Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17116gsingletonON54454428260.0
SAKL0H15686g8.317ON5992996403e-75
Ecym_42508.317ON6573124227e-44
Kwal_56.239008.317ON5892664082e-42
KLTH0G12408g8.317ON6032623978e-41
AGL191W8.317ON5822943969e-41
Skud_4.4028.317ON6122793545e-35
KLLA0E04071g8.317ON7042673441e-33
Smik_4.3878.317ON6342893272e-31
TDEL0F044408.317ON5542663243e-31
YDR143C (SAN1)8.317ON6102893244e-31
NDAI0G026308.317ON6612233202e-30
Suva_2.3048.317ON6244623121e-29
TPHA0C008508.317ON7813223052e-28
KAFR0B030708.317ON6432273023e-28
NCAS0C033108.317ON5702772952e-27
Kpol_1036.668.317ON6683362784e-25
CAGL0E01441g8.317ON7172422776e-25
TBLA0A039008.317ON6983062759e-25
ZYRO0D05830g8.317ON7802352562e-22
KNAG0G023908.317ON688872001e-15
SAKL0C03586gsingletonON1474291162e-05
SAKL0C01760gsingletonON1474291162e-05
ZYRO0E05192g1.389ON1520311162e-05
TDEL0B061701.389ON1470261127e-05
CAGL0M08690g5.628ON328291091e-04
TDEL0G042506.45ON517501091e-04
AER390W5.628ON316291072e-04
KNAG0I013801.389ON1493311082e-04
Kpol_1048.731.389ON1549271073e-04
Kpol_1035.506.45ON601591054e-04
ZYRO0C07194g6.45ON558611045e-04
KLLA0F12166g1.389ON1528261055e-04
KLTH0G18150g1.389ON1554261047e-04
TPHA0B036501.389ON1576311038e-04
KAFR0I020901.389ON1466261039e-04
SAKL0D08272g1.389ON1491261020.001
Skud_12.3281.389ON1557271010.001
ZYRO0C11176g5.628ON36833990.002
KLLA0E16677g5.628ON30533990.002
NDAI0G052001.389ON1586261000.002
KLTH0C10604g6.45ON51540990.002
Kwal_55.199995.628ON15287930.002
Skud_15.1486.45ON54857990.002
Suva_10.3441.389ON156027990.002
Kwal_14.12871.389ON151826990.003
Suva_15.1596.45ON55043970.003
SAKL0G07370g5.628ON32138960.003
YDR265W (PEX10)5.628ON33736960.003
TPHA0A039903.279ON17537930.004
Suva_2.4335.628ON33736960.004
Ecym_13285.628ON32029950.004
KNAG0E027406.45ON55637960.004
YLR247C (IRC20)1.389ON155626970.004
NCAS0A087801.389ON150226970.004
Skud_4.5285.628ON33736950.005
TBLA0I019603.279ON18437920.005
SAKL0E01958g6.45ON52441960.005
Smik_12.3201.389ON155327960.005
YOL013C (HRD1)6.45ON55157950.006
CAGL0E02299g6.45ON54537940.007
TDEL0A049405.628ON32641930.008
NCAS0C052905.628ON33033930.008
Kpol_526.345.628ON32829930.008
TBLA0B005606.45ON49240930.010
NDAI0I004006.332ON481101930.010
Kpol_1052.193.279ON10337860.010
Smik_15.1576.45ON55057930.011
NDAI0C027706.45ON63040930.012
TPHA0F024806.45ON60540920.013
CAGL0B05049g1.389ON147024930.013
KAFR0A052406.45ON55337910.017
Kwal_56.225226.45ON51351910.020
AGR034W3.279ON15944860.021
TBLA0A096405.628ON32524890.023
AAR049C6.332ON44343900.024
KLTH0E02464g5.628ON32924890.025
NDAI0H008405.628ON34124880.037
NDAI0K007108.799ON159140890.041
KLLA0C08756g6.332ON42736870.052
Smik_4.5165.628ON33724860.060
KNAG0J015605.628ON30941860.062
TDEL0B063402.545ON76243860.074
NCAS0D020106.45ON51058860.079
CAGL0H10274g3.279ON17533820.079
TBLA0C013301.389ON145228860.082
NDAI0A074503.279ON17344820.085
KNAG0J008503.279ON16260810.093
Kpol_480.228.808ON42541850.097
TPHA0C003505.628ON27824840.099
NCAS0A04680singletonON27428830.10
NCAS0D045406.332ON46938840.13
NCAS0A082803.279ON11829780.13
KLLA0E07019g7.416ON27988830.14
TDEL0D034603.279ON14437790.14
Ecym_74188.799ON154746840.15
AER016C3.190ON14741790.15
Ecym_53123.190ON14844790.16
SAKL0A09812g2.545ON75125830.17
TDEL0B008908.808ON54068820.21
ACL019C6.45ON57529820.23
KAFR0B014602.545ON76133820.26
KAFR0H005605.628ON32724810.27
Ecym_24906.332ON46565810.27
TDEL0B009808.799ON155937820.28
YMR247C (RKR1)8.799ON156237820.29
TPHA0I005908.799ON159143820.29
TBLA0I014902.545ON75035810.30
Ecym_30486.45ON67031810.30
ZYRO0E06996g3.279ON17248780.31
TDEL0A074706.332ON40828800.31
Kpol_480.258.799ON157143810.31
KAFR0C004603.279ON15727770.31
Skud_13.4198.799ON156437810.32
ABL058C8.799ON154637810.33
Suva_13.4328.799ON155937810.33
KLTH0A06556g6.332ON46044800.34
Ecym_72412.545ON75838800.37
NCAS0C006808.799ON156437810.38
SAKL0B06226g8.799ON155737800.40
KLTH0E13992g8.799ON155037800.41
Smik_13.4608.799ON156637800.45
Ecym_26583.279ON15937760.47
Kpol_1028.466.332ON44856790.48
Skud_2.2423.368ON79838790.49
Suva_11.1892.545ON75833790.50
KAFR0B036208.799ON156037800.50
SAKL0D03058g3.279ON15530760.50
Kwal_23.62856.332ON45844780.56
CAGL0H02651g8.799ON154429790.57
Skud_11.1922.545ON75833790.58
YKL034W (TUL1)2.545ON75833790.59
Ecym_71377.416ON26341770.59
TPHA0C042602.545ON75725790.60
Suva_4.3023.279ON15029750.62
YBR062C3.279ON18029760.63
KAFR0F028406.332ON44538780.64
KLLA0F18458g3.279ON14038740.66
Skud_2.1863.279ON17829750.68
Kwal_26.80992.545ON75025780.70
ZYRO0F12760g8.799ON155537780.72
Kwal_27.105463.279ON10431720.76
Kwal_27.123278.799ON157437780.78
Smik_11.2132.545ON75933780.80
KLTH0D07216g2.545ON74725770.82
KLLA0C14344g8.799ON151834780.82
Smik_2.1963.279ON18529750.84
TDEL0C051003.368ON75038770.85
KLLA0E07151g3.28ON11023720.86
Smik_2.2553.368ON78638770.88
Skud_4.2433.190ON16536740.89
NDAI0K018102.545ON76234770.89
KLLA0F25674g2.545ON75745770.90
YBR114W (RAD16)3.368ON79038770.91
Kpol_1002.72.545ON75425770.93
Kwal_23.36603.368ON76838770.97
SAKL0B08008g3.368ON77438770.99
ZYRO0E05632g2.545ON76571771.0
SAKL0A01474g6.332ON46844761.0
TBLA0D006508.799ON156837771.0
TBLA0H015103.368ON78339761.1
NCAS0A047602.545ON76170761.2
Kwal_55.21206singletonON27527751.2
KNAG0A012803.28ON11422711.3
Suva_4.3623.368ON79038761.3
NDAI0A079603.368ON78539751.4
Ecym_26848.808ON38636751.5
AGL217W8.808ON41446751.5
KNAG0J005408.799ON156137751.7
CAGL0M10615g6.320ON41067741.8
KNAG0A070902.545ON76249741.9
TPHA0H006403.190ON18038722.1
Suva_4.2393.190ON16536712.3
SAKL0D02354g8.808ON33136722.9
NDAI0A065203.190ON20628713.0
ADR199C5.525ON94440733.0
KLLA0C18260g4.139ON22939713.2
TBLA0B026708.808ON47841723.2
KLTH0C05258g3.279ON15231693.3
SAKL0E13178g2.60ON35691723.4
AFR275W2.545ON75325723.4
YPR093C (ASR1)3.405ON28827713.8
KAFR0D026403.368ON77638714.6
TBLA0A002603.190ON18444694.8
Kwal_26.8030na 1ON66032715.2
KLLA0C05874g6.45ON55334705.4
KLTH0D06886gna 1ON66432705.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17116g
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...  1093   0.0  
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...   251   3e-75
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...   167   7e-44
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...   161   2e-42
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...   157   8e-41
AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic ho...   157   9e-41
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...   140   5e-35
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...   137   1e-33
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...   130   2e-31
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...   129   3e-31
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...   129   4e-31
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317    127   2e-30
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...   124   1e-29
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...   122   2e-28
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...   120   3e-28
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317    118   2e-27
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...   111   4e-25
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...   111   6e-25
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...   110   9e-25
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...   103   2e-22
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    82   1e-15
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    49   2e-05
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    49   2e-05
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    49   2e-05
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    48   7e-05
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    47   1e-04
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...    47   1e-04
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    46   2e-04
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    46   2e-04
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    46   3e-04
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...    45   4e-04
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...    45   5e-04
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    45   5e-04
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    45   7e-04
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    44   8e-04
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    44   9e-04
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    44   0.001
Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] ...    44   0.001
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    43   0.002
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    43   0.002
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    43   0.002
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...    43   0.002
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    40   0.002
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...    43   0.002
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    43   0.002
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    43   0.003
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    42   0.003
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    42   0.003
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    42   0.003
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    40   0.004
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    42   0.004
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    41   0.004
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...    42   0.004
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    42   0.004
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    42   0.004
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    41   0.005
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    40   0.005
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...    42   0.005
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    42   0.005
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    41   0.006
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...    41   0.007
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    40   0.008
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    40   0.008
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    40   0.008
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...    40   0.010
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    40   0.010
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    38   0.010
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...    40   0.011
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...    40   0.012
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...    40   0.013
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    40   0.013
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...    40   0.017
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...    40   0.020
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    38   0.021
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    39   0.023
AAR049C Chr1 complement(428904..430235) [1332 bp, 443 aa] {ON} S...    39   0.024
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    39   0.025
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    39   0.037
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    39   0.041
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    38   0.052
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    38   0.060
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    38   0.062
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    38   0.074
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...    38   0.079
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    36   0.079
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    38   0.082
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    36   0.085
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    36   0.093
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    37   0.097
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    37   0.099
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      37   0.10 
NCAS0D04540 Chr4 (861304..862713) [1410 bp, 469 aa] {ON} Anc_6.3...    37   0.13 
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    35   0.13 
KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some si...    37   0.14 
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    35   0.14 
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    37   0.15 
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...    35   0.15 
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...    35   0.16 
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    37   0.17 
TDEL0B00890 Chr2 (170522..172144) [1623 bp, 540 aa] {ON} Anc_8.8...    36   0.21 
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...    36   0.23 
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    36   0.26 
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    36   0.27 
Ecym_2490 Chr2 (961218..962615) [1398 bp, 465 aa] {ON} similar t...    36   0.27 
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    36   0.28 
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    36   0.29 
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    36   0.29 
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    36   0.30 
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...    36   0.30 
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    35   0.31 
TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON} Anc_6...    35   0.31 
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    36   0.31 
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    34   0.31 
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    36   0.32 
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    36   0.33 
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    36   0.33 
KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} simila...    35   0.34 
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    35   0.37 
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    36   0.38 
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    35   0.40 
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    35   0.41 
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    35   0.45 
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    34   0.47 
Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [13...    35   0.48 
Skud_2.242 Chr2 (435864..438260) [2397 bp, 798 aa] {ON} YBR114W ...    35   0.49 
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    35   0.50 
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    35   0.50 
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    34   0.50 
Kwal_23.6285 s23 (1516142..1517518) [1377 bp, 458 aa] {ON} YCR06...    35   0.56 
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    35   0.57 
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    35   0.58 
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    35   0.59 
Ecym_7137 Chr7 (277509..278300) [792 bp, 263 aa] {ON} similar to...    34   0.59 
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    35   0.60 
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    33   0.62 
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    34   0.63 
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    35   0.64 
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    33   0.66 
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    33   0.68 
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    35   0.70 
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    35   0.72 
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    32   0.76 
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    35   0.78 
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    35   0.80 
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    34   0.82 
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    35   0.82 
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    33   0.84 
TDEL0C05100 Chr3 (910686..912938) [2253 bp, 750 aa] {ON} Anc_3.3...    34   0.85 
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    32   0.86 
Smik_2.255 Chr2 (452057..454417) [2361 bp, 786 aa] {ON} YBR114W ...    34   0.88 
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...    33   0.89 
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    34   0.89 
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    34   0.90 
YBR114W Chr2 (467248..469620) [2373 bp, 790 aa] {ON}  RAD16Prote...    34   0.91 
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    34   0.93 
Kwal_23.3660 s23 complement(382943..385249) [2307 bp, 768 aa] {O...    34   0.97 
SAKL0B08008g Chr2 (680730..683054) [2325 bp, 774 aa] {ON} simila...    34   0.99 
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    34   1.0  
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    34   1.0  
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    34   1.0  
TBLA0H01510 Chr8 complement(339262..341613) [2352 bp, 783 aa] {O...    34   1.1  
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    34   1.2  
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    33   1.2  
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    32   1.3  
Suva_4.362 Chr4 (636207..638579) [2373 bp, 790 aa] {ON} YBR114W ...    34   1.3  
NDAI0A07960 Chr1 (1826531..1828888) [2358 bp, 785 aa] {ON} Anc_3...    33   1.4  
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    33   1.5  
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    33   1.5  
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    33   1.7  
CAGL0M10615g Chr13 (1064930..1066162) [1233 bp, 410 aa] {ON} sim...    33   1.8  
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    33   1.9  
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...    32   2.1  
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...    32   2.3  
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    32   2.9  
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....    32   3.0  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...    33   3.0  
KLLA0C18260g Chr3 (1613311..1614000) [690 bp, 229 aa] {ON} simil...    32   3.2  
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    32   3.2  
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    31   3.3  
SAKL0E13178g Chr5 complement(1086160..1087205,1087289..1087313) ...    32   3.4  
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    32   3.4  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    32   3.8  
KAFR0D02640 Chr4 complement(527097..529427) [2331 bp, 776 aa] {O...    32   4.6  
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...    31   4.8  
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    32   5.2  
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    32   5.4  
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    32   5.5  

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 1093 bits (2826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/544 (97%), Positives = 530/544 (97%)

Query: 1   MTNNSYSMPSADGAHHGEFDNEARDRDRGQNHTTRNVTVAIQYTFLNDNRNSQGSVTEDS 60
           MTNNSYSMPSADGAHHGEFDNEARDRDRGQNHTTRNVTVAIQYTFLNDNRNSQGSVTEDS
Sbjct: 1   MTNNSYSMPSADGAHHGEFDNEARDRDRGQNHTTRNVTVAIQYTFLNDNRNSQGSVTEDS 60

Query: 61  RSTPANDTQSQSNNGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSN 120
           RSTPANDTQSQSNNGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSN
Sbjct: 61  RSTPANDTQSQSNNGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSN 120

Query: 121 EAFDALPVKKLKSVTTDTCSICYDKFXXXXXXXXXXXXXXGLTKPAMGSRLVDGDRKQND 180
           EAFDALPVKKLKSVTTDTCSICYDKF              GLTKPAMGSRLVDGDRKQND
Sbjct: 121 EAFDALPVKKLKSVTTDTCSICYDKFEEEYEESERKRRHEGLTKPAMGSRLVDGDRKQND 180

Query: 181 RAFKIASFGPEEGSSAGRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCI 240
           RAFKIASFGPEEGSSAGRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCI
Sbjct: 181 RAFKIASFGPEEGSSAGRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCI 240

Query: 241 YQWTKENNSCPICRANIVGREGLIQRSPDDQGNDMIFFDRIRDLLYGPQVSADTRIPGEV 300
           YQWTKENNSCPICRANIVGREGLIQRSPDDQGNDMIFFDRIRDLLYGPQVSADTRIPGEV
Sbjct: 241 YQWTKENNSCPICRANIVGREGLIQRSPDDQGNDMIFFDRIRDLLYGPQVSADTRIPGEV 300

Query: 301 DGVAIAQEPIGMETEDEPIFPSHNTSVSGEGIPREYGIQDRATSGISSMRRSSTMAPLPL 360
           DGVAIAQEPIGMETEDEPIFPSHNTSVSGEGIPREYGIQDRATSGISSMRRSSTMAPLPL
Sbjct: 301 DGVAIAQEPIGMETEDEPIFPSHNTSVSGEGIPREYGIQDRATSGISSMRRSSTMAPLPL 360

Query: 361 LDPVDTNYPLRDAFNDTDEPYYNTGIDFSTQNFQHTNRVVGVLDHVFNTSNESRPRVIPQ 420
           LDPVDTNYPLRDAFNDTDEPYYNTGIDFSTQNFQHTNRVVGVLDHVFNTSNESRPRVIPQ
Sbjct: 361 LDPVDTNYPLRDAFNDTDEPYYNTGIDFSTQNFQHTNRVVGVLDHVFNTSNESRPRVIPQ 420

Query: 421 PVFGIGPPNHEQNSRRRPIFRNFGRALRNLRNPYIDRTDGFQIPSQTRASHNSTFTSRYT 480
           PVFGIGPPNHEQNSRRRPIFRNFGRALRNLRNPYIDRTDGFQIPSQTRASHNSTFTSRYT
Sbjct: 421 PVFGIGPPNHEQNSRRRPIFRNFGRALRNLRNPYIDRTDGFQIPSQTRASHNSTFTSRYT 480

Query: 481 PPAVRNSPGNAAANTRNCTTLPVTNNRGGPSFISSQNQSVYENSNGQNFRSHDFSNLAQD 540
           PPAVRNSPGNAAANTRNCTTLPVTNNRGGPSFISSQNQSVYENSNGQNFRSHDFSNLAQD
Sbjct: 481 PPAVRNSPGNAAANTRNCTTLPVTNNRGGPSFISSQNQSVYENSNGQNFRSHDFSNLAQD 540

Query: 541 NSNS 544
           NSNS
Sbjct: 541 NSNS 544

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score =  251 bits (640), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 183/299 (61%), Gaps = 22/299 (7%)

Query: 18  EFDNEARDRDRGQNHTTRNVTVAIQYTFLNDNRNSQGSVTED----SRSTPANDTQSQSN 73
           E  N A ++D      TRN+TVAIQY F+N  R  QG+V  +    + +TPAN + S   
Sbjct: 16  EAGNTAVNQDHTGRRPTRNITVAIQYAFVNGGRGPQGNVLNNGVNATVNTPANASPSPVA 75

Query: 74  NGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKS 133
           +G+   +F D+PE  ++ERF+EI+ALAAD+AMNRLTRR++  RG+  EAF+ALPVK+LK 
Sbjct: 76  DGAFVLNFTDVPESTTQERFDEIIALAADVAMNRLTRRLQRFRGVGKEAFEALPVKRLKD 135

Query: 134 VTTDTCSICYDKFXX---------------XXXXXXXXXXXXGLTKPAMGSRLVDGDRKQ 178
           V  + CSICYD F                                K A G    + + + 
Sbjct: 136 VHGEVCSICYDNFEEENEEEAKEEVNEDDIKSREQNTKDKTLKSKKRARGEH--EKEEED 193

Query: 179 NDRAFKIASFGPEEGSSA-GRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGR 237
           N    K  S GPEEGSS+ G   Q   +T  N+ +E K++ +P YKHSPT+LKCGH FGR
Sbjct: 194 NLNVKKQRSVGPEEGSSSTGEQLQQEPHTLANIVEEHKEKPSPEYKHSPTQLKCGHRFGR 253

Query: 238 VCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGNDMIFFDRIRDLLYGPQVSADTRI 296
           +CIYQWTKE+NSCPICRA IVGREGL +  PD++  D I FDRIR+LLYG + S + ++
Sbjct: 254 MCIYQWTKEHNSCPICRAEIVGREGLNRDLPDEETGDGISFDRIRELLYGSRNSTNLQV 312

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 58/112 (51%), Gaps = 1/112 (0%)

Query: 391 QNFQHTNRVVGVLDHVFNTSNESRPRVIPQPVFGIGP-PNHEQNSRRRPIFRNFGRALRN 449
           Q  Q ++R++ +LDH+F+ SN +RPR  P       P PN E N  RRP+F +F R  RN
Sbjct: 433 QQPQDSDRLLSILDHLFSLSNGNRPRPEPSTRSNAEPVPNGENNEERRPLFSSFVRFARN 492

Query: 450 LRNPYIDRTDGFQIPSQTRASHNSTFTSRYTPPAVRNSPGNAAANTRNCTTL 501
           LRN    +  G Q  +Q  A   ST T+  T   + N      A+ RN T +
Sbjct: 493 LRNARGSQDAGAQATTQAEAPSTSTSTALPTNSTLPNLFSTGVASFRNGTGV 544

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score =  167 bits (422), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 113/312 (36%), Positives = 152/312 (48%), Gaps = 43/312 (13%)

Query: 13  GAHHGEFDNEAR-DRDRGQNH----TTRNVTVAIQYTFLNDNRNSQGSVTE--------- 58
           G+   E D E R +R+ G +      TRNVTVAIQY++LND RN  G             
Sbjct: 36  GSSSREGDEEGRVERENGGSSGGRSNTRNVTVAIQYSWLNDMRNLGGGGGGVGVRGAGLG 95

Query: 59  -----DSRSTPANDTQSQSNNGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMR 113
                D +  PA     + N  +   SF D+P+  S  RF E++ +AA  A++R+TRR  
Sbjct: 96  GGEDGDPQDRPAGGGPGE-NGDTFVMSFTDVPDSTSYARFQEVIGIAAQFAVSRVTRRFS 154

Query: 114 PLRGLSNEAFDALPVKKLKSVTTDTCSICYDKFXXXXXXXXXXXXXXGLTKPAMGSRLVD 173
             RGLS E+F+ LP+K L  +  D CSICY+ F                    +  + V+
Sbjct: 155 LFRGLSKESFEKLPLKSLNEINGDICSICYEDFEDDASVWSKRNRSLDGETSVVKRQRVE 214

Query: 174 GDRK------------QNDRAFKIASFGPEEGSSAG--RPWQDIAYTPKNLSKEPKKEHT 219
           G+              Q+  A    +    E S++G   P  D   TP      P+  + 
Sbjct: 215 GNSTPLQNPSRSTPSVQSPEAADAGTNEVSEVSASGPFAPGADAPDTPA-----PETSNQ 269

Query: 220 PTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGL---IQRSPDDQGN-DM 275
             YKH PTEL CGH+FGR CI++WTKE+NSCPICR+ IV  EGL   I  SP      D 
Sbjct: 270 MDYKHCPTELPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEGLNHAINDSPVVMDEFDR 329

Query: 276 IFFDRIRDLLYG 287
             F+RIR L+YG
Sbjct: 330 QSFERIRQLIYG 341

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score =  161 bits (408), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/266 (36%), Positives = 135/266 (50%), Gaps = 25/266 (9%)

Query: 34  TRNVTVAIQYTFLNDNRNSQGSVTEDSRSTPANDTQSQSNNGSMFFSFPDIPEPNSRERF 93
           TR ++V+IQY F+N  R   G   E+  +T   D       G    +F D+PE  +RER 
Sbjct: 29  TRVISVSIQYAFVNGLRLGAGGEHEEQGAT---DGAGMPPIGDFVLNFTDVPESTTRERI 85

Query: 94  NEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSVTTDTCSICYDKFXXXXXXX 153
           +E++ALA+ +A+NR++R +   RG+S +AF+ LPV K +    D+CSICYD F       
Sbjct: 86  DEVVALASGVAVNRMSRSLNRSRGISRKAFELLPVLKTEQSLEDSCSICYDGFVEEEPEV 145

Query: 154 XXXXXXXGLTKPAMGSRLVDGD------------RKQNDRAFKIASFGPE-EGSSAGRPW 200
                    T      R+ DG+            R + D +      GP  +G +A  P 
Sbjct: 146 PS-------TAEQSRKRVRDGEAGHHGCKHPKRTRYEQDESEVDDQNGPANDGETASSPP 198

Query: 201 QDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGR 260
           +     PK+       +   TYKHSP +L C HVFGR CI QWT  +N+CPICRANIVG 
Sbjct: 199 EQ--EQPKDNENSGDDQGKVTYKHSPVQLPCSHVFGRECIRQWTNLHNTCPICRANIVGA 256

Query: 261 EGLIQRSPDDQGNDMIFFDRIRDLLY 286
           +GL      D   D    +RIR LLY
Sbjct: 257 DGLNNNFAMDDLEDQASLERIRRLLY 282

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 42/99 (42%), Gaps = 22/99 (22%)

Query: 383 NTGIDFSTQNFQHTNRVVGVLDHVFNTSNESRPRVIP------QPVFGIGPPNHEQNSR- 435
           NT  D ST      +R++ +LDH+F+ SN +R R  P      +P  G      E  S  
Sbjct: 417 NTNNDDSTNPGPDNDRLMSILDHIFSISNGNRARSQPTARSNAEPQNGTSTGTAESPSET 476

Query: 436 ----------RRPIFRNFGRALRNLRNPYIDRTDGFQIP 464
                     R  IF N  R  RNLRN     TDG + P
Sbjct: 477 QSTTNSSTPIRSHIFNNLFRFARNLRN-----TDGNREP 510

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score =  157 bits (397), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 94/262 (35%), Positives = 132/262 (50%), Gaps = 15/262 (5%)

Query: 34  TRNVTVAIQYTFLNDNR-NSQGSVTEDSRSTPANDTQSQSNNGSMFFSFPDIPEPNSRER 92
           TRN+ V+IQY F++  R  + G   E+       D  +    G    +F D+P   +RE+
Sbjct: 31  TRNIMVSIQYAFVSGLRLGANGGNPEEG----TGDGATMPPIGDFVLNFTDVPGTATREQ 86

Query: 93  FNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSVTTDTCSICYDKFXXXXXX 152
            +E++ALA+ +A+NR+ RR    RG+S  AF+ LPV K  +V  ++CSICYD F      
Sbjct: 87  LDEVVALASGVAVNRMNRRFNRSRGISKTAFENLPVLKFSAVPQESCSICYDDFEDEAPE 146

Query: 153 XXXXXXXXGLTKPAMGSRLVDGDRKQNDRAFKIASFGPEEGSSAGRPWQDIAYTPKNLSK 212
                      K +   +  DG    +      +     + S           TP   + 
Sbjct: 147 PQPENEQS--RKRSRDHKADDGLHSSSSSKKHRSERDSGQSSEDDEETGGEEPTPAPSTS 204

Query: 213 EPKKEH--------TPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLI 264
           EP KE+        +  YKHSP +L CGH+FGR CI QWT E+N+CPICRA IVG +GL 
Sbjct: 205 EPPKENEADTNNQESIAYKHSPLKLPCGHIFGRECIRQWTNEHNTCPICRARIVGADGLE 264

Query: 265 QRSPDDQGNDMIFFDRIRDLLY 286
             S +D   D I  +RIR LLY
Sbjct: 265 DHSVNDDLEDQISLERIRRLLY 286

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 21/92 (22%)

Query: 386 IDFSTQNFQHTNRVVGVLDHVFNTSNESRPR--------VIPQPVFGIGPPNHEQNSRR- 436
           I+  T N Q  +R++ + DH+F+ SN +RP+          P P    G P+  Q   + 
Sbjct: 443 INTHTDNNQENDRLMNIFDHLFSISNNTRPQPEATLRSDATPMPA---GTPDSSQTDNQS 499

Query: 437 -----RP----IFRNFGRALRNLRNPYIDRTD 459
                RP    IF N  R  RNLRN    ++D
Sbjct: 500 NSAAPRPIRSHIFNNLFRFARNLRNNSTPQSD 531

>AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR143C (SAN1)
          Length = 582

 Score =  157 bits (396), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 145/294 (49%), Gaps = 19/294 (6%)

Query: 34  TRNVTVAIQYTFLNDNRNSQGSVTEDSRSTPANDTQSQSNNGSMFFSFPDIPEPNSRERF 93
           TRNVTVAIQY++L+D RN  G   E              N  +   SF D+P+  S +RF
Sbjct: 43  TRNVTVAIQYSWLHDMRNVGGEGEEAG-------QGPGENGDTFVMSFTDVPDSTSNDRF 95

Query: 94  NEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSVTTDTCSICYDKFXXXXXXX 153
            E++ +AA  A++R+ RR+  LRGLS E+F+ LP++KL  + ++ CSICYD F       
Sbjct: 96  QEVIGIAAQFALSRVARRISLLRGLSKESFEKLPLRKLSELDSELCSICYDDFEDDTSIG 155

Query: 154 XXXXXXXGLTKPAMGSRLVDGDRKQNDRAFKIASFGPEEGSSAGRPWQDIAYTPKNLSKE 213
                        +  +   GD          +S  P E  + G               E
Sbjct: 156 SKRNRDVDNDALYLKRQRTGGDSSAQ------SSLSPGEAGAGGDAGGREGGHAGGWPAE 209

Query: 214 PKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGL---IQRSPDD 270
            + E +  YKHSPTEL CGHVFGR CI++WT+E+NS   C A IV  EGL   +Q +P  
Sbjct: 210 EEAEQS-HYKHSPTELPCGHVFGRDCIFRWTQEHNSLSYCWARIVENEGLNHAVQDTPVV 268

Query: 271 QGN-DMIFFDRIRDLLYGPQVSADTRIPGEVDGVAIAQEPIGMETEDEPIFPSH 323
               D   F+RIR L+YG   S+  R  G+  G+ + +  + +   D   F  H
Sbjct: 269 MDEFDRQSFERIRQLIYGDNASSGDRPNGD-GGITLQRHNVIVIRPDSASFNGH 321

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score =  140 bits (354), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 136/279 (48%), Gaps = 34/279 (12%)

Query: 34  TRNVTVAIQYTFLNDNRNSQGSVTEDS---RSTPANDTQSQSN---------------NG 75
           TRN+TV+IQY++    R +Q S T ++    ++ AN T + +N               +G
Sbjct: 48  TRNITVSIQYSYFTPERLAQLSNTSNNGNIENSSANSTNTIANGAGPSFGIGNGGHQPDG 107

Query: 76  SMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSV- 134
           ++  SF D+P    ++R N  +++AA +AM R  R +   +G++ + FD LPV K+  + 
Sbjct: 108 ALVLSFRDVPASTPQDRLNSFISVAAQLAMERFNRLLNRPKGITKDDFDKLPVLKVSDLP 167

Query: 135 --TTDTCSICYDKFXXXXXXXXXXXXXXGLTKPAMGSRLVDGDRKQNDRAFKIASFGPEE 192
                 CSICYD++                 +          D K    A   A+   E+
Sbjct: 168 KSEGSLCSICYDEYEEEKDLNTTKRRRESEGEEESEKLKKRRDNKGMPTAGTSAAIA-EQ 226

Query: 193 GSSAGRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPI 252
            S+A     D  + P +      +E  P+YKHSP +L CGH+FGR CIY+W+K  NSCP+
Sbjct: 227 SSTA---LADQPHAPND------EETNPSYKHSPIKLPCGHIFGRECIYKWSKLENSCPL 277

Query: 253 CRANI---VGREGLIQRSPDDQGNDMIFFDRIRDLLYGP 288
           CR  I    G +   Q+  D+   +   F+RIR +LY P
Sbjct: 278 CRHKISESAGIQNTAQQDTDEVAANEAAFERIRRVLYDP 316

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score =  137 bits (344), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 125/267 (46%), Gaps = 34/267 (12%)

Query: 38  TVAIQYTFLNDNRNSQGSVTEDSRSTPANDTQSQSNNGSMFFSFPDIPEPNSRERFNEIM 97
           T+AI Y  L+ N    G+   ++  TP            M   F D+P   S  R NE++
Sbjct: 34  TIAINYASLSGNDEQAGNDAANTAFTP------------MILRFADVPSDTSSGRLNEVI 81

Query: 98  ALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSVTTDTCSICYDKFXXXXXXXXXXX 157
           ALA++     LTR  R   GL+ EAF+ L V+K+ ++   TC+ICYD             
Sbjct: 82  ALASEYIFQTLTRDQRRHSGLTREAFEKLEVQKVDTLDEKTCAICYDDLINDPKDFASTS 141

Query: 158 XXXGLTKPAMGSRLVDGDRKQNDRAFKIASFGPEEGSSAGRPWQDI--------AYTPKN 209
              G  +  +GS      ++Q  R  + A    +EG       Q +        +     
Sbjct: 142 SKRG--REEIGSAESPNSKRQ--RNEEAAPLPHQEGLPENESDQRVDNELPDPESSAHHT 197

Query: 210 LSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGL-IQRSP 268
             +E  +E TPTY HS T L CGHVFGR C+Y+WT E+NSCPICRA I+  E L    S 
Sbjct: 198 GEQEGGQEDTPTYGHSATVLPCGHVFGRECLYKWTTEHNSCPICRAPILSEEELQALHSS 257

Query: 269 DD---QGND------MIFFDRIRDLLY 286
           DD   +GN+         F+ IR LLY
Sbjct: 258 DDTSSRGNNGPDATQQSTFESIRRLLY 284

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score =  130 bits (327), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 138/289 (47%), Gaps = 31/289 (10%)

Query: 34  TRNVTVAIQYTFLNDNRNSQ---GSVTEDSRSTPANDTQSQSN---------------NG 75
           TRN+TV+IQY++    R +Q    S   +S ++ A  T + +N               +G
Sbjct: 48  TRNITVSIQYSYFTPERLAQLSNTSNNGNSENSNATSTNTIANGAGPSFGIGNGGHQPDG 107

Query: 76  SMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSVT 135
           ++  SF D+P    ++R N  +++AA +AM R  R +   +G++ + F  LPV K+  + 
Sbjct: 108 ALVLSFRDVPASTPQDRLNSFISVAAQLAMERFNRLLNRPKGITKDEFGKLPVLKISDLP 167

Query: 136 TD---TCSICYDKFXXXXXXXXXXXXXXGLTKPAMGSRLVDGDRKQNDRAFKIASFGPEE 192
           T     CSICYD++                 +   G       RK N  A    +     
Sbjct: 168 TSEGPLCSICYDEYEEENDISKTKREREFEDE---GESEGIKKRKDNGGAPITQTTTGNS 224

Query: 193 GSSAGRPWQDIAYTPKNLSKEP----KKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENN 248
           GS+     +    +   L+++P     +E  P+YKHSP +L CGH+FGR CIY+W++  N
Sbjct: 225 GSATDTNAEIAGQSSTPLTEQPLTPNDEETNPSYKHSPIKLPCGHIFGRECIYKWSRLEN 284

Query: 249 SCPICRANIVGREGL---IQRSPDDQGNDMIFFDRIRDLLYGPQVSADT 294
           SCP+CR  I    G+    ++  D+   +   F+RIR +LY P    +T
Sbjct: 285 SCPLCRHKISENAGVQRAAEQDTDEVAANEAAFERIRRVLYDPTAGNNT 333

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score =  129 bits (324), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 128/266 (48%), Gaps = 31/266 (11%)

Query: 34  TRNVTVAIQYTFLNDNRNSQGSVTEDSRSTPANDTQSQSN--NGSMFFSFPDIPEPNSRE 91
           TR++TV+IQY++ N N  +  +  + + +   N      N  +G++  SF D+P    +E
Sbjct: 33  TRSITVSIQYSYFNPNGLANLNPNQPNGNAEGNGETPTVNRPDGALILSFRDVPTSTPQE 92

Query: 92  RFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSVT---TDTCSICYDKFXX 148
           R   I+++AA++AM R +  M   +G++ E F+ LP  K++ +       CSICYD +  
Sbjct: 93  RLESIISIAAELAMRRFSDMMSQPKGITKEQFEQLPALKVRELADRHNTICSICYDAYED 152

Query: 149 XXXXXXXXXXXXGLTKPAMGSRLVDG-DRKQNDRAFKIASFGPEEGSSAGRPWQDIAYTP 207
                        L          DG D  Q  +  +     P E SS+    QD     
Sbjct: 153 ELSNIFKRTREDDL----------DGRDGLQKKQRSESPVVVPTEQSSS---QQD----- 194

Query: 208 KNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRS 267
           +N  + P     PTYKHSP  L C HVFGR C+++W++  NSCP+CR  IV  E    +S
Sbjct: 195 ENTEQAPNVMEPPTYKHSPVVLPCNHVFGRECLFKWSQLENSCPLCRHKIV--EAAAGQS 252

Query: 268 PDDQGNDMI-----FFDRIRDLLYGP 288
            +D    +       F+RIR  LY P
Sbjct: 253 GEDSNGAVANQNAEAFERIRQALYNP 278

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score =  129 bits (324), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 133/289 (46%), Gaps = 34/289 (11%)

Query: 29  GQNHTTRNVTVAIQYTFLNDNR----------NSQGSVTEDSRSTPANDTQ--------S 70
           G    TRN+TV+IQY++    R          ++  + +  S ST AN T          
Sbjct: 34  GGAEQTRNITVSIQYSYFTPERLAHLSNISNNDNNENNSAASGSTIANGTGPSFGIGNGG 93

Query: 71  QSNNGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKK 130
              +G++  SF D+P    ++R N  +++AA +AM R  R +   +G+S + FD LPV +
Sbjct: 94  HQPDGALVLSFRDVPASTPQDRLNSFISVAAQLAMERFNRLLNRPKGISKDEFDKLPVLQ 153

Query: 131 ---LKSVTTDTCSICYDKFXXXXXXXXXXXXXXGLTKPAMGSRLVDGDRKQNDRAFKIAS 187
              L       CSICYD++                 + +      +G +K+ D       
Sbjct: 154 VSDLPKAEGPLCSICYDEYEDEVDSTKAKRK-----RDSENEEESEGTKKRKDNEGAPLR 208

Query: 188 FGPEEGSSAGRPWQDIAYTPKNLSKEPKK-----EHTPTYKHSPTELKCGHVFGRVCIYQ 242
              +  S+       +   P     E ++     E  P+YKHSP +L CGH+FGR CIY+
Sbjct: 209 TTADNDSNPSITNATVVEPPSIPLTEQQRTLNDEETNPSYKHSPIKLPCGHIFGRECIYK 268

Query: 243 WTKENNSCPICRANI---VGREGLIQRSPDDQGNDMIFFDRIRDLLYGP 288
           W++  NSCP+CR  I   VG +   Q+  D+   +   F+RIR +LY P
Sbjct: 269 WSRLENSCPLCRQKISESVGVQRAAQQDTDEVAANEAAFERIRRVLYDP 317

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score =  127 bits (320), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 116/223 (52%), Gaps = 17/223 (7%)

Query: 75  GSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSV 134
           G+   SF D+P   S+ER + +++LA ++AM R  + +RP +G+S E F+ LP+ K K +
Sbjct: 93  GAFILSFRDVPIATSQERLSTVISLATELAMRRYNQLIRP-KGISRENFEKLPILKTKDI 151

Query: 135 T-TDTCSICYDKFXXXXXXXXXXXXXXGLTKPAMGSRLVDGDRKQNDRAFKIASFGPEEG 193
           T T  CSICY+ +                 K A G    +     N +  K+A+ G    
Sbjct: 152 TGTTECSICYEPYVDEPDPIDNKR------KRAAGDGTEEDSNDDNKKKRKLATAGAAND 205

Query: 194 SS--AGRPWQDIAYTPKNLSKEPKKE-HTPTYKHSPTELKCGHVFGRVCIYQWTKENNSC 250
           ++  A     +   T  N S    +E   P Y HSP +L C H+FGR C+Y+W+K  NSC
Sbjct: 206 TAPLASTSTTENTDTGNNSSSTNIEEAEEPVYLHSPVKLPCDHIFGRECLYKWSKLENSC 265

Query: 251 PICRANIV----GREGLIQRSPDDQGNDMIFFDRIRDLLYGPQ 289
           P+CR  I+     R   I  + D  GND + F++IR++LY P+
Sbjct: 266 PLCRHKIIESDSERASEISTA-DRAGNDAM-FEQIRNMLYAPE 306

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score =  124 bits (312), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 124/462 (26%), Positives = 185/462 (40%), Gaps = 107/462 (23%)

Query: 34  TRNVTVAIQYTFLNDNRNSQGSVT---EDSRSTPANDTQSQSN---------------NG 75
           TRN+TV+IQY++    R +Q S T   ++S  + A  T + +N               +G
Sbjct: 48  TRNITVSIQYSYFTPERLAQLSNTSSNDNSGGSTATSTNTIANGAGPSFGIGNGGHQPDG 107

Query: 76  SMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKK---LK 132
           ++  SF D+P    ++R N  +++AA +AM R  R +   +G++ E FD L V K   L 
Sbjct: 108 ALVLSFRDVPASTPQDRLNSFISVAAQLAMERFNRLLNRPKGITKEDFDKLTVLKVADLP 167

Query: 133 SVTTDTCSIC---------YDKFXXXXXXXXXXXXXXGLTKPAMGSRLVDGDRKQNDRAF 183
                 CSIC         + K                + K           +K N    
Sbjct: 168 ETEGPACSICYEEYEEEDDFSKTKRKRESEDNEEESGNIKK-----------QKDNQGGS 216

Query: 184 KIASFGPEEGSSA--GRPWQDIAYTPKNLSK--EPKKEHT-------PTYKHSPTELKCG 232
                 P  GS+A         A TP   S   E  + HT       P+YKHSP  L CG
Sbjct: 217 FAGRTAPANGSTAMSDNDSNSNATTPNPSSTPLESNQPHTANDEETNPSYKHSPIRLPCG 276

Query: 233 HVFGRVCIYQWTKENNSCPICRANIVGREGL-IQRSPDDQGNDMIFFDRIRDLLYGPQVS 291
           HVFGR C+Y+W++  NSCP+CR  I    G+ +Q+  D+   +   F+RIR +LY P   
Sbjct: 277 HVFGRECLYKWSRLENSCPLCRHKISESAGVPVQQDTDEVAANEAAFERIRRVLYDPAAE 336

Query: 292 ADTRIPGEVDGVAIAQEPIGMETEDEPIFPSHNTSVSGEGIPREYGI------------- 338
            +     + +   I    +   +   P   + N   SGE I    G              
Sbjct: 337 NNN----DENNSEITNPTVNSSSTTAPTIGNAN---SGEQILSRTGFFLMPQNGQTLHNP 389

Query: 339 -------QDRATS-GISSMRRS--STMAPL-----PLLDPV---------------DTNY 368
                   DR TS G +   ++  S  APL     P   P+                +++
Sbjct: 390 AHVPTNNSDRNTSNGTTPAAQNVPSNAAPLNNNQNPRWVPIPLTLFQFHSPNPNASSSDH 449

Query: 369 PLRDAFNDTDEPYYNTGIDFSTQNFQHTNRVVGVLDHVFNTS 410
           P       + +P    G D  T + QH NR+  VLDH+FN +
Sbjct: 450 PTNSTTTSSADP---NGTDTDTTSLQH-NRLRAVLDHIFNVA 487

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score =  122 bits (305), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/322 (28%), Positives = 139/322 (43%), Gaps = 83/322 (25%)

Query: 34  TRNVTVAIQYTFL--NDNR-------NSQGSVTEDSRSTPANDTQ--------------- 69
           TRN+TV+IQY++L  N +R       N+   V  +  ST A  T+               
Sbjct: 31  TRNITVSIQYSYLFPNGSRLNQSNMVNTNNMVQNNVTSTTATGTRHTATENETTTTSTDT 90

Query: 70  ------------------SQSNNGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRR 111
                              +S +G++  SF D+P   S+ER + I+++AA+ A+ R +  
Sbjct: 91  PHLNDASFNPFAMGVNLRQRSPDGAVILSFRDVPASTSQERLDNIISIAAEFAIRRFSDL 150

Query: 112 MRPLRGLSNEAFDALPVKKLKSVTTD---TCSICYDKFXXXXXXXXXXXXXXGLTKPAMG 168
             P R ++ E F+ LPV KL  +  +   TCSICYD                 + + A  
Sbjct: 151 QVPTRAITKEQFETLPVLKLSDIVNENDKTCSICYDDLVDEDQ----------VEEGADN 200

Query: 169 SRLVDGDRKQNDRAFKIASFGPEEGSSAGRPWQDI-------AYTPKNLSKEPK------ 215
            R    D + + +  K    GP       RP + +            N   E +      
Sbjct: 201 KRKYSVDEEDDIKDQKKVKTGPNNNRE--RPTEQLLDAVRSSTSAQNNTESETQTSRPAS 258

Query: 216 -------KEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSP 268
                  +E +PTY HSPTEL C H+FGR C+Y+WT+  N+CP+CR  I   E  +   P
Sbjct: 259 GVDTIQSEEDSPTYLHSPTELPCKHIFGRECLYKWTRVQNTCPLCRHIIA--ESPVNAPP 316

Query: 269 D----DQGNDMIFFDRIRDLLY 286
           +    + G  +  F+RIR L+Y
Sbjct: 317 NAPDGNNGGTVDAFERIRQLIY 338

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score =  120 bits (302), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 110/227 (48%), Gaps = 22/227 (9%)

Query: 75  GSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKL--- 131
           G+   SF D+P    + R   I+ +AA++AM R T      RG+S EAF+ LPV  L   
Sbjct: 145 GTFVLSFRDVPSSTPQSRLESIIGIAAEIAMRRFTELHSRARGISKEAFETLPVLTLEEA 204

Query: 132 KSVTTD-TCSICYDKFXXXXXXXXXXXXXXGL------TKPAMGSRLVDGDRKQNDRAFK 184
           K +T D +CSICY+                 +       +     R ++G+   ++  + 
Sbjct: 205 KKLTEDLSCSICYEPLEEEVKVDEMNENKKRVRNDDDNEEERSKRRRLNGEANPSNGNYS 264

Query: 185 IASFGPEEGSSAGRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWT 244
           I       G + G        T  + + + ++   PTY HSP +L CGH+FGR C+++W+
Sbjct: 265 I-------GLTEGATINSNTGTSTDSTTKHEENEVPTYSHSPLKLPCGHIFGRECLFKWS 317

Query: 245 KENNSCPICRANIV---GREGLIQRSPDDQGNDMIFFDRIRDLLYGP 288
           K  N+CP+CR  I+     E  +  S + Q  +   F+RIR+LLY P
Sbjct: 318 KVENTCPLCRHVIIENNQNEANVDSSVEAQSTEA--FERIRNLLYNP 362

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score =  118 bits (295), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 120/277 (43%), Gaps = 44/277 (15%)

Query: 34  TRNVTVAIQYTFLNDNRNS--------------------QGSVTEDSRSTPANDTQSQSN 73
           TRN+TVA+ Y+ L     +                      +  + S + P  +   Q  
Sbjct: 32  TRNITVAVHYSLLTPGTTTPVPGSGPTSGPQTQQPQTGANAAAADGSTNPPPPNVLPQQL 91

Query: 74  NGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKS 133
            G+   SF D+P   S+ R   I+ +A ++A  R    +   +G+S E F+ LPV  L  
Sbjct: 92  PGAFILSFRDVPNTTSQNRLQSIITMATELAAQRFRSMIDRPKGISKEQFEKLPVLTLDD 151

Query: 134 VTTD----TCSICYDKFXXXXXXXXXXXXXXGLTKPAMGSRLVDGDRKQNDRAFKIASFG 189
           +  +     CSIC++ +                          D +   N +  KI    
Sbjct: 152 LKKNGSDLQCSICFEPYVADATTTKKRSLSG-----------TDSEEPGNAKKRKI---- 196

Query: 190 PEEGSSAGRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNS 249
             + ++A  P  +    P    ++  +E  PTY HSPT+L CGH+FGR C+Y+W K  N+
Sbjct: 197 --DATTASTPTSN-EPEPTTTVEDNDEEAHPTYNHSPTKLPCGHIFGRECLYRWCKLENT 253

Query: 250 CPICRANIVGREGLIQRSPDDQGNDMIFFDRIRDLLY 286
           CP+CR +++      Q    D  +D   F+RIR+L+Y
Sbjct: 254 CPLCR-HVIAEVDTTQHQAQDAASDQA-FERIRNLVY 288

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score =  111 bits (278), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 103/336 (30%), Positives = 159/336 (47%), Gaps = 70/336 (20%)

Query: 2   TNNS-YSMPSADGAHHGEFDNEARDRDRG----QNHTTRNVTVAIQYTFLNDNR------ 50
           TNNS  + P  DG +     N+ ++ D G        T N+TV+IQY++           
Sbjct: 4   TNNSDGARPPNDGEN--PLSNDGQNGDSGAVDSSGRPTTNITVSIQYSYFTPTSLTGTTA 61

Query: 51  --NSQGSVTEDSRSTPAN--DTQSQSN-------------NGSMFFSFPDIPEPNSRERF 93
             NS  SV   S S  +N  D  S++              +GS+  SF D+P    ++R 
Sbjct: 62  GGNSGDSVASGSNSGTSNIGDGGSETTAAGIPPMFPVGRPDGSLVLSFRDVPSSTPQQRL 121

Query: 94  NEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSVTTD---TCSICYDKFXXXX 150
             I+++AA++AM R +  + P +G+  E FD L V KLK +  D   TC +CYD+F    
Sbjct: 122 ESIISIAAELAMRRFSDMVMPNKGIPREEFDKLKVLKLKDLPADADKTCGVCYDEF---- 177

Query: 151 XXXXXXXXXXGLTKPAMGS-RLVDGDRKQND--------RAFKIASF--GPEEGSSAGR- 198
                      + +P  G+ R  + D K+++        +  K++S   GP+      R 
Sbjct: 178 -----------VDEPVPGAKRERETDNKEDEEEEGSGNVKRAKVSSENEGPQPNEGETRQ 226

Query: 199 ----PWQDIAYTPKNLSKEPKKEHT--PTYKHSPTELKCGHVFGRVCIYQWTKENNSCPI 252
               P Q    T +N +  P +E +  P Y  SP EL C H+FGR C+Y+WT+  N+CP+
Sbjct: 227 TENGPNQGTTST-QNSNTLPNQEESNEPVYLESPVELPCHHIFGRECLYKWTRHENTCPL 285

Query: 253 CRANIVGREGLIQRSPDDQG--NDMIFFDRIRDLLY 286
           CR +I+      QR+   +   N+   F+RIR LLY
Sbjct: 286 CR-HIIVELTPEQRNAQQESNNNNTEAFERIRQLLY 320

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score =  111 bits (277), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 111/242 (45%), Gaps = 33/242 (13%)

Query: 77  MFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKSV-- 134
           +  SF D+P   S +R N  + +AA++AM R    +   +G++NEAF  LPV K++ +  
Sbjct: 111 LILSFQDVPL-TSPDRLNSFITIAAELAMRRFQNMLNRPKGITNEAFKELPVIKIEELPD 169

Query: 135 -TTDTCSICYDKFXXXXXXXXXXXXX---------------XGLTK-PAMGSR------L 171
            T  TCSICYDKF                             G  K P  GS        
Sbjct: 170 KTETTCSICYDKFVDEPEDTAENSKKRKHESNSNEDSMDDITGEGKLPRTGSNTPSSLMA 229

Query: 172 VDGDRKQNDRAFKIAS-FGPEEGSSAGRPWQD-----IAYTPKNLSKEPKKEHTPTYKHS 225
             G    N+    I+S   P+  S + +  +      I  T      +  +E  P Y HS
Sbjct: 230 ATGISDNNNERTTISSILNPQSESDSSQSHESTHNAFIENTEGQDQAQATQEQNPEYLHS 289

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIV-GREGLIQRSPDDQGNDMIFFDRIRDL 284
           P ++ CGH+FGR C+Y+WT+  NSCP+CR  I    E   QR  ++  ++M  F+ IR +
Sbjct: 290 PVKIPCGHIFGRSCLYEWTRLENSCPLCRKKIAEQTEEEEQRENNENTSNMEAFEAIRRM 349

Query: 285 LY 286
           LY
Sbjct: 350 LY 351

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score =  110 bits (275), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 135/306 (44%), Gaps = 43/306 (14%)

Query: 34  TRNVTVAIQYTFLN--------DNRNSQ----------GSVTEDSRSTPANDTQ------ 69
           TRN+TV+IQY+ LN        +N  S           GS T ++    +N +Q      
Sbjct: 103 TRNITVSIQYSLLNPQTRLTTSNNMASNFSFNPSTALNGSSTSETPDRTSNGSQLAPDNI 162

Query: 70  -SQSNNGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPV 128
            ++  NG++  SF D+P     +    ++++AA++A  R    M    G+S + F+ L +
Sbjct: 163 PNRQANGTLVLSFRDVPVSTPSDTLESVISVAAELATRRFVDIMTQSNGISQKDFENLSI 222

Query: 129 KKLKSVTTDT--CSICYDKFXXXXXXXXXXXXXXGL-----TKPAMGSRLVDGDRKQNDR 181
            KL S+ T T  CSIC + +               L     +K      +     + N  
Sbjct: 223 LKLNSLPTSTELCSICMEPYEEEPSATLSKKRSRDLDRLEDSKAKKPRSMESNSTESNST 282

Query: 182 AFK-------IASFGPEEGSSAGRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHV 234
           A         IA F      +   P    +  P + + +  K+H   Y +SP +L C H+
Sbjct: 283 AVSTNSVDNGIAQFNETTQLTTVAPSSMDSTIPTSSTPDENKKHE--YHNSPVQLSCKHI 340

Query: 235 FGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGNDMIFFDRIRDLLYGPQ-VSAD 293
           F R C+Y+W+K  NSCP+CR  IV     ++ +  +  N    F+RIR +LY    ++++
Sbjct: 341 FCRSCLYEWSKLKNSCPLCRKKIV-ETPTVENNIQNDANSNEAFERIRRILYNNHNLNSE 399

Query: 294 TRIPGE 299
           T  P E
Sbjct: 400 TNTPTE 405

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 110/235 (46%), Gaps = 22/235 (9%)

Query: 74  NGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKS 133
           +G++  SF D+P    +ER   I+++AA++AM R +  M   +G++ E F+ LPV ++ S
Sbjct: 126 DGALVLSFRDVPVSTPQERLESIISIAAELAMRRFSDIMSIPKGITREQFEQLPVVQVSS 185

Query: 134 V--TTDT-CSICYDKFXXXXXXXXXXXXXXGLTKPAMGSRLVDGDRKQNDRAFKIASFGP 190
           +    DT CSICY+ +                 +       V   R ++  + +     P
Sbjct: 186 LPEKQDTICSICYENYEDEPSTPLKRARDGEDMEDEEDLDSVKKRRSESPGSSETMETAP 245

Query: 191 ----------EEGSSAGRPWQDIAYTPKNL-------SKEPKKEHTPTYKHSPTELKCGH 233
                     EEG+ +    +  + T +         S +  +E    Y HSP +L C H
Sbjct: 246 SHPLEHSDNQEEGNGSHVHEEQRSETAQQQPEAPQQDSSQQGEESQKKYLHSPVQLPCAH 305

Query: 234 VFGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGN--DMIFFDRIRDLLY 286
           +FGR C+ +W++  NSCP+CR  IV  +   +  P +     +M  F+RIR LLY
Sbjct: 306 IFGRECLDKWSQIENSCPLCRRKIVEVQPEQRPEPGNPAGTTNMEAFERIRQLLY 360

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 52/87 (59%), Gaps = 8/87 (9%)

Query: 207 PKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIV--GREGLI 264
           P N    P++E  PTY HSPT+L CGH+FGR CI++W+   NSCP+CR  IV   R    
Sbjct: 317 PNNQESSPEEEQ-PTYLHSPTKLPCGHIFGRDCIFKWSHLENSCPLCRKAIVVIDRNDAS 375

Query: 265 QRSPDDQGN-----DMIFFDRIRDLLY 286
           Q +P ++ N     D   F R+ D+LY
Sbjct: 376 QNNPLNEANREHLFDPAIFQRLGDMLY 402

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 74  NGSMFFSFPDIPEPNSRERFNEIMALAADMAMNRLTRRMRPLRGLSNEAFDALPVKKLKS 133
           N ++  SF D+P    R     I+ +A ++ M R        +G+S E F+ LPV KL  
Sbjct: 136 NAALILSFRDVPNSTPRSTLENIITIATELTMRRFNDFAGHPKGISREQFEELPVLKLCE 195

Query: 134 VTTDT----CSICYDKF 146
           +T +     C+IC++ +
Sbjct: 196 LTEEQLDTGCAICFETY 212

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 22/29 (75%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICRANI 257
            +KCGH F   CI+ W KE+N+CP+C+ N+
Sbjct: 1177 VKCGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 22/29 (75%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICRANI 257
            +KCGH F   CI+ W KE+N+CP+C+ N+
Sbjct: 1177 VKCGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 224  HSPTELKCGHVFGRVCIYQWTKENNSCPICR 254
            H+ + +KCGH F R CI+ W K N SCP+C+
Sbjct: 1209 HTGSIIKCGHFFCRKCIHSWLKNNQSCPLCK 1239

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICR 254
            +KCGH F R CI+ W K +NSCP+C+
Sbjct: 1167 IKCGHFFCRSCIHSWLKNHNSCPMCK 1192

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 20/29 (68%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICR 254
           P+ L CGHVF   CI  WTKEN  CP+CR
Sbjct: 287 PSCLPCGHVFCWDCITDWTKENPECPLCR 315

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 213 EPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           E  + HT   K+ P  L CGHV    C+  W + + +CPICR  +    G
Sbjct: 329 EQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMG 378

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICR 254
           P+ L CGH+F   C+ QW  E N CP+CR
Sbjct: 276 PSCLPCGHMFCWACVMQWCNERNECPLCR 304

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 224  HSPTELKCGHVFGRVCIYQWTKENNSCPICR 254
            H  + +KCGH F R CI+ W K   +CPIC+
Sbjct: 1185 HHGSIMKCGHFFCRDCIHSWLKNQRTCPICK 1215

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICRA 255
            +KCGH F + CI  W K  NSCP+C+ 
Sbjct: 1239 IKCGHFFCKKCIQSWLKNKNSCPLCKT 1265

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 217 EHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGNDM 275
           +H    K  P +L CGH+    C+  W + + +CPICR  +           DD+GN M
Sbjct: 357 DHIMKSKQKPKKLPCGHILHLNCLKNWMERSQTCPICRLPVF----------DDKGNVM 405

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 214 PKKEHTP-TYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQG 272
           P +E    T K+ P  L CGHV    C+  W + + +CPICR  +    G + +S     
Sbjct: 349 PDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVVQSQSSTT 408

Query: 273 N 273
           N
Sbjct: 409 N 409

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICR 254
            LKCGH F + C+  W K+N SCP+C+
Sbjct: 1221 LKCGHFFCKDCVTHWFKKNTSCPMCK 1246

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICR 254
            +KCGH F + CI+ W K + SCP+C+
Sbjct: 1236 IKCGHFFCQSCIFSWLKNHASCPLCK 1261

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 224  HSPTELKCGHVFGRVCIYQWTKENNSCPICR 254
            H+ + + CGH F   CI+ W K N++CP+C+
Sbjct: 1279 HTGSMISCGHFFCNNCIFSWLKLNSNCPLCK 1309

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICR 254
            +KCGH F + CI+ W K  + CPIC+
Sbjct: 1164 IKCGHFFCKHCIFSWLKNKSVCPICK 1189

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICR 254
            +KCGH F + CI+ W +  N+CP+C+
Sbjct: 1177 IKCGHFFCKSCIHSWLRNKNACPLCK 1202

>Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] {ON}
            YLR247C (REAL)
          Length = 1557

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICRA 255
            +KCGH F + CI  W + +N CPIC++
Sbjct: 1253 IKCGHYFCKNCILTWLRAHNKCPICKS 1279

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGL 263
           CGH+F   CI  W KE   CP+CR   + ++ L
Sbjct: 333 CGHLFCWACIMNWCKEREECPLCRQRCLRQQIL 365

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENNSCPICR 254
           Y   P+   CGH+F   CI +WT E   CP+CR
Sbjct: 261 YMLDPSATPCGHLFCWDCIMEWTLERQECPLCR 293

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 16/26 (61%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICR 254
            LKCGH F   CIY W +    CPIC+
Sbjct: 1280 LKCGHFFCEDCIYDWLQTRTICPICK 1305

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           KH P +L C H     C+  W + + +CPICR ++   +G
Sbjct: 331 KHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKG 370

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 40.4 bits (93), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 35/87 (40%), Gaps = 11/87 (12%)

Query: 178 QNDRAFKIASFGPEEGSSAGRPWQDIAYTPKNLSKEPKKEHTPT----------YKHSPT 227
           QN++A    S G    S+AG P  D       L +  +    P+          +   P+
Sbjct: 55  QNEKATSSLSVGETTLSTAGLP-TDSQVEHIGLEQASEMSFIPSDSRKCILCLGFMLDPS 113

Query: 228 ELKCGHVFGRVCIYQWTKENNSCPICR 254
              CGHVF   C+  W  E   CP+CR
Sbjct: 114 CAPCGHVFCWKCLLSWCNERPECPLCR 140

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 12/57 (21%)

Query: 206 TPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           T KN +K+PK+            L CGH+    C+  W + + +CPICR ++   +G
Sbjct: 359 TWKNKNKKPKR------------LPCGHILHLSCLKNWMERSQTCPICRLSVFDEKG 403

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICRA 255
            +KCGH F + CI  W + ++ CPIC++
Sbjct: 1256 IKCGHYFCKSCILTWLRSHSKCPICKS 1282

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICR 254
            +KCGH F + CI  W K ++SCP+C+
Sbjct: 1202 IKCGHFFCQDCICSWLKNHSSCPLCK 1227

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSP 268
           P  L CGH+    C+  W + + +CPICR  +   +G + ++P
Sbjct: 370 PKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTP 412

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGL 263
           P+   CGH+F   CI  W KE + CP+CR   + +  L
Sbjct: 281 PSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSIL 318

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQR 266
           CGH+F   C+  W KE   CP+CR +   +E L+ R
Sbjct: 301 CGHLFCWSCLMSWCKERPECPLCRQHCQPQEILVLR 336

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 40.4 bits (93), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRS 267
           CGH F   CI  W  +N +CPICR N+   + +I  S
Sbjct: 127 CGHHFDFECISIWLSKNETCPICRDNLTSHKEVIDTS 163

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQR 266
           CGH+F   C+  W KE   CP+CR     +E L+ R
Sbjct: 301 CGHLFCWDCLMSWCKERPECPLCRQQCQTQEILVLR 336

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICR 254
           P+ L CGH+F   CI  W  E + CP+CR
Sbjct: 280 PSCLPCGHLFCWNCIMHWCTERSECPLCR 308

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           P +L CGH+    C+  W + + +CPICR  +  ++G
Sbjct: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKDG 431

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICR 254
            +KCGH F + CI  W + ++ CPIC+
Sbjct: 1252 IKCGHYFCKSCILTWLRAHSKCPICK 1277

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICR 254
            LKCGH F + CI  W K   +CP+C+
Sbjct: 1204 LKCGHFFCKRCITSWLKNKKNCPMCK 1229

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQR 266
           CGH+F   C+  W KE   CP+CR     +E L+ R
Sbjct: 301 CGHLFCWNCLMSWCKERPECPLCRQQCQTQEILVLR 336

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRS 267
           C H F   CI  W ++N+SCPICR +++ ++  I  S
Sbjct: 136 CKHYFDLECITLWLQKNSSCPICRNDVLEKKFKIDDS 172

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQR 266
           P +L CGH+    C+  W + + +CPICR  +    G + R
Sbjct: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTR 372

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 229  LKCGHVFGRVCIYQWTKENNSCPICRA 255
            +KCGH F + CI  W + ++ CPIC++
Sbjct: 1249 IKCGHYFCKNCILTWLRAHSKCPICKS 1275

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 12/57 (21%)

Query: 206 TPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           T KN +K+PK+            L CGH+    C+  W + + +CPICR  +   +G
Sbjct: 364 TWKNKNKKPKR------------LPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 408

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           P +L CGHV    C+  W + + +CPICR  +    G
Sbjct: 372 PKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENG 408

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQR 266
           P+   CGH+F   CI  W KE   CP+CR     ++ L  R
Sbjct: 286 PSCAPCGHIFCWDCILSWCKERPECPLCRQKCQAQQVLSLR 326

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENNSCPICR 254
           Y   P+   CGH+F   CI  W KE   CP+CR
Sbjct: 286 YMTDPSCSPCGHIFCWECILDWCKERPECPLCR 318

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICR 254
           P+   CGH+F   CI  W KE   CP+CR
Sbjct: 288 PSAAPCGHIFCWDCIINWCKERPECPLCR 316

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           K  P  L CGH+    C+  W + + +CP+CR  +   +G
Sbjct: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKG 383

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 10/101 (9%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGNDMIFFDRI 281
           +  +P    CGH F  VCI ++ + N+ CP+C   +  RE ++ RS       +  +  +
Sbjct: 34  FLKTPVLTPCGHTFCSVCIREYLQSNSKCPLCLLEL--RESML-RSEFLVNGIVQTYQSL 90

Query: 282 R----DLLYGPQVSADTRIP---GEVDGVAIAQEPIGMETE 315
           R    D+L   + S DT I     + +G +  +EPI +  E
Sbjct: 91  RPSLIDILDSTRSSNDTSIIELGSDSEGDSYVKEPIDITGE 131

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 37.7 bits (86), Expect = 0.010,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRS 267
           CGH F   C+  W  +N +CP+CR +I   + +I  S
Sbjct: 55  CGHNFDYECLSIWLSKNKTCPMCRDDITSHKEVIDTS 91

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 12/57 (21%)

Query: 206 TPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           T KN +K+PK+            L CGH+    C+  W + + +CPICR  +   +G
Sbjct: 363 TWKNKNKKPKR------------LPCGHILHLSCLKNWMERSQTCPICRLPVFDDKG 407

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 229 LKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSP 268
           L CGH     C+  W + + +CPICR ++  + G ++  P
Sbjct: 423 LPCGHFLHFSCLKNWMERSQTCPICRLDVFDKNGNVKVYP 462

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           K  P +L C H+    C+  W + + +CPICR ++    G
Sbjct: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 231  CGHVFGRVCIYQWTKENNSCPICR 254
            CGH+F   CI+ W K   +CP+C+
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCK 1202

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           P +L CGH+    C+  W + + +CPICR  +    G
Sbjct: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENG 423

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGN 273
           K  P  L C H     C+  W + + +CPICR  +  ++G +  + D   N
Sbjct: 333 KQKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNVVVTSDQTNN 383

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 37.7 bits (86), Expect = 0.021,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 24/44 (54%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGND 274
           CGH F   C+  W   + +CP+CR++++ R+  I  S  +   D
Sbjct: 111 CGHTFDLQCVSVWLSRSTTCPMCRSDVLVRKPEIDGSAAELEED 154

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICR 254
           CGH++   C+  W KE   CP+CR
Sbjct: 290 CGHIYCWNCLINWCKEKEECPLCR 313

>AAR049C Chr1 complement(428904..430235) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR066W
           (RAD18)
          Length = 443

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 224 HSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQR 266
            +P   +CGH F  +CI ++  + + CP+C A +  R+ ++Q+
Sbjct: 40  QTPVLTQCGHTFCSLCIREYLNKESRCPLCLAEL--RQNMLQK 80

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICR 254
           CGH+F   C+  W+KE   CP+CR
Sbjct: 294 CGHLFCWDCLLNWSKERPECPLCR 317

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICR 254
           CGH+F   C+  W +E   CP+CR
Sbjct: 305 CGHIFCWRCLMDWCQERAECPLCR 328

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 5/40 (12%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANIVGR 260
            K  PT   C + F   C+Y+W K   NN+CP+CR+ I  R
Sbjct: 1554 KTCPT---CKNKFHGACLYKWFKSSGNNTCPLCRSEIALR 1590

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQR 266
           CGH F  +CI ++ ++ + CP+C +++   E ++Q+
Sbjct: 47  CGHSFCSICIRKYLQKESKCPLCLSDLT--ESMLQK 80

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICR 254
           CGH+F   C+  W KE   CP+CR
Sbjct: 301 CGHLFCWDCLMSWCKERPECPLCR 324

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQR 266
           P+   CGH +   C+++W  E   CP+CR     ++ L+ R
Sbjct: 268 PSCAPCGHTYCWDCLFKWCNERPECPLCRQTCAPQQILMLR 308

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 4/43 (9%)

Query: 213 EPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRA 255
           E  K    TY  +P    CGHVF   C+  W      CP+CR+
Sbjct: 719 ETHKVDLQTYMTTP----CGHVFHTQCLENWMSYKLQCPVCRS 757

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 210 LSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRS 267
           LS+E KK+           L CGH     C+  W + + +CPICR  +    G ++ S
Sbjct: 361 LSEEHKKK-------KAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKES 411

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 36.2 bits (82), Expect = 0.079,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGL 263
           CGH F   C+  W  +N +CP+CR ++  ++ L
Sbjct: 125 CGHKFDFECVSMWLTKNTTCPMCRDDVTHKKEL 157

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 2/28 (7%)

Query: 229  LKCGHVFGRVCIYQWTKEN--NSCPICR 254
            LKCGH + + CI+ W +++   +CPIC+
Sbjct: 1150 LKCGHYYCQDCIWNWLEKSKKKNCPICK 1177

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 36.2 bits (82), Expect = 0.085,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 24/44 (54%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGND 274
           CGH F   CI  W  ++++CP+CR +++  +  I  S  +   D
Sbjct: 125 CGHRFDLECISVWLSKSDTCPLCRDSVLSHKTDIDVSKTEMEED 168

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 35.8 bits (81), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 92  RFN-EIMALAADMAMNRLTRRMRPL---RGLSNEAFDALP-VKKLKSVTTDTCSICYDKF 146
           +FN E++ L  +M    L  +  P    +G S E  D+LP V + K   TDTCSIC+++F
Sbjct: 40  QFNPELIELFQNMLSPLLQSQWHPEDREKGCSQEFIDSLPRVPRNKVPLTDTCSICFERF 99

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGRE 261
           CGH+F   CI  W     +CP+CR  + G +
Sbjct: 113 CGHIFDLQCISMWLSNQVTCPMCRDVVNGHK 143

>Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON}
           (52842..54119) [1278 nt, 426 aa]
          Length = 425

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 4/41 (9%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENN----SCPICRANIV 258
           Y + P  + CGH +   C+  W   N     SCP CRAN+ 
Sbjct: 42  YMYVPMMVACGHNYCYSCLSSWFTSNETQELSCPQCRANVT 82

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICR 254
           CGH+F   CI  W +E   CP CR
Sbjct: 243 CGHIFCWDCIVDWCRERPECPFCR 266

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIV 258
           C H F   CI  W ++N+ CP+CR N++
Sbjct: 231 CSHHFHFECIKLWLQKNSLCPLCRDNVM 258

>NCAS0D04540 Chr4 (861304..862713) [1410 bp, 469 aa] {ON} Anc_6.332
           YCR066W
          Length = 469

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 231 CGHVFGRVCIYQWTKENNSCPIC----RANIVGREGLI 264
           C H F  +CI ++ K+N+ CP+C    R +++  E L+
Sbjct: 43  CSHTFCSLCIREYLKDNSKCPLCLNELRESMLRSEFLV 80

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 34.7 bits (78), Expect = 0.13,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 230 KCGHVFGRVCIYQWTKENNSCPICRANIV 258
           +C H F   CI  W  ++ +CP+CR N++
Sbjct: 69  RCNHRFDLECISVWLSKSVTCPLCRDNVL 97

>KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 279

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 37/88 (42%), Gaps = 13/88 (14%)

Query: 181 RAFKIASFGPEEGSSAGRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTEL----KCGHVFG 236
           +A ++     E+ +   +  +D++ TP  L  +   ++       P E     KCGHVF 
Sbjct: 175 KAQQVIEIDDEDETEGHKSGKDMSETP--LETKKAADYVCPICMEPPEAALVTKCGHVFC 232

Query: 237 RVCIYQWT-------KENNSCPICRANI 257
             C+Y          + N  C +CR N+
Sbjct: 233 TTCLYGMVNSSKGNGRRNGLCALCRENV 260

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 35.0 bits (79), Expect = 0.14,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRS 267
           CGH F   C+  W  ++ SCP+CR +++     +  S
Sbjct: 96  CGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEVDTS 132

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 214  PKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            P     PT K  PT   C + F   C+Y+W +   NNSCP+CR+ I
Sbjct: 1502 PVDRKLPT-KVCPT---CNNRFHGACLYKWFRSSGNNSCPLCRSEI 1543

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score = 35.0 bits (79), Expect = 0.15,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 231 CGHVFGRVCIYQWTKENNS---CPICRANIVGREGLIQRSP 268
           C H F   CIYQW   + S   CP+CR     REG+    P
Sbjct: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEP 106

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score = 35.0 bits (79), Expect = 0.16,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%)

Query: 231 CGHVFGRVCIYQWTKENNS---CPICRANIVGREGLIQRSPDDQ 271
           C H F   CIYQW   + S   CP+CR     R+G+    P  +
Sbjct: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKE 109

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRA 255
           CGH+F   C+  W      CP+CRA
Sbjct: 722 CGHIFHTQCLESWMSYKLQCPVCRA 746

>TDEL0B00890 Chr2 (170522..172144) [1623 bp, 540 aa] {ON} Anc_8.808
           YOL054W
          Length = 540

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 200 WQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTK----ENNSCPICRA 255
           WQ ++   ++L+     E    Y + P   +CGH +   C+  W +    E  SCP CRA
Sbjct: 18  WQVLSKVFESLTCSICHE----YMYVPMMTQCGHNYCYDCLLAWFESNPEEELSCPQCRA 73

Query: 256 NIVGREGL 263
           +++    L
Sbjct: 74  SVINTPAL 81

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 229 LKCGHVFGRVCIYQWTKENNSCPICRANI 257
           L CGH+    C+  W + + +CPICR ++
Sbjct: 343 LPCGHMLHFGCLKSWMERSQTCPICRLSV 371

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 16/33 (48%)

Query: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRA 255
           +HS     C H+F   C+  W      CP+CRA
Sbjct: 724 QHSYMVTPCNHIFHTSCLENWMSYKLQCPVCRA 756

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICR 254
           CGH++   CI  W  E   CP+CR
Sbjct: 292 CGHLYCWDCILNWCNEKPECPLCR 315

>Ecym_2490 Chr2 (961218..962615) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AAR049C
          Length = 465

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENNSCPIC----RANIVGREGLIQRSPDDQGNDMIF 277
           +  +P    CGH F  +CI  +  +   CP+C    R N++ +E L+       G  +  
Sbjct: 39  FLQTPVLGHCGHTFCSLCIRTYLNKEARCPLCLVELRQNMLQKEFLL-------GEIVAS 91

Query: 278 FDRIR 282
           + RIR
Sbjct: 92  YSRIR 96

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1522 KTCPT---CNNKFHGACLYKWFRSSGNNTCPLCRSEI 1555

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1525 KTCPT---CKNKFHGACLYKWFRSSGNNTCPLCRSEI 1558

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 220  PTYKHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANIVGR 260
            PT K  PT   C + F   C+Y+W +   NN+CP+CR+ I  R
Sbjct: 1552 PT-KVCPT---CNNKFHGSCLYKWFRSSNNNTCPLCRSEIALR 1590

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 4/35 (11%)

Query: 221 TYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRA 255
           TY  +P    C H+F   C+  W      CP+CRA
Sbjct: 715 TYMITP----CNHIFHTTCLENWMSYKLQCPVCRA 745

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 229 LKCGHVFGRVCIYQWTKENNSCPICRANIVG 259
           L CGH+    C+  W +   +CPICR  + G
Sbjct: 361 LPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGNDMIFF 278
           C H F   CI  W  ++ SCP+CR +++  +  I  S  +   D   F
Sbjct: 124 CNHKFDLECISVWLSKSTSCPLCRDDVMSHKPGIDTSQVELEEDWGMF 171

>TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON}
           Anc_6.332 YCR066W
          Length = 408

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNSCPIC 253
           P    CGH F  +CI Q+ +++  CP+C
Sbjct: 38  PVLTPCGHTFCSLCIRQYLRQDPKCPLC 65

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 220  PTYKHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANIVGR 260
            PT K  PT   C + F   C+Y+W +   NN+CP+CR+ I  R
Sbjct: 1532 PT-KTCPT---CRNKFHGACLYKWFRSSGNNTCPMCRSEIAIR 1570

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANI 257
           C H F   CI  W   N++CP+CR  +
Sbjct: 108 CSHKFDLQCISVWLSSNSTCPVCRDKV 134

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1527 KTCPT---CKNKFHGACLYKWFRSSGNNTCPLCRSEI 1560

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W K   NN+CP+CR  I
Sbjct: 1509 KVCPT---CSNRFHGACLYKWFKSSGNNTCPLCRGEI 1542

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1522 KTCPT---CKNKFHGACLYKWFRSSGNNTCPLCRSEI 1555

>KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} similar
           to uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 460

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQ 265
           +  +P    CGH F  +CI ++      CP+C A +  RE +++
Sbjct: 43  FIKTPVLTPCGHTFCSLCIREYLNRELKCPLCLAEL--RESMLR 84

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 221 TYKHSPTELK---CGHVFGRVCIYQWTKENNSCPICRA 255
           T+K +P E     C HVF   C+  W      CP+CRA
Sbjct: 716 THKTNPNEYMVTPCAHVFHTECLENWMSYKLQCPVCRA 753

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1527 KTCPT---CKNKFHGACLYKWFRSSGNNTCPLCRSEI 1560

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1520 KTCPT---CNNKFHGACLYKWFRSSGNNTCPMCRSEI 1553

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1513 KVCPT---CNNRFHGACLYKWFRSSGNNTCPLCRSEI 1546

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1529 KTCPT---CKNRFHGACLYKWFRSSGNNTCPLCRSEI 1562

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 33.9 bits (76), Expect = 0.47,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRS 267
           C H F   CI  W  ++++CP+CR +++  +  I  S
Sbjct: 111 CNHKFDLQCITLWLSKSSTCPMCRNDVMSSKTKIDTS 147

>Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [1347
           bp, 448 aa] {ON}
           complement(110464..110775,110777..111811) [1347 nt, 449
           aa]
          Length = 448

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRSPDDQGNDMIFFDRIR-DLL 285
           CGH F  +CI  +    + CP+C   +  RE ++ RS       + F+  IR DLL
Sbjct: 44  CGHTFCSICIRSYVNSESKCPLCLHEV--RESML-RSEFLTNEIVEFYKTIRSDLL 96

>Skud_2.242 Chr2 (435864..438260) [2397 bp, 798 aa] {ON} YBR114W
           (REAL)
          Length = 798

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 6/38 (15%)

Query: 226 PTELKCGHVFGRVCIYQWTK---ENN---SCPICRANI 257
           P E KC H F R+CI ++ +   ENN   +CPIC   +
Sbjct: 555 PIESKCHHKFCRLCIKEYVESYMENNNKLTCPICHIGL 592

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 16/33 (48%)

Query: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRA 255
           +HS     C HVF   C+  W      CP+CR+
Sbjct: 721 QHSYMVTPCNHVFHTSCLENWMSYKLQCPVCRS 753

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1523 KTCPT---CKNRFHGACLYKWFRSSGNNTCPLCRSEI 1556

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGR 260
           C H F   C+  W  +N++CP+CR +++ +
Sbjct: 107 CSHRFDLECLTPWLLKNSTCPLCRDDVMEK 136

>Kwal_23.6285 s23 (1516142..1517518) [1377 bp, 458 aa] {ON} YCR066W
           (RAD18) - Zn finger protein, putative ATPase [contig 16]
           FULL
          Length = 458

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQ 265
           +  SP    C H F  +CI ++      CP+C A +  RE +++
Sbjct: 43  FIKSPVLTPCAHTFCSLCIREYLNRELRCPLCLAEL--RESMLK 84

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 231  CGHVFGRVCIYQWTKE--NNSCPICRANI 257
            C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1512 CKNKFHGACLYKWFRSSGNNTCPLCRSEI 1540

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 16/33 (48%)

Query: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRA 255
           +HS     C HVF   C+  W      CP+CR+
Sbjct: 721 QHSYMVTPCDHVFHTSCLENWMSYKLQCPVCRS 753

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 16/33 (48%)

Query: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRA 255
           +HS     C HVF   C+  W      CP+CR+
Sbjct: 721 QHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRS 753

>Ecym_7137 Chr7 (277509..278300) [792 bp, 263 aa] {ON} similar to
           Ashbya gossypii AGL289C
          Length = 263

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 7/41 (17%)

Query: 231 CGHVFGRVCIYQWT------KENNSCPICRANIVGRE-GLI 264
           CGHV+  VC++Q        + N  C +CR ++  +E GLI
Sbjct: 212 CGHVYCTVCLFQMVNSSRGYRRNGQCALCRKDVKLKEVGLI 252

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 13/25 (52%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRA 255
           C H+F   C+  W      CP+CRA
Sbjct: 728 CNHIFHTACLENWMGYKLQCPVCRA 752

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVG 259
           C H F   C+  W   + +CP+CR +++G
Sbjct: 100 CHHKFDLECLSVWLSRSTTCPLCRDDVMG 128

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 33.9 bits (76), Expect = 0.63,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVG 259
           C H F   C+  W   + +CP+CR N++G
Sbjct: 130 CHHKFDLECLSVWLSRSTTCPLCRDNVMG 158

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 4/38 (10%)

Query: 231 CGHVFGRVCIYQWTKENNSCPIC----RANIVGREGLI 264
           CGH F  +CI ++    + CP+C    R +++  E L+
Sbjct: 43  CGHTFCSICIREYINRQSKCPLCLNELRESMLRSEFLV 80

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 33.1 bits (74), Expect = 0.66,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 22/38 (57%)

Query: 230 KCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRS 267
           +C H F   C+  W + N++CP+CR ++  ++  I  S
Sbjct: 91  RCNHKFDLECLSIWLQNNHTCPMCRDDLRSKKVEIDTS 128

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVG 259
           C H F   C+  W   + +CP+CR +++G
Sbjct: 128 CNHRFDLECLSVWLSRSTTCPLCRDDVMG 156

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 13/25 (52%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRA 255
           C H+F   C+  W      CP+CRA
Sbjct: 721 CSHIFHTQCLESWMSYKLQCPVCRA 745

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR  I
Sbjct: 1518 KTCPT---CNNKFHGSCLYKWFRSSGNNTCPLCRGEI 1551

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 32.3 bits (72), Expect = 0.76,   Method: Composition-based stats.
 Identities = 9/31 (29%), Positives = 18/31 (58%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGRE 261
           C H F   C+  W  ++ +CP+CR +++  +
Sbjct: 56  CNHRFDLECVAVWLSKSRTCPLCRDDVLSHK 86

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR+ I
Sbjct: 1537 KVCPT---CNNRFHGACLYKWFRSSGNNTCPLCRSEI 1570

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 16/33 (48%)

Query: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRA 255
           +HS     C HVF   C+  W      CP+CR+
Sbjct: 722 QHSYMVTPCNHVFHTPCLENWMSYKLQCPVCRS 754

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 13/25 (52%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRA 255
           C H+F   C+  W      CP+CRA
Sbjct: 718 CSHIFHTQCLESWMSYKLQCPVCRA 742

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 5/34 (14%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICR 254
            K  PT   C + F   C+Y+W K   NN+CP+CR
Sbjct: 1481 KVCPT---CNNRFHGACLYKWFKSSGNNTCPLCR 1511

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVG 259
           C H F   C+  W   + +CP+CR +++G
Sbjct: 135 CHHKFDLECLSVWLSRSTTCPLCRDDVMG 163

>TDEL0C05100 Chr3 (910686..912938) [2253 bp, 750 aa] {ON} Anc_3.368
           YBR114W
          Length = 750

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 6/38 (15%)

Query: 226 PTELKCGHVFGRVCIYQWT----KENN--SCPICRANI 257
           P E KC H F R+CI ++     +ENN  +CP+C   +
Sbjct: 507 PIESKCHHKFCRLCIKEYVESFMEENNRLTCPVCHIGL 544

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 32.3 bits (72), Expect = 0.86,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 13/23 (56%)

Query: 230 KCGHVFGRVCIYQWTKENNSCPI 252
           +C H F   CI QW K  N CP+
Sbjct: 76  ECNHAFHLHCITQWIKSRNVCPL 98

>Smik_2.255 Chr2 (452057..454417) [2361 bp, 786 aa] {ON} YBR114W
           (REAL)
          Length = 786

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 6/38 (15%)

Query: 226 PTELKCGHVFGRVCIYQWTK---ENN---SCPICRANI 257
           P E KC H F R+CI ++ +   ENN   +CP+C   +
Sbjct: 543 PIESKCHHKFCRLCIKEYVESFMENNNKLTCPVCHIGL 580

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score = 33.1 bits (74), Expect = 0.89,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 231 CGHVFGRVCIYQWTKENNS---CPICRANIVGREGL 263
           C H F   CIY+W   +NS   CP+CR     ++GL
Sbjct: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 17/34 (50%)

Query: 224 HSPTELKCGHVFGRVCIYQWTKENNSCPICRANI 257
           HS     C H+F   C+  W      CP+CR+++
Sbjct: 726 HSYMVTPCNHIFHTECLENWMGYKLQCPVCRSSL 759

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 4/45 (8%)

Query: 211 SKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRA 255
           ++E  K    +Y  +P    C H+F   C+  W      CP+CRA
Sbjct: 712 TEETHKIDAQSYMITP----CSHIFHTECLENWMSYKLQCPVCRA 752

>YBR114W Chr2 (467248..469620) [2373 bp, 790 aa] {ON}  RAD16Protein
           that recognizes and binds damaged DNA in an
           ATP-dependent manner (with Rad7p) during nucleotide
           excision repair; subunit of Nucleotide Excision Repair
           Factor 4 (NEF4) and the Elongin-Cullin-Socs (ECS) ligase
           complex
          Length = 790

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 6/38 (15%)

Query: 226 PTELKCGHVFGRVCIYQWTK---ENN---SCPICRANI 257
           P E KC H F R+CI ++ +   ENN   +CP+C   +
Sbjct: 547 PIESKCHHKFCRLCIKEYVESFMENNNKLTCPVCHIGL 584

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 13/25 (52%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRA 255
           C HVF   C+  W      CP+CRA
Sbjct: 725 CNHVFHTQCLENWMGYKLQCPVCRA 749

>Kwal_23.3660 s23 complement(382943..385249) [2307 bp, 768 aa] {ON}
           YBR114W (RAD16) - Radiation repair protein, putative DNA
           helicase [contig 253] FULL
          Length = 768

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 6/38 (15%)

Query: 226 PTELKCGHVFGRVCIYQWTK------ENNSCPICRANI 257
           P E KC H F R+CI ++T+      E  +CP+C   +
Sbjct: 525 PIESKCHHRFCRLCIKEYTESFLENLEKLTCPVCHIAL 562

>SAKL0B08008g Chr2 (680730..683054) [2325 bp, 774 aa] {ON} similar
           to uniprot|P31244 Saccharomyces cerevisiae YBR114W RAD16
           Protein that recognizes and binds damaged DNA in an
           ATP-dependent manner (with Rad7p) during nucleotide
           excision repair subunit of Nucleotide Excision Repair
           Factor 4 (NEF4) member of the SWI/SNF family
          Length = 774

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 6/38 (15%)

Query: 226 PTELKCGHVFGRVCIYQWTK------ENNSCPICRANI 257
           P E KC H F R+CI ++ +      E  SCP+C  ++
Sbjct: 531 PIESKCHHRFCRLCIKEYIESFMDASEKLSCPVCHISL 568

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 11/71 (15%)

Query: 191 EEGSSAGRPWQDIAY----TPKNLSKEPK--KEHTPTYKHSPTELKCGHVFGRVCIYQWT 244
           E GS+AG    D A      P  + + P+  K    TY  +P    C H+F   C+  W 
Sbjct: 695 EHGSTAGYT-IDCAICMSEVPIRVEEVPETHKVDEQTYMVTP----CAHIFHTQCLENWM 749

Query: 245 KENNSCPICRA 255
                CP+CR+
Sbjct: 750 SYKLQCPVCRS 760

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQ 265
           +  +P    CGH F  +CI ++      CP+C   +  RE +++
Sbjct: 50  FLKTPVLTPCGHTFCSLCIREYLNRELKCPLCLVEL--RESMLR 91

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + +   C+Y+W +   NN+CP+CR+ I
Sbjct: 1531 KTCPT---CNNKYHGACLYKWFRSSGNNTCPMCRSEI 1564

>TBLA0H01510 Chr8 complement(339262..341613) [2352 bp, 783 aa] {ON}
           Anc_3.368 YBR114W
          Length = 783

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 7/39 (17%)

Query: 226 PTELKCGHVFGRVCIYQWTK-------ENNSCPICRANI 257
           P E KC H F R+CI ++ +       E  SCP+C   +
Sbjct: 539 PIESKCHHQFCRLCIKEYVESSFLGESEKLSCPVCHIGL 577

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 27/70 (38%)

Query: 185 IASFGPEEGSSAGRPWQDIAYTPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWT 244
           +A     EG+S       I  +   +  E  +E     +HS     C H+F   C+  W 
Sbjct: 686 LAHLAKHEGASKHTADCAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWM 745

Query: 245 KENNSCPICR 254
                CP+CR
Sbjct: 746 GYKLQCPVCR 755

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 229 LKCGHVFGRVCIYQWTKENNS-CPICR 254
           L C HVF   CI QW   N++ CP+C+
Sbjct: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 32.0 bits (71), Expect = 1.3,   Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 14/22 (63%)

Query: 231 CGHVFGRVCIYQWTKENNSCPI 252
           CGH F   CI +W K  ++CP+
Sbjct: 81  CGHAFHLHCINKWIKTRDACPL 102

>Suva_4.362 Chr4 (636207..638579) [2373 bp, 790 aa] {ON} YBR114W
           (REAL)
          Length = 790

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 6/38 (15%)

Query: 226 PTELKCGHVFGRVCIYQWTK---ENN---SCPICRANI 257
           P E KC H F R+C+ ++ +   ENN   +CP+C   +
Sbjct: 547 PIESKCHHKFCRLCVKEYVESYMENNNKLTCPVCHIGL 584

>NDAI0A07960 Chr1 (1826531..1828888) [2358 bp, 785 aa] {ON}
           Anc_3.368
          Length = 785

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 7/39 (17%)

Query: 226 PTELKCGHVFGRVCIYQWTK---ENN----SCPICRANI 257
           P E KC H F R+CI ++ +   ENN    +CP+C   +
Sbjct: 541 PIESKCHHKFCRLCIKEYIESFMENNNNKLACPVCHIGL 579

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 4/36 (11%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNS----CPICRANI 257
           P    CGH +   CI  W   NN+    CP CR  I
Sbjct: 4   PVMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTI 39

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 4/46 (8%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENNS----CPICRANIVGREGL 263
           Y + P    CGH +   CI  W    +S    CP CR++I     L
Sbjct: 44  YMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCRSSITSMPSL 89

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 5/37 (13%)

Query: 223  KHSPTELKCGHVFGRVCIYQWTKE--NNSCPICRANI 257
            K  PT   C + F   C+Y+W +   NN+CP+CR  I
Sbjct: 1524 KTCPT---CKNRFHGACLYKWFRSSGNNTCPLCRNEI 1557

>CAGL0M10615g Chr13 (1064930..1066162) [1233 bp, 410 aa] {ON}
           similar to uniprot|P53723 Saccharomyces cerevisiae
           YNR021w
          Length = 410

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 33  TTRNVTVAIQYTFLNDNRNSQGSVTE--DSRSTPANDTQSQSNNGSMFFSFPDIP--EPN 88
           TT N  +  +Y F+++     G +T       TP N+   QSN    F +F D+P  +P 
Sbjct: 220 TTDNDALPQEYVFMSEMNQLNGFITNYLSKTKTPLNEALKQSNRILEFIAFTDLPSDKPF 279

Query: 89  SRERFNE 95
           S E +NE
Sbjct: 280 SVEEWNE 286

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 206 TPKNLSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICR 254
            P  +  +P+      Y +  T   C H+F   C+  W      CP+CR
Sbjct: 710 IPLYVDDKPETHKVDQYSYMVT--PCNHIFHTECLENWMSYKLQCPVCR 756

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score = 32.3 bits (72), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 230 KCGHVFGRVCIYQWTKENNS---CPICRANIVGREGLI 264
           KC H F   CI++W +   S   CP+CR     R+G++
Sbjct: 83  KCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRKGVV 120

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score = 32.0 bits (71), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 231 CGHVFGRVCIYQWTKENNS---CPICRANIVGREGL 263
           C H F   CIY+W   +NS   CP+CR     ++GL
Sbjct: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQLQKGL 104

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 4/36 (11%)

Query: 226 PTELKCGHVFGRVCIYQWTKENNS----CPICRANI 257
           P    CGH +   CI  W   NN+    CP CR ++
Sbjct: 4   PVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSV 39

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 3/28 (10%)

Query: 230 KCGHVFGRVCIYQWTKENNS---CPICR 254
           +C H F   CIYQW K   S   CP+CR
Sbjct: 80  RCNHNFHFHCIYQWLKTLTSKGLCPMCR 107

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 7/40 (17%)

Query: 324 NTSVSGEGIP-------REYGIQDRATSGISSMRRSSTMA 356
           NT+  G GIP       R + + D+ +SG+S+MRRS  MA
Sbjct: 396 NTAHCGSGIPATERNGPRRFVLADQGSSGLSAMRRSKRMA 435

>KLLA0C18260g Chr3 (1613311..1614000) [690 bp, 229 aa] {ON} similar
           to uniprot|Q752S4 Ashbya gossypii AFR499C CWC24
           Pre-mRNA-splicing factor CWC24 and some similarites with
           YLR323C uniprot|P53769 Saccharomyces cerevisiae
          Length = 229

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 5/39 (12%)

Query: 215 KKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPIC 253
           KKE+T     SP   KC H F   C  +  K + +CPIC
Sbjct: 175 KKEYT-----SPVVTKCNHYFCSSCFMKQMKVSTNCPIC 208

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.808
           YOL054W
          Length = 478

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 4/41 (9%)

Query: 222 YKHSPTELKCGHVFGRVCIYQWTKENN----SCPICRANIV 258
           Y   P    CGH F   C+  W   +N    SCP CR +I 
Sbjct: 36  YMFVPMVTPCGHSFCYGCLCSWFSSSNVDGLSCPHCRTSIT 76

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 31.2 bits (69), Expect = 3.3,   Method: Composition-based stats.
 Identities = 9/31 (29%), Positives = 18/31 (58%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGRE 261
           C H F   C+  W  ++ +CP+CR +++  +
Sbjct: 104 CSHRFDLECVAVWLSKSRTCPLCRDDVLSHK 134

>SAKL0E13178g Chr5 complement(1086160..1087205,1087289..1087313)
           [1071 bp, 356 aa] {ON} highly similar to uniprot|P53871
           Saccharomyces cerevisiae YNL191W Hypothetical ORF
          Length = 356

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 7/91 (7%)

Query: 286 YGPQVSADTRIPGEVDGVAIAQEPIGMETEDEPIFPSH------NTSVSGEGIPREYGIQ 339
           Y P      R+    D + +A EP+  E  D    P++      N +V    I  EY  +
Sbjct: 249 YAPGEYRMERLDRNQDVIMVASEPLTFERGDWTAVPTNSILTIKNQTVLLHPIVDEYYQE 308

Query: 340 DRATSGISSMRRSS-TMAPLPLLDPVDTNYP 369
           D   S  S++  S   M  +PL DPV+ N P
Sbjct: 309 DPLYSRSSTLAESKGLMGSIPLEDPVEKNVP 339

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 13/25 (52%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRA 255
           C H+F   C+  W      CP+CRA
Sbjct: 724 CSHLFHTGCLENWMSYKLQCPVCRA 748

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 2/27 (7%)

Query: 231 CGHVFGRVCIYQWTKE--NNSCPICRA 255
           CGH F   CI +W K   N  CPICR 
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>KAFR0D02640 Chr4 complement(527097..529427) [2331 bp, 776 aa] {ON}
           Anc_3.368 YBR114W
          Length = 776

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 6/38 (15%)

Query: 226 PTELKCGHVFGRVCI------YQWTKENNSCPICRANI 257
           P E +C H F R+C+      Y  T  N +CP+C   +
Sbjct: 533 PIESRCHHKFCRLCVQEYVESYLETNNNLTCPVCHIGL 570

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 231 CGHVFGRVCIYQW---TKENNSCPICRANIVGREGL-IQRSPDD 270
           C H F   CIY+W   T     CP+CR     +EG+ + +S +D
Sbjct: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQED 121

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           CGH   + C  ++TK +  CP C+ +++  E 
Sbjct: 406 CGHAIHQHCFDEYTKHSYKCPSCQVSVLNMEA 437

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 15/34 (44%)

Query: 229 LKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           L C H     C+  W   + +CPICR  I    G
Sbjct: 376 LPCTHALHLSCLKNWIARSPTCPICRLPIFDENG 409

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 231 CGHVFGRVCIYQWTKENNSCPICRANIVGREG 262
           CGH   + C  ++TK +  CP C+ +I+  E 
Sbjct: 405 CGHAIHQHCFDEYTKHSYKCPSCQVSILNMEA 436

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,237,664
Number of extensions: 2959638
Number of successful extensions: 10020
Number of sequences better than 10.0: 289
Number of HSP's gapped: 10336
Number of HSP's successfully gapped: 305
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)