     +P    
Sbjct: 600 PHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICE-LAETILLKKFGSQPGKLS 658

Query: 329 -----MVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQ 383
                M +N  +TGGN  +     R+  E     P   ++ +++  +SD +L  W  M  
Sbjct: 659 QTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININM--SSDPSLDAWKGMAA 716

Query: 384 FSQTTA-YQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419
            +Q    Y++T ++R+EY E+G D+  + + G  K+ 
Sbjct: 717 LAQNEEEYKRTIISRKEYEEYGPDYIKEHKLGNTKYF 753

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 14/141 (9%)

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESISM---------LPEAIRPLMVSNTVVTGGN 339
           E   +PE  F P I  L + GIVE + E++ +         L E I  +M  N  +TGGN
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGSNRRELSE-ISKMMAKNIFITGGN 666

Query: 340 FNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTA-YQQTRVTRE 398
             +     R+  E     P   ++ V +  A D ++  W  M +F+  T+ Y+ + +T++
Sbjct: 667 AKLPGIRERVVREFTGFLPVGTNLNVKL--AEDPSMSAWRGMAKFANNTSLYETSIMTKK 724

Query: 399 EYYEHGVDWCTKQRFGYQKWL 419
           EY E G ++  +   G  K++
Sbjct: 725 EYEELGPEYIKEHNLGNAKFV 745

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 90/224 (40%), Gaps = 38/224 (16%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRAL-NALARDKYGNPHLSNQVSRLKDISNV------ 55
           DTPI ID GSYEV+ G      P     N LAR  Y +   S   + + + +N+      
Sbjct: 36  DTPIAIDFGSYEVRAGYVNQGDPALVFTNRLAR--YRDRKASRTYTFVGNDTNLDQSIRT 93

Query: 56  QFRRPHELGQLTSWELQSCIWDYCLYNPD-EFNWEIGNTKGKHLVLSEMCMSMPELSKGT 114
           Q + P +   +T+W+    I  Y  ++ D   N  + N     ++++E   ++       
Sbjct: 94  QSKSPFDGSMITNWDYVDDILAYTFHHLDVRGNGGVPNP----VLITERMAALQSQRSNW 149

Query: 115 DQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVI 174
            +++FE Y       G  + F                  S Y +   G         + I
Sbjct: 150 YELLFECYNLQKVTFGIDSLF------------------SFYGEHPPGTTG------IAI 185

Query: 175 DSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           +SG   T V+P+V G       K+++ GG+   G+L   LS ++
Sbjct: 186 NSGNEDTSVIPVVNGKGILTEAKRINWGGQQSVGYLNGLLSLKY 229

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 92/413 (22%), Positives = 154/413 (37%), Gaps = 66/413 (15%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRAL--NALARDKYGNPHLSNQVSRLKDISN-------- 54
           PI+IDNG+  +K G  T  T  R L  + +   KY     SN +     I N        
Sbjct: 14  PIVIDNGTNVIK-GGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI 72

Query: 55  VQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGT 114
           ++ R P   G + +W+    IW Y     D    E  N   +H +L    ++ P L+   
Sbjct: 73  LKLRHPMLRGVVQNWDDMETIWQYVF--DDTLYLENLN---EHPIL----ITEPPLNNMA 123

Query: 115 DQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVI 174
           ++    E           A F  F + A     +Y     V    ++G+          +
Sbjct: 124 NRQKMCE-----------ALFEIFGFPA-----VYISVSPVLSLYASGQTT-----GCAV 162

Query: 175 DSGFNCTWVVPIVKGIPYYKAIKKLDIGG-----RFLNGFLKETLSFRHYNVMDETILVN 229
           D G      +P+  G     ++KK+DIGG     +     LK T  F + +   E  +V 
Sbjct: 163 DCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSS--SEREIVR 220

Query: 230 NIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDE 289
            IKEK  +++                +Y L   +  F       + K+P D + + +   
Sbjct: 221 TIKEKVCYIA---------------TDYNLETEKYLFNEEKMASQFKLP-DGKMLNISQG 264

Query: 290 LFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRL 349
            ++  E  F PE+       + E   +SI  +   +R  + SN V++GG      F  RL
Sbjct: 265 KYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCPGFGSRL 324

Query: 350 ATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYE 402
             ELQ    T +D  + +    +     W      S  + + +  VT+  + E
Sbjct: 325 LKELQTL--TGYDTKIRIIAPPERKYTSWIGGSILSGLSTFSKIWVTKSMWEE 375

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 95/225 (42%), Gaps = 37/225 (16%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRAL-NALARDKYGNPHLSNQVSRLKDISN------V 55
           D PI ID GSY VK G    S P     N L R  Y +  L+  ++ + + +N      +
Sbjct: 36  DIPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMTFIGNDTNLDQPLRI 93

Query: 56  QFRRPHELGQLTSWELQSCIWDYCLYN--PDEFNWEIGNTKGKHLVLSEMCMSMPELSKG 113
           Q +RP++   + +WE    I+DY L++      N  I N     ++L+E    +      
Sbjct: 94  QAKRPYDGLFIANWEYAEEIFDYTLHHLGVQTTNGSISNP----IILTEKMACLQSQRAN 149

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
             Q++FE ++  S   G  + +  +N  A                      N +    LV
Sbjct: 150 WYQLLFETFDVPSATFGLDSLYAFYNNCA----------------------NPFESDGLV 187

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           I+ G   T +VPIV+G       K+++ GGR    +L   L+ ++
Sbjct: 188 INCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKY 232

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 63/145 (43%), Gaps = 10/145 (6%)

Query: 278 PEDSQTIKLYDELFSIPETFFHPEIASLLKPGIVE----TILESISMLPE---AIRPLMV 330
           P     I +  E   +PE  F P I    + GI E      L   +  P    +I   M+
Sbjct: 611 PHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERML 670

Query: 331 SNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAY 390
           +N  +TGG+  +     R+  E     P    + +++ N  D +L  W  M + +  T Y
Sbjct: 671 NNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINISN--DPSLDTWKGMAKLASNTDY 728

Query: 391 -QQTRVTREEYYEHGVDWCTKQRFG 414
            ++ +VT+++Y E+G ++  +   G
Sbjct: 729 LKKIQVTKKDYEEYGPEYMMEHNLG 753

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 60/135 (44%), Gaps = 13/135 (9%)

Query: 289 ELFSIPETFFHPEIASLLKPGIVETILESI---------SMLPEAIRPLMVSNTVVTGGN 339
           E    PE  F P +  L + GI E + + I         S L +     M SN  +TGGN
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAE-LADGILTKKFGSGSSKLSQQCLD-MASNIFITGGN 668

Query: 340 FNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREE 399
             I N   R+  E     P   +  ++V  A + +L  W  M +F+++  Y  T VT+ E
Sbjct: 669 TKIPNLRERIVNEFTGFLPV--NTPLNVNYAQNVSLDAWKGMAKFARSDTYSSTCVTKVE 726

Query: 400 YYEHGVDWCTKQRFG 414
           Y E G ++  + + G
Sbjct: 727 YEEFGPNYIKEHKLG 741

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 89/222 (40%), Gaps = 34/222 (15%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRAL-NALARDKYGNPH-----LSNQVSRLKDISNVQ 56
           +TPI +D GSYEV+ G  +  TP       + R K          + N  S L +     
Sbjct: 39  NTPIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCS-LDNAVRSH 97

Query: 57  FRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQ 116
            R P++   +T+WE    +  Y  ++      +  +     ++L+E   ++        Q
Sbjct: 98  SRSPYDGSLITNWEYMEDMLSYTFHH---LGVQPNDGISNPMILTEKMATVQAQRSNWYQ 154

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE Y       G + G   F          YA        DSTG         L+I+S
Sbjct: 155 LLFECYGIPQVTFG-IDGLFSF----------YANNSP----DSTG---------LIINS 190

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           G   T ++P++KG       K++D GG     +LK  LS ++
Sbjct: 191 GHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 61/133 (45%), Gaps = 9/133 (6%)

Query: 289 ELFSIPETFFHPEIASLLKPGIVE----TILESISMLPEAIRPL---MVSNTVVTGGNFN 341
           E   +PE  F P +    + G+ E     +L+     P  +      M +N  ++GGN  
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 342 IRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYY 401
           +     R+  E     P    + V++  +SD  L  W  M +++++  Y ++ +T++EY 
Sbjct: 673 VPGLKNRIVKEFTSFLPVGTKLSVNM--SSDPLLDSWKGMAKWAKSEDYNKSFITKKEYE 730

Query: 402 EHGVDWCTKQRFG 414
           E+G ++  + + G
Sbjct: 731 EYGPEYIKEHKMG 743

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 80/222 (36%), Gaps = 34/222 (15%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLS---NQVSRLKDISNVQ 56
           D PI ID GS  +K G      P   F       RD+  N  ++   N +S L      Q
Sbjct: 37  DVPIAIDFGSNTLKAGYTNQDVPSLVFPTRLTRFRDRRLNRTMTFIGNDIS-LDQAVRAQ 95

Query: 57  FRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQ 116
            + P +   +T+WE    + +Y   +         N     L+ SE    +        Q
Sbjct: 96  SKSPFDGSMVTNWEYIDEMLEYTFKHLGVLG---DNGISNPLIFSEKLAVVQAQRSQWYQ 152

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE +       G    F  F   ++               DSTG         L+I  
Sbjct: 153 LLFETFNISKATFGIDNQFAFFANNSI---------------DSTG---------LMIGC 188

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
               T V+PIV G+   +  K+++ GG     ++   LS ++
Sbjct: 189 NNEDTNVIPIVNGVASLQECKRINWGGNHAVSYMNNLLSLKY 230

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 63/152 (41%), Gaps = 18/152 (11%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPL--- 328
           P DS+ I       +  E   +PE  F P +    + GI E I E+I        P    
Sbjct: 600 PHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITE-ICETIITKKFGSTPRNLS 658

Query: 329 -----MVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQ 383
                M  N  + GGN  +     R+  E     P+D  + V++  A    L  W+ M +
Sbjct: 659 QQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPSDTKINVNISEAP--TLDVWNGMYR 716

Query: 384 FSQTTA-YQQTRVTREEYYEHGVDWCTKQRFG 414
            + T   YQ+T VT EEY E GVD+  + +  
Sbjct: 717 LANTEEDYQRTIVTSEEYDECGVDYLKEHKLS 748

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 106/273 (38%), Gaps = 50/273 (18%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTP---FRALNALARDKYGNPHLS--NQVSRLKDISNVQF 57
           + PI ID GSYE++ G    S P   F    +  RD+  N +L      + L   +  Q 
Sbjct: 40  NIPIAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQA 99

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQV 117
           R P +   + +W++   I  Y  ++      +  N     ++++E    +        Q 
Sbjct: 100 RSPFDGPLVVNWDMVEDILQYTFHH---LGVQPDNGVTNPIIINEKLACLQSQRSNWYQT 156

Query: 118 VFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSG 177
           +FE   FG          VP    A+E  + +   +      STG         +VID G
Sbjct: 157 LFES--FG----------VPKVSMAVEGMLAFYGHNG---GSSTG---------IVIDCG 192

Query: 178 FNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLF 237
           +  T V+PIV+G       K+++ GG     +L   L  ++                  F
Sbjct: 193 YEDTNVIPIVEGQGMMLDAKRINWGGHSSIDYLSNLLYLKY----------------PYF 236

Query: 238 MSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYV 270
            + +SY    +  +D    YV  D++T  +GY+
Sbjct: 237 PTKLSYLQYEKMYKDYC--YVSQDYETDIEGYL 267

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 10/130 (7%)

Query: 293 IPETFFHPEIASLLKPGIVE----TILESISMLPEAIR---PLMVSNTVVTGGNFNIRNF 345
           +PE  F P +    + GI+E     +L+     P  +      M  N  +TGG+  +   
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 346 ARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTA-YQQTRVTREEYYEHG 404
             R+  E     P D    V++  +   +L  W  M +FS   A ++ + ++++EY E+G
Sbjct: 682 KTRIVKEFTSFLPNDAKFSVNI--SKHPSLDAWKGMAKFSSDDADFKSSLISKKEYEEYG 739

Query: 405 VDWCTKQRFG 414
            ++  + R G
Sbjct: 740 PEYIKEHRLG 749

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 89/222 (40%), Gaps = 38/222 (17%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRALNALAR-DKYGNPHLSNQVSRLKDISNV------QF 57
           PI ID G+  VK G    + P  A N   R  ++ +  +S  ++ + + +N+      Q 
Sbjct: 39  PIAIDFGTCSVKAGYVNKADP--AFNFPTRLTRFRDRKMSRTMTFIGNDTNLDYAVRSQS 96

Query: 58  RRPHELGQLTSWELQSCIWDYCLYNPD-EFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQ 116
           + P +   +T+WE    I +Y   +     N  I N     L+++E   ++        Q
Sbjct: 97  KTPFDGPFVTNWEYAEDILEYTFKHLGVTANHGISNP----LIMTEKLATLQSQRANWYQ 152

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           ++FE +   +   G    F             YA  D    K S+G         LV   
Sbjct: 153 LLFETFNTSNVSFGIDNVFA-----------FYANTD----KHSSG---------LVFGL 188

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
               T V+PI+ G P     K+++ GG    G+L + ++ ++
Sbjct: 189 NNQDTNVIPIIDGKPVLTDTKRINWGGSQSVGYLSDLMTLKY 230

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 45/106 (42%)

Query: 308 PGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSV 367
           PGIV+ I  SI      +R  +  N V+TGG   I  F+ RL  EL ++ P      ++ 
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTT 454

Query: 368 PNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
               +     W      S    + Q  V ++EY E G D   K RF
Sbjct: 455 GQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 62/155 (40%), Gaps = 30/155 (19%)

Query: 64  GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEYE 123
           G++  W+     WD+ L N       + +  G    L+E   +  E  K + +V+ E  +
Sbjct: 95  GEVIDWDGAQEQWDWALKNA----LYLESNSGIPAFLTEPIWNTVENRKKSLEVLLEGLQ 150

Query: 124 FGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNCTWV 183
           F +C+  P    + F                     ++G  N      LV+D G +   V
Sbjct: 151 FEACYLSPTPTCISF---------------------ASGRPN-----CLVVDIGHDVASV 184

Query: 184 VPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
            P++ G+   K+  +  I GRF+N  +KE L  R 
Sbjct: 185 SPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 91/224 (40%), Gaps = 40/224 (17%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDIS---------N 54
           T I+ID GSY    G + +  P  ++   +  +Y +        + K  S         +
Sbjct: 13  TSIVIDPGSYTTNIGYSGSDCP-ESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARPD 71

Query: 55  VQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGT 114
            + +R  E G++  W+     WD+ L N       + +  G  ++L+E   +  E  K +
Sbjct: 72  YEIKRIVENGEIADWDTAQEQWDWVLKN----ELFLKSNSGIPVLLTEPIWNSVENRKKS 127

Query: 115 DQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVI 174
            +V+ E  +F +C+  PV+  V F                     + G  N      LV+
Sbjct: 128 LEVLLEGMDFEACYLSPVSTCVSF---------------------AAGRPN-----CLVV 161

Query: 175 DSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           D G + T V P++ G+   K+  +  I GR++N  ++  L  R 
Sbjct: 162 DIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 41/105 (39%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           GI + +  SI      +R  +  N V+TGG   I     RL  EL ++ P      ++  
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTG 469

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
           +  +     W      +    + Q  V +EEY E G D     RF
Sbjct: 470 HLREKQYQAWLGGSILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 85/230 (36%), Gaps = 45/230 (19%)

Query: 4   TPIIIDNGSYEVKFGPATNSTP-----------FRALNALARDKYGNPHLSNQVSRLKDI 52
           T +IID GSY    G A    P             A  + + D       + +V   + I
Sbjct: 15  TAVIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQSI 74

Query: 53  S----NVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108
                + + +R  E GQ+  W+     W + L N       I + +G   +L+E   +  
Sbjct: 75  PIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRN----ELHIESNRGIPAMLTEPLWNSK 130

Query: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168
           E    + +++ E  EF +C+    +  V F                     +TG  N   
Sbjct: 131 ENRSKSLEILLEGMEFEACYLTATSTAVSF---------------------ATGRPN--- 166

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
              L++D G +   V P++ G+   K+ +     GRFLN  L + L  R 
Sbjct: 167 --SLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 44/106 (41%)

Query: 308 PGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSV 367
           PGIV+ I  SIS     IR  +  N V+TGG+  I   + R+  EL  + P      ++ 
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLAT 446

Query: 368 PNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
             + +     W      S    + Q  + ++EY E G +     R 
Sbjct: 447 GQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRL 492

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 88/220 (40%), Gaps = 36/220 (16%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNA-----LARDKYGNPHLSNQVSRLKDISNVQFR 58
           + ++ID GSY    G +   +P   + +        +K G    ++Q   +    + + +
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFEIK 73

Query: 59  RPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVV 118
           R  E G +  WE     W + + +  +F    G+ KG    L+E   +  E  K + +V+
Sbjct: 74  RILEDGCVVDWEAAQEQWTWAIRDELKF----GSFKGTPAFLTEAIWNSEENRKKSLEVL 129

Query: 119 FEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGF 178
            E  EF +C+  P A  V F               ++ R              LV+D G 
Sbjct: 130 LEGMEFEACYIAPTATCVSF---------------AMGRPTC-----------LVVDIGH 163

Query: 179 NCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           +   V P+V G+   K+  +  + G+ LN  +++ L  R 
Sbjct: 164 DVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 51/112 (45%), Gaps = 8/112 (7%)

Query: 302 IASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDW 361
           +A+L+   I+ET ++        +R  +  N VVTGG+ +I   A RL TEL ++ P   
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALK 428

Query: 362 DVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
              ++  +  +     W      S    + Q  V R+EY E G +   K RF
Sbjct: 429 FRILTSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 56/134 (41%), Gaps = 10/134 (7%)

Query: 289 ELFSIPETFFHPEIASLLKPGI---VETIL----ESISMLPEAIRPLMVSNTVVTGGNFN 341
           E   +PE  F P +    + GI    ET+L     S       +   M  N  +TGGN  
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAK 670

Query: 342 IRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTA-YQQTRVTREEY 400
           +     R+  E     P+      S+  + D +L  W  M + +Q T  ++   +T++EY
Sbjct: 671 LPGLRERIVKEFSEFLPSG--SPFSIRKSQDPSLDAWRGMAKLAQNTEDFKHGYITKQEY 728

Query: 401 YEHGVDWCTKQRFG 414
            E+G ++  +   G
Sbjct: 729 LEYGPEYIKEHNLG 742

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 88/215 (40%), Gaps = 35/215 (16%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKY----GNPHLSNQVSRLKDISNVQFRR 59
           + ++ID GSY    G + +  P   L ++   KY    GN  + ++ S      + + + 
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSV-YGKYTADEGNKKIFSEQSIGIPRKDYELKP 73

Query: 60  PHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
             E G +  W+     W + L N    N    +  G   +L+E   +  E  K + +V+ 
Sbjct: 74  IIENGLVIDWDTAQEQWQWALQNELYLN----SNSGIPALLTEPVWNSTENRKKSLEVLL 129

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179
           E  +F +C+  P +  V F                     + G  N      LV+D G +
Sbjct: 130 EGMQFEACYLAPTSTCVSF---------------------AAGRPN-----CLVVDIGHD 163

Query: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETL 214
              V PIV G+   K+ ++  I G+F+N  +K+ L
Sbjct: 164 TCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           G+ + +  SI      +R  +  N V+TGG  +I   + RL TEL +  P+     ++  
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
           +  +     W      +    + Q  V ++EY E GV+     RF
Sbjct: 444 HTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 137/332 (41%), Gaps = 55/332 (16%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGN----PHLSNQVSRLKDISNVQFRR 59
           T IIID GS+    G +    P +A+      +Y N    P L N+ S      + + + 
Sbjct: 15  TAIIIDPGSFNTNIGYSGTDCP-QAILPSCYGQYINDEEKPSLFNEQSIGLPRKDYEIKE 73

Query: 60  PHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
               G++  W+     W++ + +   F     + KG   +L+E   +  +  K + +V+ 
Sbjct: 74  IVRSGEVVDWDKAQEQWEWAIKSVLLFE----SNKGLPALLTEPIWNSEDNRKKSLEVLL 129

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179
           E  +F +C+  P A  V F               ++ R              LV+D G +
Sbjct: 130 EGMDFEACYLTPTATAVSF---------------AMGRPTC-----------LVVDIGHD 163

Query: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-----LVNNIKEK 234
            T V P++ G+   K+  +  I G  LN  ++ +L  R    + +        V    + 
Sbjct: 164 ITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPEFVKRSFDY 223

Query: 235 CLFMSPVSYFNS---FQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPE---------DSQ 282
            +  S +++ N    FQ+ ++T  + V P   T F+  ++Q  ++  E         DS+
Sbjct: 224 EIHPSLLNFVNERQFFQEFKETMLQ-VAPTSLTKFKSELEQLSKRSIEAPWGEDLVFDSE 282

Query: 283 T-IKLYDELFSIPETFFHPEIASLLKPGIVET 313
           T   + ++LF  PET   PE   + K G+VET
Sbjct: 283 TRFNIAEQLFR-PETAKFPEDWPISKDGVVET 313

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 43/105 (40%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           G+ + I  SI      +R  +  N V+TGG+ +I     R+  EL +  P      ++  
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
            A +     W      +    + Q  V ++EY E G D   K RF
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 87/220 (39%), Gaps = 40/220 (18%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHEL 63
           T ++ID GS+    G +    P     A+    YG      +     + S    R+ +E+
Sbjct: 15  TAVVIDPGSFTTNIGYSGTDCP----QAILPSCYGKYTEGEKDELFSEQSIGLPRKDYEI 70

Query: 64  ------GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQV 117
                 G++  WE     WD+ + +  E  +E  +  G   +L+E   +  E  K + +V
Sbjct: 71  HNIVQNGEVVDWEKAEKQWDWAIRS--ELRFETNS--GMPALLTEPIWNSEENRKKSLEV 126

Query: 118 VFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSG 177
           + E  +F +C+  P A  V F               ++ R              LV+D G
Sbjct: 127 LLESMDFSACYLVPTATAVSF---------------AMGRPTC-----------LVVDIG 160

Query: 178 FNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFR 217
            + T V P+V G+   K+  +  I G  LN  ++  L+ R
Sbjct: 161 HDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 43/105 (40%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           G+ + I  SI      +R  +  N V+TGG  ++     R++ EL R  P      ++  
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
              +    GW      +    + Q  V ++EY E G D   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 93/237 (39%), Gaps = 56/237 (23%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQ--FRRPH 61
           + ++ID GSY    G +    P   L +    +YG+   +N+ S  +D  + +   +R H
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDCPHSILPS----RYGSFKKTNKDSGDEDTKSDESATKRAH 70

Query: 62  --------------------ELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLS 101
                               E G +T W+     W++ L N  E   E  +TKG   +L+
Sbjct: 71  IFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKN--ELFLE--STKGIPALLT 126

Query: 102 EMCMSMPELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDST 161
           E   +  +  K + + + E   F +C+  P +  V F                     +T
Sbjct: 127 EPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSF---------------------AT 165

Query: 162 GERNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           G  N      LV+D G +   V P+V G+   K+ ++    G+++N  ++  L  R 
Sbjct: 166 GRAN-----CLVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPRE 217

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 40/105 (38%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           G+ + +  SI      +R  +  N  +TGG   I   + RL  EL  + P      ++  
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
           +  +     W      +    + Q  V R+EY E G D     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/316 (19%), Positives = 120/316 (37%), Gaps = 59/316 (18%)

Query: 6   IIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPH---- 61
           I+ID GS+    G +    P     ++    YGN        R+ +   + F R      
Sbjct: 17  IVIDPGSFVTNIGYSGTDCP----QSIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEIK 72

Query: 62  ---ELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVV 118
              E   +  W+     W+Y L    +F     + KG  ++L+E   +     K + +++
Sbjct: 73  PIVENSTIVDWDRAQEQWEYALNTDLKFE----SNKGTPVLLTEPIWNSEASRKKSLEIL 128

Query: 119 FEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGF 178
            E  EF +C+    +  V F               ++ R              LV+D G 
Sbjct: 129 LESMEFEACYLAANSSAVSF---------------AMGRPTC-----------LVVDIGH 162

Query: 179 NCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH----YNVMDET------ILV 228
           + + V P++ G+   K+  +  + G++LN  + + L  R     + V+ +        L 
Sbjct: 163 DVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPDFVKRTLS 222

Query: 229 NNIKEKCL-FMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK---IPEDSQTI 284
            ++ E  + F +   +F  F++    T  ++ P   +SF+  +  Q ++    P   + I
Sbjct: 223 FDVNESVINFANERQFFQEFKE----TLLHIAPKSLSSFKDELATQTKRSLEAPWGEELI 278

Query: 285 KLYDELFSIPETFFHP 300
              D  +S  E  F P
Sbjct: 279 FDADTRYSFAEQLFRP 294

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 45/105 (42%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           GIV+ I +S+      +R  +  N V+TGG   I   + R+  EL +  P      +S  
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
           +  +    GW      +    + Q  V REEY E G +   K RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 62/163 (38%), Gaps = 10/163 (6%)

Query: 259 LPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFS--------IPETFFHPEIASLLKPGI 310
           +P  +T   G VK  K   P++S    +  E           I E+       SLL  G+
Sbjct: 324 VPVKRTKPSGSVKSNKDSTPQNSVEPSITAEPLDETNENGKRIIESSSEITKGSLL--GV 381

Query: 311 VETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNA 370
            + +  SI      +R  +  N V+TGG   I   + RL  EL  + P      ++  + 
Sbjct: 382 ADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTGHT 441

Query: 371 SDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
            +     W      +    + Q  V +EEY + GVD     RF
Sbjct: 442 RERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 86/218 (39%), Gaps = 41/218 (18%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQF-RRPHE 62
           + ++ID GSY    G + +  P   L ++    YG          +    ++   R+ +E
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKDYE 70

Query: 63  L------GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQ 116
           L      G +  W+     W + L N    N    +  G   +L+E   +  E  K + +
Sbjct: 71  LKPIVKDGLVIDWDTAQEQWQWALKNELYLN----SNSGTPALLTEPVWNSTENRKKSLE 126

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           V+ E  +F +C+  P +  V F                     + G  N      LV+D 
Sbjct: 127 VLLEGMQFEACYLAPTSTCVSF---------------------AAGRPN-----CLVVDI 160

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETL 214
           G +   V PIV G+   K+ ++  + G+F+N  +K+ L
Sbjct: 161 GHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 43/105 (40%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           G+   +  SI      +R  +  N V+TGG   I   + RL TEL +  P+     ++  
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
           +  +     W      +    + Q  V ++EY E GV+     RF
Sbjct: 444 HTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 87/218 (39%), Gaps = 41/218 (18%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQF-RRPHE 62
           + ++ID GSY    G + +  P   L ++    YG         ++    ++   R+ +E
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKLTADENSKKMFSEQSIGIPRKDYE 70

Query: 63  L------GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQ 116
           L      G +  W+     W + L N       + +  G   +L+E   +  E  K + +
Sbjct: 71  LKPIIENGLVIDWDTAQEQWQWALRN----ELYLDSNSGIPALLTEPVWNSMENRKKSLE 126

Query: 117 VVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDS 176
           V+ E  +F +C+  P +  V F                     + G  N      LV+D 
Sbjct: 127 VLLEGMQFEACYLAPTSTCVSF---------------------AAGRPN-----CLVVDI 160

Query: 177 GFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETL 214
           G +   V PIV G+   K+ ++  I G+F+N  +++ L
Sbjct: 161 GHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 44/105 (41%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           G+   +  SI      +R  +  N V+TGG  +I   + RL TEL +  P+     ++  
Sbjct: 383 GLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 442

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
           +  +     W      +    + Q  V ++EY E G++     RF
Sbjct: 443 HIRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 85/215 (39%), Gaps = 35/215 (16%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNAL----ARDKYGNPHLSNQVSRLKDISNVQFRR 59
           + ++ID GSY    G + +  P   L ++      DK      S Q   +    + + + 
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQSIGIPR-KDYELKP 73

Query: 60  PHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119
             E G +  W+     W + L N       + +  G   +L+E   +  E  K + +V+ 
Sbjct: 74  IIENGLVIDWDTAQEQWQWALKN----ELYLDSNSGIPALLTEPVWNSTENRKKSLEVLL 129

Query: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179
           E  +F +C+  P +  V F                     + G  N      LV+D G +
Sbjct: 130 EGMQFEACYLAPTSTCVSF---------------------AAGRPN-----CLVVDIGHD 163

Query: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETL 214
              V PIV G+   K+ ++  I G+F+N  +K+ +
Sbjct: 164 TCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           G+ + +  SI      +R  +  N V+TGG  +I   + RL TEL +  P+     ++  
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
           +  +     W      +    + Q  V ++EY E GVD     RF
Sbjct: 444 HTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           G+ + +  +I+     +R  +  N VVTGG+ +I     RL TEL ++ P      ++  
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
           +  +     W      S    + Q  V R+EY E G +   K RF
Sbjct: 436 HLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 86/220 (39%), Gaps = 36/220 (16%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNAL-----ARDKYGNPHLSNQVSRLKDISNVQFR 58
           + ++ID GSY    G +   +P   + +      A  K G    ++Q   +    + + +
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQF-MIMPRPDFEIK 73

Query: 59  RPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVV 118
           R  E G +  WE     W + +   DE  +E  + KG    L+E   +  E  K + +V+
Sbjct: 74  RILENGCVVDWEAAQEQWAWAIR--DELKFE--SFKGTPAFLTEAIWNPEENRKKSLEVL 129

Query: 119 FEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGF 178
            E  EF +C+  P A    F               ++ R              LV+D G 
Sbjct: 130 LEGMEFEACYIAPTATCTSF---------------AMGRPTC-----------LVLDIGH 163

Query: 179 NCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           +   V P+V G+   K+  +  + G+ LN  ++  L  R 
Sbjct: 164 DVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 81/394 (20%), Positives = 135/394 (34%), Gaps = 108/394 (27%)

Query: 111 SKGTD-QVVFEEYEF----GSCFKGPVAGFVPFNWQALEHNMIYAKED------------ 153
           +KG D +VVF   E     G  F    +   P+NW+ALE    +  E             
Sbjct: 35  AKGKDGEVVFGYLEMLQNPGEVFTIMDSRGCPYNWEALEQQWRWIYEQVLEISPEELPLV 94

Query: 154 -SVYRKDSTGERNEYNDF---------------------------QLVIDSGFNCTWVVP 185
            +V    S G R++Y +                             LV+D G +   V P
Sbjct: 95  ITVPPDLSAGTRSKYLELALEKLKVPVFQMVVEPLAISLSLGRNTSLVVDIGASKITVTP 154

Query: 186 IVKGIPYYKAIKKLDIGGRFLNGFLKETL-----------------SFRHYNVMDETILV 228
           I+ G     A+ +    G FL+  + E L                 SF+++        +
Sbjct: 155 IIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDSKVPESFKYWE--SSRTWI 212

Query: 229 NNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288
           ++ K   L +SP S     +  +DT A    P     +  Y K  K    E         
Sbjct: 213 HDFKATMLQVSP-SKIQELEGMQDTMAFSHNPLDNKKYFLYKKGNKTLTLEQR------- 264

Query: 289 ELFSIPETFFHPEIAS---LLKPGIVETILESI--------------------------- 318
           E + + E  F P++AS     K G+ E +++++                           
Sbjct: 265 ECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTTSNSGPAGGGGPSGSSSMG 324

Query: 319 -----SMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDT 373
                +  PE I   +++N V+TG    +    +R+  EL  Q P       + P   D 
Sbjct: 325 IGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQYKLSSFANPMVLDR 384

Query: 374 ALFGWDSMRQFSQTTAYQQTR-VTREEYYEHGVD 406
            L  W      S   +++    +TR+EY  +G++
Sbjct: 385 KLQSWQGGVTMSNLPSWELGNWITRQEYDANGIN 418

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 44/106 (41%)

Query: 308 PGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSV 367
           PGIV+ I  SI+     +R  +  N V+TGG   I   + R+  EL ++ P      ++ 
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 368 PNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
               +     W      S    + Q  V ++EY E G D     RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 61/155 (39%), Gaps = 30/155 (19%)

Query: 64  GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEYE 123
           G++  W+     W + L N       + + +G   +L+E   +  E  K + +V+ E   
Sbjct: 101 GEVVDWDAAQEQWSWALEN----ELFLKSNEGVPALLTEPIWNTVENRKKSLEVLLEGMG 156

Query: 124 FGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNCTWV 183
           F +C+       V F                     + G  N      LV+D G +   V
Sbjct: 157 FEACYLSATPTCVSF---------------------AAGRSN-----CLVVDIGHDIISV 190

Query: 184 VPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
            P+V G+ + K+ ++  I G++LN  + + L  R 
Sbjct: 191 SPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPRE 225

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 87/225 (38%), Gaps = 40/225 (17%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRALNA---LARDKYGNPHLSNQVSRLKDISNVQFRRP 60
           T +IID GS+    G +    P   L +     ++       + +  R+   S++Q  RP
Sbjct: 15  TAVIIDPGSFSTNIGYSGTDYPQSILPSSYGTYKETTEGQESTTKRKRIFSESSIQIPRP 74

Query: 61  H-------ELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKG 113
                   E G +  W+     W + L +       + +T G   +L+E   +  E  K 
Sbjct: 75  DYEIKRIVENGSIMDWDAAQEQWSWALKS----QLHLQSTSGIPALLTEPIWNSVENRKK 130

Query: 114 TDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLV 173
           + +++ E   F +C+   V   V F                     + G  N      LV
Sbjct: 131 SLEILLEGMNFEACYLSSVPTCVSF---------------------AAGRPN-----CLV 164

Query: 174 IDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           +D G + T V P+V G+   K+  +  I G+++N  +++ L  R 
Sbjct: 165 VDIGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 66/164 (40%), Gaps = 8/164 (4%)

Query: 250 KEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHPEIASLLKPG 309
           KE T    + P    +    + +  ++  ED + +        +P+     +I +++ PG
Sbjct: 440 KEHTADAILAPTNADTPSENINENGKRSIEDGENV-------DVPKKSDKKDIDNII-PG 491

Query: 310 IVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPN 369
           I + +  +++     +R  +  N ++TGG   I   A RL  EL ++ P      +S  +
Sbjct: 492 IADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADRLMYELNKKLPALKFRILSSGH 551

Query: 370 ASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
             +     W      +    + Q  V + EY E G D   K RF
Sbjct: 552 RRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRLLKDRF 595

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 69/169 (40%), Gaps = 36/169 (21%)

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNP---DEFNWEIGNTKGKHLVLSEMCMSMPE 109
           S+ Q +R  E G +  W++    W + L      D F       KG   +L+E   +  +
Sbjct: 157 SDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSF-------KGIPALLTEPVWNTVQ 209

Query: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169
             K + +V+ E+ EF +C+   +   V F                     + G+ N    
Sbjct: 210 NRKKSLEVLLEKMEFEACYLTTIPTNVSF---------------------AAGKPN---- 244

Query: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
             LV+D G +   V P++ G+   K++++    GR+LN  L+  +  R 
Sbjct: 245 -CLVVDVGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 86/227 (37%), Gaps = 44/227 (19%)

Query: 3   DTPIIIDNGSYEVKFGPATNSTPFRAL-NALARDK----------YGNPHLSNQVSRLKD 51
           +TPI ID GSYEV+ G  ++S P     N L R +           GN  L +Q  R   
Sbjct: 36  ETPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQTVR--- 92

Query: 52  ISNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELS 111
               Q + P +   + +W+    I  Y     +       N+    L+++E   S+    
Sbjct: 93  ---SQSKSPFDGSFIANWDYVEDIMQYTF---NHLGVVGDNSVRNPLIINEPLGSLQSQR 146

Query: 112 KGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQ 171
           K   +++FE      CF  P   F          N                  NE N   
Sbjct: 147 KNWYELLFE------CFHLPNVSFGIDGMFGFYAN------------------NEGNQDG 182

Query: 172 LVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           +VI+     T V+P+V G       K+++ GGR    +L + +S ++
Sbjct: 183 IVINCSNEETDVIPVVDGRGVLTDAKRINWGGRQAVDYLSDLMSLKY 229

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 41/105 (39%)

Query: 309 GIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVP 368
           G+ + I  SI      +R  +  N VVTGG  +I     R+  EL +  P      ++  
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 369 NASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRF 413
           +  +     W      S    + Q  V ++EY E G     K RF
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 59/151 (39%), Gaps = 30/151 (19%)

Query: 64  GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEYE 123
           G +  W+     W + + +  E ++E  +TKG    L+E   +  E  K + +V+ E  E
Sbjct: 92  GSVIDWDSAQEQWSWAIQH--ELHFE--STKGMPAFLTEPIWNTEENRKKSLEVLLENME 147

Query: 124 FGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNCTWV 183
           F +CF  P    V F               ++ R              LV+D G +   V
Sbjct: 148 FEACFLSPTPTCVSF---------------AMGRPTC-----------LVVDIGHDVCSV 181

Query: 184 VPIVKGIPYYKAIKKLDIGGRFLNGFLKETL 214
            P+V G+   K+     I G  LN  L + L
Sbjct: 182 SPVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 90/224 (40%), Gaps = 42/224 (18%)

Query: 5   PIIIDNGSYEVKFGPATNSTPFRAL-NALAR--DKYGNPH---LSNQVSRLKDISNVQFR 58
           PI ID GS +++ G    STP     N L R  D+  N     + N VS L      Q +
Sbjct: 38  PIAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDRKINKTFTFIGNDVS-LDQAIRTQSK 96

Query: 59  RPHELGQLTSWELQSCIWDYCLYNPDEFNWEIG----NTKGKHLVLSEMCMSMPELSKGT 114
            P +   +T+W+    I  Y       FN  +G    N     ++L+E   ++       
Sbjct: 97  SPFDGSIITNWDYVEDIMQYI------FN-HLGVVGHNGVSNPILLTEKLATLQSQRSNW 149

Query: 115 DQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVI 174
            Q++FE ++      G  + F  +                +  + STG         LVI
Sbjct: 150 YQLLFECFDIPEVTLGIDSMFAFY---------------GLNERSSTG---------LVI 185

Query: 175 DSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH 218
           D G   T V+P+V+G       K+++ GGR    +L + L+ ++
Sbjct: 186 DCGNEETDVIPVVEGAGMLTDAKRINWGGRQAVDYLNDLLTLKY 229

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 58/137 (42%), Gaps = 20/137 (14%)

Query: 278 PEDSQTIK------LYDELFSIPETFFHPEIASLLKPGIV---ETIL------ESISMLP 322
           P DS+ I       L  E   +PE  F P +    + GI+   ETIL      E   + P
Sbjct: 597 PHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSP 656

Query: 323 EAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMR 382
            A+   M +N  +TGGN  +     R+  E     P       +V  + + +L  W+ M 
Sbjct: 657 TAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPV--GTAFNVKQSYNPSLDAWNGMA 712

Query: 383 QFS-QTTAYQQTRVTRE 398
           + +  +  Y+ T ++++
Sbjct: 713 KLTLNSEDYKNTIISKK 729

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 45/225 (20%), Positives = 84/225 (37%), Gaps = 41/225 (18%)

Query: 4   TPIIIDNGSYEVKFGPATNSTPFRAL-----------NALARDKYGNPHLSNQVSRLKDI 52
           T ++ID GS+    G +    P   L           NA   D+   P +  + S     
Sbjct: 15  TAVVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTFPR 74

Query: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112
            + + +   E G +  W+     WD+ L N       + + KG   +++E   +  E   
Sbjct: 75  PDYEIKPIVENGLVVDWDAAQEQWDWALRN----VLHLESNKGVPALMTESIWNTMENKT 130

Query: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172
            + +V+ E  +F +C+       V F                     +TG  N      L
Sbjct: 131 KSLEVLLETLDFEACYISSTPTCVSF---------------------ATGRPN-----CL 164

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFR 217
           V+D G +     P+V G+   ++ ++  I G+F++  + + L  R
Sbjct: 165 VVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPR 209

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 54/256 (21%), Positives = 94/256 (36%), Gaps = 25/256 (9%)

Query: 172 LVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRH-----YNVMDETI 226
           LV+D G +   V PIV G      I +    G FL+  L + L  R      Y+      
Sbjct: 142 LVVDVGASKVTVTPIVDGSVVKTGILRSRYAGDFLDFQLMKALDDRPDGTSLYHWQQSRT 201

Query: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKL 286
            + + K   L +S +      ++ +  +  ++    +       K+QK    +  Q  ++
Sbjct: 202 WMRDFKNTMLQVSLMRLSEVEKQLQKQSISFIPIPLEGRKHFLFKRQKTVTWDLKQCYRI 261

Query: 287 YDELF---SIPETFFHPEIASLLKPGIVETILESI----------------SMLPEAIRP 327
            + LF   S+   F   +  S L    ++    SI                S  PE I  
Sbjct: 262 PESLFDPSSVSPEFDSADGLSDLVGKAIKKCAASITSSNGSAAQPAAAGLPSATPEQIHA 321

Query: 328 LMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQT 387
            +++N V+ GG   ++   +RL  +L  Q P       + P   D  L  W         
Sbjct: 322 ALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQSWQGGVNMCHL 381

Query: 388 TAYQ-QTRVTREEYYE 402
             ++  + VT++EY E
Sbjct: 382 PDWKLGSWVTKQEYLE 397

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 84/216 (38%), Gaps = 35/216 (16%)

Query: 172 LVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNI 231
           LV+D G   + V PI+ G     A+ +    G FL+  + E L+       +E    NN 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 232 KEKCLFM--SPVSYFNSFQKKEDTTAEYVLPDFQTS---FQG--YVKQ---QKQKIPEDS 281
           K+  L +  +  ++   F+      A   L D  ++     G  Y+K    QKQK     
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNFLLQKQK----- 252

Query: 282 QTIKLYD-ELFSIPETFFHPEIAS---LLKPGIVETILESIS---------------MLP 322
            TI L   +   + E  F P   S   +   G+ E + +S+                  P
Sbjct: 253 -TISLTQKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTP 311

Query: 323 EAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCP 358
           E     +++N ++TG +  I    +R+  +L  Q P
Sbjct: 312 EQTHAALLTNILITGSSSLISGLEQRIVNDLSYQFP 347

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 82/203 (40%), Gaps = 36/203 (17%)

Query: 172 LVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNI 231
           LVID   + + V PIV G+     I K   GG FL+  +      + ++ +DE +     
Sbjct: 156 LVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQI-----IKKFSTIDEDLEEEMT 210

Query: 232 KEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQ--------KIPEDSQT 283
               +++S  S+  +F+K      +  L D +  ++  ++ Q +         +  +  +
Sbjct: 211 NSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVEKYYEEQLRLQAELQNQGSITSVGTNPLS 270

Query: 284 IK---LY----------DELFSIPETFFHPEIASL---LKPGIVETILESISMLPEAIRP 327
           +K   LY           EL+   E  F P++AS       G+ E I  SI+       P
Sbjct: 271 VKKEYLYRSRKTVTFESRELYQFGEYLFQPQLASEQYNRDDGLGELIYRSITSAAMGNMP 330

Query: 328 LMV--SNTV-----VTGGNFNIR 343
             V  SN +      TGG+ N+ 
Sbjct: 331 AAVAASNNIGGSSGATGGDSNVH 353

>KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.477
           YOR141C
          Length = 934

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 27/143 (18%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY-------NVMDET 225
           V++ G   T V  + +GI    +I  L+ GG  ++      L   ++       + +   
Sbjct: 520 VVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLFAVLLLMSNFPYQEWDIDSIPGR 579

Query: 226 ILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285
           ++  ++K++CL         +FQ  + TT  +   +F     G        +P +    K
Sbjct: 580 MIAEHLKKECL---------TFQDADITTQLF---NFIKRVPG--------LPTEKIEFK 619

Query: 286 LYDELFSIPETFFHPEIASLLKP 308
            +DE+   P   F+P+I SLLKP
Sbjct: 620 TFDEVILAPLALFYPKIFSLLKP 642

>ABR194C Chr2 complement(769476..770828) [1353 bp, 450 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR177C
           (EHT1) and YPL095C
          Length = 450

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 13/94 (13%)

Query: 283 TIKLYDELFSIPETF-----------FHPEIASLLKPGIVETILESISMLPEAIRPLMVS 331
            ++ +D+L++ PE +            HPE    L+P       E ++ +P+  RPL+V 
Sbjct: 105 AMREWDDLYAAPEGYNKEKFDADAAKTHPENWPRLQPNTRFLDEEELAKIPKDTRPLIVV 164

Query: 332 NTVVTGGNFNIRNFARRLATELQRQCPTDWDVCV 365
              + GG+    N  R L TEL       ++V V
Sbjct: 165 AHGLAGGSH--ENIIRALVTELLSVGNGQFNVVV 196

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 8/106 (7%)

Query: 310 IVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPN 369
           I+  +LESI  LP  ++  ++ N ++ GG   I+    RL   L R   T+      +  
Sbjct: 205 IISLVLESIKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENL-RYAHTNARGINILKV 263

Query: 370 ASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGV--DWCTKQRF 413
               +++ + S+          Q  V REE+   G+  DW   QRF
Sbjct: 264 WQGGSIYTYHSLMH----NDLDQMEVNREEFKSSGIVPDW-QLQRF 304

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 319 SMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGW 378
           ++ PE +  L+++N ++TGG   I    +R+  EL  + P       + P+    +L  W
Sbjct: 433 NITPEHVYSLLLTNVIITGGTSLIDGMEQRIIRELSIRFPQYKLSTFTNPDQLQRSLQAW 492

Query: 379 DSMRQFSQTTAYQQTR-VTREEYYEH 403
           +     S    +  T+  T+E++  H
Sbjct: 493 NGAVSLSNLPKWGLTQWFTKEDFNNH 518

>NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11
          Length = 330

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 92  NTKGKHLVLSEMCMSMPELSKGTDQVVFEEYEF 124
           NT  KH    E+C+++P LSK  DQV   E EF
Sbjct: 165 NTNSKHS--EEICLNLPNLSKDIDQVESNENEF 195

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 5/75 (6%)

Query: 269 YVKQQKQKIPEDSQTIKLYDELFSIP--ETFFHPEIASLLKPGIVETILESISMLPEAIR 326
           +VK Q+ ++P +S ++  YD L S+P  E+ F P+ A+ L    +  + ES+  L + ++
Sbjct: 566 HVKFQRVQVPNESMSLSPYDFLRSLPHLESLFMPQCAA-LTDDTMSLMTESVDYLND-LK 623

Query: 327 PLMVS-NTVVTGGNF 340
            L VS N+ +TG + 
Sbjct: 624 SLDVSLNSSLTGASL 638

>NCAS0C01880 Chr3 complement(346987..349383) [2397 bp, 798 aa] {ON}
           Anc_8.587 YBR172C
          Length = 798

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 306 LKPGI-VETILESISMLP------EAIRPLMVSN-TVVTGGNFNIRNFARRLATELQRQC 357
           L PG+ + ++LE + MLP      E I   + +N TV+ G  F      RR+  E Q   
Sbjct: 708 LNPGVSMNSVLEVLLMLPASASAKEIIADTIYANSTVMDGRRFATDFIKRRIECEKQLTD 767

Query: 358 PTDWDVCVSVPNASD 372
           P  W   +S+P  +D
Sbjct: 768 PLSWKEALSLPEGND 782

>Kpol_1030.7 s1030 complement(13601..18073) [4473 bp, 1490 aa]
          {ON} complement(13601..18073) [4473 nt, 1491 aa]
          Length = 1490

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 19 PATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHEL 63
          P +N+  + +L+A A+++     + +  S++ DI  +QFRRP  L
Sbjct: 46 PISNN-AYESLSAEAKEELDRDSILDSFSKINDIEEIQFRRPDHL 89

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 62/163 (38%), Gaps = 26/163 (15%)

Query: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETI-- 226
           D   V+D G   T +  + +G+    ++  LD GG  +     + L   ++   D  +  
Sbjct: 390 DSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNS 449

Query: 227 -----LVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDS 281
                L+  +KEK         + +FQ  + T   Y           ++K+   K   + 
Sbjct: 450 PEGWSLMEQLKEK---------YATFQDADVTIQLY----------NFIKRIPNKPGAEK 490

Query: 282 QTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEA 324
              K++DE+ + P   F P I  LLK   V       S LP +
Sbjct: 491 FEFKVFDEVMTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRS 533

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 28/143 (19%)

Query: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGG----RFLNGFLKETLSFRHYNVMDET--- 225
           V+D G   T +  + +G+    +I  LD GG    R    FL E+ +F + ++  ++   
Sbjct: 394 VVDIGATTTKIACVDEGLVNENSIINLDYGGDDITRLFARFLLES-NFPYQDLDLDSPQG 452

Query: 226 -ILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284
             LV  +KEK         + +FQ  + T   Y           ++K+   K   +    
Sbjct: 453 WSLVEQLKEK---------YTTFQDADVTIQLY----------NFIKRIPGKPGAEKFEF 493

Query: 285 KLYDELFSIPETFFHPEIASLLK 307
           K++DE+ + P   F P +  LLK
Sbjct: 494 KVFDEVMTAPMGLFFPHVFPLLK 516

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,762,952
Number of extensions: 2208248
Number of successful extensions: 6352
Number of sequences better than 10.0: 162
Number of HSP's gapped: 6238
Number of HSP's successfully gapped: 208
Length of query: 419
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 307
Effective length of database: 40,638,807
Effective search space: 12476113749
Effective search space used: 12476113749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)