Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17094g8.259ON1422142268170.0
Kwal_56.238258.259ON1396142238850.0
KLTH0G13750g8.259ON1399142638720.0
AGR089C8.259ON1370138837810.0
Ecym_43118.259ON1376137037780.0
Suva_10.1708.259ON1416143837410.0
TDEL0F038608.259ON1399143437190.0
Smik_12.1458.259ON1418144436760.0
Skud_12.1548.259ON1417143936750.0
NCAS0B050008.259ON1409137836360.0
YLR086W (SMC4)8.259ON1418144336210.0
KAFR0B027108.259ON1416143835920.0
Kpol_392.88.259ON1427140335630.0
ZYRO0C01716g8.259ON1413143034920.0
NDAI0B019708.259ON1415143033910.0
KNAG0G020208.259ON1444142533790.0
KLLA0F19085g8.259ON1372139133660.0
TBLA0E044108.259ON1422144933130.0
TPHA0J007208.259ON1393143432160.0
CAGL0L12188g8.259ON1398142430550.0
CAGL0F02079g8.68ON12237083725e-35
Kwal_23.50438.68ON12251743555e-33
KLTH0A02706g8.68ON12281703555e-33
NDAI0G033208.68ON12312093512e-32
TPHA0P003408.68ON12191633493e-32
Suva_6.528.68ON12641633484e-32
Skud_6.648.68ON12301613441e-31
YFL008W (SMC1)8.68ON12252243431e-31
KAFR0C032008.68ON12231673422e-31
Kpol_1011.58.68ON12211713422e-31
Smik_6.718.68ON12281513412e-31
NCAS0C040008.68ON12231513412e-31
KNAG0G009108.68ON12261623403e-31
ZYRO0F03828g8.68ON12176903403e-31
SAKL0B02288g8.68ON12281743378e-31
KLLA0D07502g8.68ON12432133361e-30
TDEL0C009608.68ON12221723332e-30
TBLA0G035308.68ON12321633243e-29
Ecym_73038.68ON12221613217e-29
AGL023W8.68ON12227253207e-29
KAFR0G029307.186ON11707983038e-27
YFR031C (SMC2)7.186ON11707952993e-26
Skud_6.1197.186ON11707272957e-26
Suva_6.1047.186ON11708052931e-25
SAKL0F07282g7.186ON11707272779e-24
ZYRO0D15642g7.186ON11707212572e-21
TDEL0H026107.186ON11701882421e-19
CAGL0D05258g7.186ON11701872412e-19
AGR236W7.186ON11701842384e-19
NDAI0G020707.186ON11711842365e-19
Smik_7.3467.186ON11701872359e-19
NCAS0E019207.186ON11701842331e-18
SAKL0D06116g1.295ON12297742322e-18
Kpol_1063.207.186ON11711842313e-18
KLTH0E04774g7.186ON11701822303e-18
Kwal_55.204217.186ON11701822276e-18
Ecym_43907.186ON11701842277e-18
KNAG0L011607.186ON11701842241e-17
KLLA0D16005g7.186ON11701822205e-17
TPHA0C044407.186ON11701902188e-17
Smik_10.1671.295ON12297512152e-16
NDAI0G056301.295ON12297082142e-16
Kwal_14.24351.295ON12477152053e-15
TBLA0D046107.186ON1174792044e-15
NCAS0A093301.295ON12277082044e-15
KLTH0H09966g1.295ON12247432018e-15
ZYRO0G21296g1.295ON12271092018e-15
KAFR0A016101.295ON12271031991e-14
Kpol_1018.21.295ON12112021963e-14
KNAG0B052301.295ON12251051902e-13
TDEL0D016201.295ON12231021873e-13
Ecym_63221.295ON12321241849e-13
TPHA0I010901.295ON1216831812e-12
CAGL0H02805g1.295ON12192311812e-12
YJL074C (SMC3)1.295ON1230831812e-12
TBLA0C027401.295ON11191491784e-12
Suva_6.1491.295ON1230831784e-12
AAL182W1.295ON12311001784e-12
Skud_10.1701.295ON1230831732e-11
KLLA0A00286g1.295ON1224971703e-11
KNAG0L006307.101ON11081611632e-10
KLTH0D02816g7.101ON10941871373e-07
KAFR0D013307.101ON10801831203e-05
ZYRO0G01584g7.101ON10881851151e-04
TDEL0E013404.237ON1106851141e-04
KLLA0F07997g7.101ON11191881132e-04
SAKL0B09526g7.101ON10991811104e-04
Kwal_26.72047.101ON11171231095e-04
ZYRO0B12122g4.237ON1109791060.001
Skud_15.1217.101ON10931631040.002
Suva_15.1337.101ON10921891040.002
NCAS0I005707.101ON10952351030.003
CAGL0H05071g4.237ON1110801010.004
Ecym_26257.101ON10972191010.004
AEL337C7.101ON10971841010.005
YOL034W (SMC5)7.101ON10931881000.006
NCAS0J013904.237ON1096791000.007
AER044W4.237ON1103467980.011
TPHA0L006007.101ON1117160980.011
Kpol_1044.137.101ON1103125980.012
TPHA0B008404.237ON111968970.013
Skud_12.4684.237ON112068970.014
KNAG0B060104.237ON1117101970.014
Suva_10.5004.237ON111568970.015
CAGL0F01155g7.101ON1105223960.016
YLR383W (SMC6)4.237ON111468960.016
NDAI0J021804.237ON110868960.017
Smik_12.4704.237ON111468960.017
TDEL0H034907.101ON110385950.021
NDAI0A084507.101ON111962950.024
Smik_15.1317.101ON109362940.028
Kwal_26.93804.237ON1102166940.029
KLLA0E05303g4.237ON109870930.039
TBLA0E021907.101ON108962930.042
Ecym_53444.237ON110258910.062
TBLA0I028904.237ON109871910.068
KAFR0A060404.237ON1102123900.092
Kpol_479.38.604ON795217890.100
NCAS0A024504.238ON1928224900.11
TBLA0A053001.67ON70763860.21
SAKL0H03322g4.237ON111147870.23
Kpol_483.104.237ON111847860.25
KLTH0D14080g4.237ON1102221850.33
Skud_2.4111.307ON641106840.38
Suva_5.1101.71ON209144820.40
KNAG0F036507.488ON1264183801.3
TDEL0G028102.351ON109471791.7
Skud_8.785.267ON1927201782.4
Kpol_1043.518.401ON86846764.0
NCAS0B087001.67ON71572754.4
Suva_13.2342.627ON680126754.8
CAGL0I02090g5.88ON1136175754.9
Kpol_483.114.238ON2546267755.4
TPHA0B043601.96ON36895736.7
Kwal_55.198087.488ON825141747.4
ZYRO0F17050g1.67ON71472737.6
KLLA0D18645g8.401ON86242737.6
Skud_12.3934.46ON913256737.7
CAGL0B00924g1.46ON438152737.8
ZYRO0F16236g1.101ON382102729.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17094g
         (1422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  2630   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1501   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1496   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1461   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1459   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1445   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1437   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1420   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1420   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1405   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1399   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1388   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1377   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1349   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1310   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1306   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1301   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1280   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1243   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1181   0.0  
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   147   5e-35
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   141   5e-33
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   141   5e-33
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             139   2e-32
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   139   3e-32
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   138   4e-32
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   137   1e-31
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   136   1e-31
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   136   2e-31
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   136   2e-31
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   135   2e-31
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   135   2e-31
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   135   3e-31
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   135   3e-31
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   134   8e-31
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   134   1e-30
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   132   2e-30
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   129   3e-29
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   128   7e-29
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   127   7e-29
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   121   8e-27
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...   119   3e-26
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...   118   7e-26
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...   117   1e-25
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...   111   9e-24
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   103   2e-21
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    98   1e-19
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    97   2e-19
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    96   4e-19
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    96   5e-19
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    95   9e-19
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    94   1e-18
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    94   2e-18
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    94   3e-18
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    93   3e-18
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    92   6e-18
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    92   7e-18
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    91   1e-17
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    89   5e-17
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    89   8e-17
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    87   2e-16
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    87   2e-16
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    84   3e-15
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    83   4e-15
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    83   4e-15
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    82   8e-15
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    82   8e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    81   1e-14
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    80   3e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    78   2e-13
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    77   3e-13
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    75   9e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    74   2e-12
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    74   2e-12
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    74   2e-12
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    73   4e-12
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    73   4e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    73   4e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    71   2e-11
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    70   3e-11
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    67   2e-10
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    57   3e-07
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    51   3e-05
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    49   1e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    49   1e-04
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    48   2e-04
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    47   4e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    47   5e-04
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    45   0.001
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    45   0.002
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    45   0.002
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    44   0.003
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    44   0.004
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    44   0.004
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    44   0.005
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    43   0.006
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    43   0.007
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    42   0.011
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    42   0.011
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    42   0.012
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.013
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.014
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    42   0.014
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.015
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    42   0.016
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.016
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    42   0.017
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.017
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    41   0.021
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    41   0.024
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.028
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    41   0.029
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.039
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    40   0.042
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    40   0.062
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    40   0.068
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    39   0.092
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    39   0.100
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    39   0.11 
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    38   0.21 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.23 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    38   0.25 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    37   0.33 
Skud_2.411 Chr2 complement(731701..733626) [1926 bp, 641 aa] {ON...    37   0.38 
Suva_5.110 Chr5 complement(167540..167740,167806..168234) [630 b...    36   0.40 
KNAG0F03650 Chr6 (681394..685188) [3795 bp, 1264 aa] {ON} Anc_7....    35   1.3  
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    35   1.7  
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    35   2.4  
Kpol_1043.51 s1043 complement(99063..101669) [2607 bp, 868 aa] {...    34   4.0  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    33   4.4  
Suva_13.234 Chr13 (374150..375856,375905..376240) [2043 bp, 680 ...    33   4.8  
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    33   4.9  
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    33   5.4  
TPHA0B04360 Chr2 complement(1017141..1018247) [1107 bp, 368 aa] ...    33   6.7  
Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047...    33   7.4  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   7.6  
KLLA0D18645g Chr4 complement(1571106..1573694) [2589 bp, 862 aa]...    33   7.6  
Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {...    33   7.7  
CAGL0B00924g Chr2 complement(81492..82808) [1317 bp, 438 aa] {ON...    33   7.8  
ZYRO0F16236g Chr6 (1332793..1333941) [1149 bp, 382 aa] {ON} simi...    32   9.3  

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 2630 bits (6817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1305/1422 (91%), Positives = 1305/1422 (91%)

Query: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLVL 60
            MSDSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLVL
Sbjct: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLVL 60

Query: 61   GSPEKKYAYXXXXXXXXXXVPNLQPPNVDGSRGRRFYXXXXXXXXXXXXXXXXXXXLELI 120
            GSPEKKYAY          VPNLQPPNVDGSRGRRFY                   LELI
Sbjct: 61   GSPEKKYAYSQPSTSSSLSVPNLQPPNVDGSRGRRFYSQSPPRSPHRSPNRSPTRRLELI 120

Query: 121  QLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVV 180
            QLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVV
Sbjct: 121  QLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVV 180

Query: 181  GPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDESD 240
            GPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDESD
Sbjct: 181  GPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDESD 240

Query: 241  GTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGE 300
            GTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGE
Sbjct: 241  GTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGE 300

Query: 301  VESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELV 360
            VESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELV
Sbjct: 301  VESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELV 360

Query: 361  EKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQE 420
            EKEKNSLESGKDEA                 AQYHIWQDQRKLSETLGKISELNEHLGQE
Sbjct: 361  EKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNEHLGQE 420

Query: 421  KAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKR 480
            KAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKR
Sbjct: 421  KAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKR 480

Query: 481  LKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKT 540
            LKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKT
Sbjct: 481  LKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKT 540

Query: 541  SEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFA 600
            SEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFA
Sbjct: 541  SEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFA 600

Query: 601  EKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLS 660
            EKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLS
Sbjct: 601  EKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLS 660

Query: 661  NVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECG 720
            NVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECG
Sbjct: 661  NVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECG 720

Query: 721  QQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLR 780
            QQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLR
Sbjct: 721  QQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLR 780

Query: 781  DTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQPGAGYT 840
            DTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQPGAGYT
Sbjct: 781  DTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQPGAGYT 840

Query: 841  PEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSSTXX 900
            PEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSST  
Sbjct: 841  PEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSSTEL 900

Query: 901  XXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKIM 960
                       TDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKIM
Sbjct: 901  KLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKIM 960

Query: 961  KIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLENQCREASNDIESCN 1020
            KIGGTKLQLQNSKV            KQKKDRTATKKAENDLKRLENQCREASNDIESCN
Sbjct: 961  KIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCREASNDIESCN 1020

Query: 1021 LEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLEEKTNNTSDFKSVEI 1080
            LEISKISVLNTELEAKIYKLDTSLN              RVKTNLEEKTNNTSDFKSVEI
Sbjct: 1021 LEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEEKTNNTSDFKSVEI 1080

Query: 1081 EINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPXXXXXXXXXXXX 1140
            EINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLP            
Sbjct: 1081 EINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEENEDDFEVQDE 1140

Query: 1141 XXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYENETSNGLPKFSEAQL 1200
                    MSSDPNAMDID            TDGEIDSMDIDEYENETSNGLPKFSEAQL
Sbjct: 1141 EVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYENETSNGLPKFSEAQL 1200

Query: 1201 QSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNC 1260
            QSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNC
Sbjct: 1201 QSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNC 1260

Query: 1261 EELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKS 1320
            EELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKS
Sbjct: 1261 EELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKS 1320

Query: 1321 WRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1380
            WRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA
Sbjct: 1321 WRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1380

Query: 1381 QFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILNGV 1422
            QFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILNGV
Sbjct: 1381 QFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILNGV 1422

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1501 bits (3885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 791/1422 (55%), Positives = 1004/1422 (70%), Gaps = 33/1422 (2%)

Query: 3    DSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLVLGS 62
            DSPLAKKQKT          N +    P V            TR  R  S TPRKLVLGS
Sbjct: 2    DSPLAKKQKTHVS---NESENSSTEESPDV------------TRASR--SRTPRKLVLGS 44

Query: 63   PEKKYAYXXXXXXXXXXVPNLQP--PNVDGSRGRRFYXXXXXXXXXXXXXXXXXXXLELI 120
            P+K++A+          VP+LQP    +  SRGR +                    LELI
Sbjct: 45   PDKRFAFSQPVSSSSSNVPHLQPLKNELSSSRGRVY-----SQSPPRSPNRSPTRKLELI 99

Query: 121  QLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVV 180
            QLSP+K +R E QK  + +   G+  + RLCID+L LHNFKSYAGTQ++GPFH SFSAVV
Sbjct: 100  QLSPMKKSRLESQKFQESRAMMGS--IQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVV 157

Query: 181  GPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDESD 240
            GPNGSGKSNVIDS+LFVFGFRANKMRQGKLS+LIHKSE +P+L+SC VDI F+YV DE D
Sbjct: 158  GPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPD 217

Query: 241  GTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGE 300
            GTT    +KP MVI RKAFRNN+SKYY++GKES+YT +TQLLRD+GIDLDHKRFLILQGE
Sbjct: 218  GTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGE 277

Query: 301  VESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELV 360
            VESI+QMKPKAE+ESDDGLLEYLEDIIGTA+YK  IE  L EI  LND+C EKENRFE+V
Sbjct: 278  VESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIV 337

Query: 361  EKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQE 420
            E+EK+SLE GK+EA                  QYH+W++++KL+ T  KI++  E L  E
Sbjct: 338  EREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAE 397

Query: 421  KAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKR 480
            KAK  +   E+A ++      K  +  L +  K LT ++R  DR++ S+EEK +NL +K 
Sbjct: 398  KAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKE 457

Query: 481  LKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKT 540
            +K+ + L+S  +S++ ++ K+EEL N Q+Q+++ LL+LN ++ EE+ KLDEIK SL+DK 
Sbjct: 458  VKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEIKSSLKDKI 517

Query: 541  SEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFA 600
            S IS +I   E++LEPWN +LQEKK+Q+KL E+ I++ KES  K  Q+II +   I+   
Sbjct: 518  SLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELR 577

Query: 601  EKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLS 660
             K N Q  ++  L+ EQ +I +++ +G+ EC +A  K+ EMK +L +HRQR+++ARS+LS
Sbjct: 578  NKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLS 637

Query: 661  NVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECG 720
              ENKNKVL+AL+RLQRSGRI+GFHGRLGDLGTIDD YDVAISTACPRLDDIVV+ VECG
Sbjct: 638  TFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECG 697

Query: 721  QQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLR 780
            QQCIE+LRKNKLGYARFI+LDKLR FNLSPI+TPE VPRL+DLVR  N KF  AFYSVLR
Sbjct: 698  QQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLR 757

Query: 781  DTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQPGAGYT 840
            DTLV  DLK+AN+VAYGK+R+RVVTLDGKLID SGT+SGGG    +G+MKS+QQ  + +T
Sbjct: 758  DTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFT 817

Query: 841  PEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSSTXX 900
             EEVQ I+KEL+ERE NF IA +T H+MEEAL+K KDREPEIE++I+KR+LDI+S S+  
Sbjct: 818  AEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEM 877

Query: 901  XXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKIM 960
                        ++      + EL+ AE KL+ L  EY E+ENE ++K++ +  L+E+IM
Sbjct: 878  KASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIM 937

Query: 961  KIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLENQCREASNDIESCN 1020
            K+GGTKLQ+Q+S V            K KK +T  KKA+ND+KR + Q  + + +++SC+
Sbjct: 938  KVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAEELKSCS 997

Query: 1021 LEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLEEKTNNTSDFKSVEI 1080
             E S I         K+ +L  S+N              + + +++EKT    DF+++EI
Sbjct: 998  QEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGRDFEALEI 1057

Query: 1081 EINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPXXXXXXXXXXXX 1140
            +   +L+KL  L + + KE       LNSLKIRD+T TLQAL+E                
Sbjct: 1058 QCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDESLENESKNEVAAETPG 1117

Query: 1141 XXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYENETS--NGLPKFSEA 1198
                       DP  MD+D            T+ ++ + + +    E S  NGLPK  E 
Sbjct: 1118 EEDGEHSSSLHDP--MDVD---ENQGESTSTTEAQLQAGEAERRNTEESLPNGLPKLLED 1172

Query: 1199 QLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRK 1258
            +L++ ++E VEL+I +L  YV+NA+ DI++LEEYARRL EYK RK+DLN AV +RD+VR+
Sbjct: 1173 ELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQ 1232

Query: 1259 NCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPK 1318
            + E LKKKRLD+FMEGF+ I M LKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPK
Sbjct: 1233 SNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPK 1292

Query: 1319 KSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1378
            KSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTK
Sbjct: 1293 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1352

Query: 1379 NAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420
            NAQFIVISLRNNMFELA+QLVG+YKN NMT+S  LQN D+++
Sbjct: 1353 NAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLID 1394

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1496 bits (3872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 803/1426 (56%), Positives = 1005/1426 (70%), Gaps = 38/1426 (2%)

Query: 3    DSPLAKKQKT---RTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLV 59
            +SPL+KKQKT   R +D  Q + +  V                  TR  R  S TPRKLV
Sbjct: 2    ESPLSKKQKTFVNRDEDFSQTEESVDV------------------TRASR--SRTPRKLV 41

Query: 60   LGSPEKKYAYXXXXXXXXXXVPNLQP--PNVDGSRGRRFYXXXXXXXXXXXXXXXXXXXL 117
            LGSP+K++A+          VP LQP    +  SRGR +                    L
Sbjct: 42   LGSPDKRFAFSQPVTSSSSNVPYLQPLKSELSSSRGRVY-----SQSPPRSPTRSPTRKL 96

Query: 118  ELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFS 177
            ELIQLSP K  R E QK   E+ +   Q + RLCI++LSLHNFKSYAGTQ++GPFH+SFS
Sbjct: 97   ELIQLSPTKKTRLESQKT--EQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFS 154

Query: 178  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVD 237
            AVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLSDLIHKSEA+PNL+SC V++ F+YV D
Sbjct: 155  AVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQD 214

Query: 238  ESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLIL 297
            E DG T    ++P +V+TRKAF+NN+SKYY++GKES+YT+VT+LLR +GIDLDHKRFLIL
Sbjct: 215  ELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLIL 274

Query: 298  QGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRF 357
            QGEVESI+QMKPKAE+E DDGLLEYLEDIIGTAKYK  IE  LV+ID LNDVC EKENR+
Sbjct: 275  QGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRY 334

Query: 358  ELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHL 417
            E+VE+EK+SLESGKDEA                  Q+ +W++  K + T  KI  L E L
Sbjct: 335  EIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEEKL 394

Query: 418  GQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLD 477
              E+AKY + +RE+ QL          +  +      LTS++R  DR++ S+EEK +N+ 
Sbjct: 395  SAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNIS 454

Query: 478  KKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLR 537
            +K++KAEK   +T NS+  ++ KLEEL   Q QY+++L +LN+SLL E++KLDEIK+SL+
Sbjct: 455  QKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLK 514

Query: 538  DKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIE 597
             KT  IS +I   E++LEPWN +LQEK+SQ+KL E++I++LKES  K  + I + + +I 
Sbjct: 515  GKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDIS 574

Query: 598  AFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARS 657
               +K   Q  AI  L+ E  +I ++I IG+ EC +AS+K+ EMK VL +HRQR+++A+S
Sbjct: 575  NNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKS 634

Query: 658  TLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNV 717
            +LS  ENKNKVLSAL RLQRSGRI+GFHGRLGDLGTIDD YDVAISTACPRLDD+VV+ V
Sbjct: 635  SLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETV 694

Query: 718  ECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYS 777
            ECGQQCIEHLRKNKLGYARFI+LDKLR FN++ IQTP  V RLFDLV   + KF  AFYS
Sbjct: 695  ECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYS 754

Query: 778  VLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQ-QPG 836
            VLRDTLV  DLK+ANRVAYGK+RFRVVTLDGKLID SGT+SGGG H   G+MKS++   G
Sbjct: 755  VLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTG 814

Query: 837  AGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESS 896
            A +T EEV+ I++EL ERE+NF IA +T H+ME+AL+  KDREPEIE +I+KRR++I+S 
Sbjct: 815  ASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSL 874

Query: 897  STXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLK 956
             +              ++      D  L +A S+L  L  E   +E E K+K+  I  L+
Sbjct: 875  LSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQ 934

Query: 957  EKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLENQCREASNDI 1016
            E+IMKIGGTKLQLQ S V            KQK+D+TA KKAENDLKR E Q  + S DI
Sbjct: 935  EQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDI 994

Query: 1017 ESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLEEKTNNTSDFK 1076
            + C  E+  I  L +  + KI +L+ S++               ++  +EEK++   DF 
Sbjct: 995  DQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFA 1054

Query: 1077 SVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPXXXXXXXX 1136
              E++INN+LEKLN L +HI K+      +L SLKIRD+T TLQ LN  KL         
Sbjct: 1055 VFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLN--KLLLSESRSGD 1112

Query: 1137 XXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYEN-ETS-NGLPK 1194
                          S+ + M++D            +  E D MD+DE E  ETS + LPK
Sbjct: 1113 ELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPE-DQMDVDEPEEMETSPSDLPK 1171

Query: 1195 FSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRD 1254
             +EAQL+ + +E+VEL+I +LN +V+NA+ DI+VLEEY +RL +++ RKL+LN+AV +RD
Sbjct: 1172 LTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRD 1231

Query: 1255 EVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSV 1314
             VR+NC+ L+KKRLD+FM GF+ ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSV
Sbjct: 1232 SVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSV 1291

Query: 1315 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIK 1374
            MPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1292 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1351

Query: 1375 ERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420
            ERTKNAQFIVISLRNNMFELAQQLVGIYKN NMT+S  L+N D++N
Sbjct: 1352 ERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1461 bits (3781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 768/1388 (55%), Positives = 964/1388 (69%), Gaps = 39/1388 (2%)

Query: 50   LPSP-------TPRKLVLGSPEKKYAYXXXXXXXXXXV---PNLQPPNVDG-SRGRRFYX 98
            +P+P       TP KL+  SP++K                 P+LQPP     SRGR  Y 
Sbjct: 3    IPTPKKPRILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRSQYS 62

Query: 99   XXXXXXXXXXXXXXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLH 158
                              +ELIQLSP+KN+R ELQ++YD K K     V RLCI  L L 
Sbjct: 63   QSPPRSPNRSPGRA----VELIQLSPIKNSRLELQRLYDTKQKK----VERLCIRTLVLE 114

Query: 159  NFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSE 218
            NFKSYAG Q++GPFH+SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQGKLS LIHKSE
Sbjct: 115  NFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSE 174

Query: 219  AYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEV 278
             YP+L+ CSV+I F+YVVDE DGTTR    KP + + RKAF+NN+SKYY++GKES YTEV
Sbjct: 175  KYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEV 234

Query: 279  TQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEA 338
            T+LLRD+GIDLDHKRFLILQGEVESI+QMKPKAE E DDGLLEYLEDIIGT KYKA IE 
Sbjct: 235  TRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQ 294

Query: 339  GLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQ 398
             LVE+D+LND+C+EKENRF+LVEKEK SLE GKDEA                  QYH++ 
Sbjct: 295  ALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFH 354

Query: 399  DQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSK 458
            +  KL++TL  +S     L QEKAK  + Q+E+ +L +       ++V ++  +K+  +K
Sbjct: 355  NGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAK 414

Query: 459  RRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQL 518
             R ++RE  S EEKQ++L +KR KAEK L + E S+   ++K+EE  +  ++Y+  L  L
Sbjct: 415  MRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTL 474

Query: 519  NESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAIL 578
            N ++++ +++L+++KL+L DKT +I+ E+A  E++LEPW  +++EKKS++KL ES+I+I+
Sbjct: 475  NHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISII 534

Query: 579  KESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKL 638
            KE+  K    I  L  EIE      + +E +I  L  E ++I   I +GE+EC SA SKL
Sbjct: 535  KEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKL 594

Query: 639  GEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMY 698
             EMK VL++HRQR  +ARS +S+ ENKNKVL+AL RLQ+SGRI G+HGRLGDLGTIDD Y
Sbjct: 595  EEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKY 654

Query: 699  DVAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVP 758
            D+AISTACPRLDDIVVD VECGQQCIEHLRKNKLGYARFI+LDKLRKFNL P  TPE VP
Sbjct: 655  DIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVP 714

Query: 759  RLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLS 818
            RLFDLV+ K  KF PAFYSVLRDTLV +DL QANRVAYGK+R+RVVTLDGKLID SGT++
Sbjct: 715  RLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMT 774

Query: 819  GGGTHVMKGLMKSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDR 878
            GGG     GLMKS QQ  + YTPEEVQ +E+ELNEREKNF +A ETF +ME AL+ + DR
Sbjct: 775  GGGDRAASGLMKSTQQ-SSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDR 833

Query: 879  EPEIEVEIAKRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVED-RELADAESKLQVLSEE 937
            +PEIEVE++K+++DIE+ S                 +  S+ED  EL  AE KL  L+ +
Sbjct: 834  QPEIEVELSKQKMDIETISAELESKIERKLELERS-NKTSIEDSSELRTAEEKLAALNAD 892

Query: 938  YDEIENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKK 997
             +   + +++K Q I  L+ KIM+IGG +LQ  NSKV            KQKKD+TA KK
Sbjct: 893  LNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKK 952

Query: 998  AENDLKRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXX 1057
            AE +LKR   Q   A +DIE C++EI K+      +   + +L   L+            
Sbjct: 953  AELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDE 1012

Query: 1058 XXRVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQ 1117
                K  L++K      + S+EIE+  +L+KL  L +++KKE+     +L+ LK+RD+ Q
Sbjct: 1013 HAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQ 1072

Query: 1118 TLQALNEGKLPXXXXXXXXXXXXXXXXXXXXM-----SSDPNAMDIDXXXXXXXXXXXXT 1172
             +  L E K                      +     S  PN   I              
Sbjct: 1073 VMLDLEENKSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNL------- 1125

Query: 1173 DGEIDSMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEY 1232
                 SM++DE  +   NGLPK  +++L  + +ED+E  I +L  Y+DN+ VDI++L+EY
Sbjct: 1126 -----SMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEY 1180

Query: 1233 ARRLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMG 1292
            A+RLAEY++R++DLN+A++KRDE R +CE LKK+RLD+FMEGF IIS+TLKEMYQMITMG
Sbjct: 1181 AKRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMG 1240

Query: 1293 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLY 1352
            GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLY
Sbjct: 1241 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1300

Query: 1353 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTT 1412
            VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+LVGIYKN+NMTRSTT
Sbjct: 1301 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTT 1360

Query: 1413 LQNIDILN 1420
            LQN DI+N
Sbjct: 1361 LQNRDIIN 1368

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1459 bits (3778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/1370 (55%), Positives = 957/1370 (69%), Gaps = 13/1370 (0%)

Query: 54   TPRKLVLGSPEKKYAYXXXXXXXXXXV--PNLQPPNVDG-SRGRRFYXXXXXXXXXXXXX 110
            TP KL+ GSP +K+            +  P+LQPP     SRGR  Y             
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYSQSPPRSPNRSPA 74

Query: 111  XXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIG 170
                  +ELIQLSP+KN+R ELQKIYD K         RL I  L L+NFKSYAG Q++G
Sbjct: 75   RR----IELIQLSPIKNSRLELQKIYDGKQ----TTTKRLSIKNLILNNFKSYAGVQVVG 126

Query: 171  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDI 230
            PFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS+LIHKSE + NL  CSV+I
Sbjct: 127  PFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEI 186

Query: 231  HFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLD 290
             F+YV+D++DG T+   +   + + RK F+NN+SKYYI+GKES+YTEVTQ LR++GIDLD
Sbjct: 187  TFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLD 246

Query: 291  HKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVC 350
            HKRFLILQGEVESI+QMKPKA+ E DDGLLEYLEDIIGTAKYK+ I   LVE+DTLND+C
Sbjct: 247  HKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDIC 306

Query: 351  VEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKI 410
            +EKE RFELVEKEK SLE+GK++A                  Q+ I ++ +KL+ TL KI
Sbjct: 307  MEKEIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKI 366

Query: 411  SELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSME 470
            S   E L  E+ KY + Q+E+  LRE  ++ ++Q+ K++ E   L   +  + RE  S E
Sbjct: 367  SAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSE 426

Query: 471  EKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLD 530
            EK ++L++KR KAEK L+  E ++   ++ +  LN +Q +++  LL+LNESL  ERS+LD
Sbjct: 427  EKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELD 486

Query: 531  EIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNII 590
             IK+SLRDKTS IS E+A+ E++LEPW  +L+ K SQ+KL ES+I I+KESK K  Q I 
Sbjct: 487  AIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEIS 546

Query: 591  QLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQ 650
            QL+ +IE++ ++    +  I+KL+ E A I   I   + EC SA  KL +MK VL +HRQ
Sbjct: 547  QLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQ 606

Query: 651  RAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLD 710
            R  +AR  LSNVENKNKVL AL RLQ+SGRI GFHGRLGDLGTIDD YD+AIS ACPRLD
Sbjct: 607  RMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLD 666

Query: 711  DIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGK 770
            DIVV+ VEC QQCIEHLRKNKLGYARFI+LDKL+KFN++ + TPE VPRLFDL   KN  
Sbjct: 667  DIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEI 726

Query: 771  FLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMK 830
            F PA YSVLRDTLV  DL QANRVAYG RRFRVVTLDGKLID SGT+SGGG  V+KGLMK
Sbjct: 727  FAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMK 786

Query: 831  SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRR 890
            SKQ+    YT EEVQ +E EL +RE NF IA +TF +ME AL+K+KDR+P I+VEI+K +
Sbjct: 787  SKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHK 846

Query: 891  LDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQ 950
            +DI++ S+             +  +    ++  L D E++L  L+ E   +++E+K K +
Sbjct: 847  IDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNE 906

Query: 951  LINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLENQCR 1010
             I+ L+ +IMKIGG KLQ QNSKV            KQKK+RT  KK E ++ R   Q  
Sbjct: 907  QISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKL 966

Query: 1011 EASNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLEEKTN 1070
             A NDI  C +E+SK +  +  L+  + + +  +                 K NL++K  
Sbjct: 967  GAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAA 1026

Query: 1071 NTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPXX 1130
                FKS EIE+   LEKL  L  HIK EI    +ELN+LK+RD+ Q LQ L+E  LP  
Sbjct: 1027 YVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLP-- 1084

Query: 1131 XXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYENETSN 1190
                              M+ + +  D++            +  + +SMD+D+  +    
Sbjct: 1085 LESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGP 1144

Query: 1191 GLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAV 1250
            GLPK +EA+L +I IE++ L+I +L  Y+D A+ DID+LEEYA RLAEYK+RKLDLN++V
Sbjct: 1145 GLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESV 1204

Query: 1251 LKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1310
             KR+E+R   E LKK RL++FM+GF IISMT+KE+YQMITMGGNAELELVDSLDPFSEGV
Sbjct: 1205 EKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGV 1264

Query: 1311 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1370
            LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1265 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1324

Query: 1371 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420
            NYIKERTKNAQFIVISLRNNMFELAQQL+GIYK++NMT+STTLQNIDILN
Sbjct: 1325 NYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1445 bits (3741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 775/1438 (53%), Positives = 984/1438 (68%), Gaps = 42/1438 (2%)

Query: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSP------- 53
            M DSPL+K+QK +T +  ++  N         +G      +    R ++ P P       
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHG-------NGEQEPKAEKQNDRTEKTPDPDSLSLES 53

Query: 54   ------TPRKLVLGSPEKKYAYXXXXXXXXXX--VPNLQPPNVDGSRGRRFYXXXXXXXX 105
                  TPRKLVL S E +YA+            VPNLQPP    SRGR +         
Sbjct: 54   SYAKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEA-PSRGRDY--KAYSQSP 110

Query: 106  XXXXXXXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAG 165
                       LEL+QLSPVKN+R ELQK+YD     G Q   RL IDKL L NFKSYAG
Sbjct: 111  PRSPGRSPTRRLELLQLSPVKNSRIELQKLYDSHQPSGEQQ-GRLFIDKLVLENFKSYAG 169

Query: 166  TQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLES 225
             Q++GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE +PNL+S
Sbjct: 170  KQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQS 229

Query: 226  CSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQ 285
            CSV +HF YVVDE  GT+R D+EKP +VITRKAFRNNSSKYYI+GKESNYT+VT+LL+++
Sbjct: 230  CSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNE 289

Query: 286  GIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDT 345
            GIDLDHKRFLILQGEVE+I+QMK KAE+ESDDGLLEYLEDIIGTA YK  IE  L +I+T
Sbjct: 290  GIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIET 349

Query: 346  LNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSE 405
            LN++C+EKENRFE+V +EKNSLESGK+ A                  Q+ + Q   KL+ 
Sbjct: 350  LNEICLEKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLAS 409

Query: 406  TLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDRE 465
            TL K S LN+    EK K+ +  +EV ++  +  + K +M     + K L  ++R ++  
Sbjct: 410  TLEKTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELEST 469

Query: 466  KTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEE 525
            + S+EE+ +NL  K  KAEK+LKST +S+++++H LEEL+  Q +++ ++  LN+SL EE
Sbjct: 470  RVSLEERTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEE 529

Query: 526  RSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKK 585
            R  LD+IKLSL+DKT +ISAEI  HE+DLEPW+ QLQEKKSQ++L ES++++L+E++ K 
Sbjct: 530  RRILDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKL 589

Query: 586  VQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVL 645
             +N   L+  I A   +    +  I  L+    +++     GEK+  +A  KL EM+ +L
Sbjct: 590  KKNAEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTIL 649

Query: 646  ISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTA 705
             +HRQRAMEARS+LS  ENK+KVL+AL RLQ+SGRI GFHGRLGDLG IDD +DVAISTA
Sbjct: 650  NAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTA 709

Query: 706  CPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVR 765
            CPRLDD+VVD VEC Q CI++LRKNKLGYARFI+LD+LR+FNL P+ TPE VPRLFDLV+
Sbjct: 710  CPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVK 769

Query: 766  SKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVM 825
             K+ KF  AFYSVLRDTLV  DLKQAN VAYGKRRFRVVT+DGKLID SGT+SGGG HV+
Sbjct: 770  PKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVV 829

Query: 826  KGLM---KSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEI 882
            KGLM   K++      YTPEEV  IE EL+EREKNF +A +T H+ME+ LKK +D+EP++
Sbjct: 830  KGLMRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDM 889

Query: 883  EVEIAKRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIE 942
            E +I +  ++ +S ++                D    +  +L      L+ L  EYD+++
Sbjct: 890  ESQILRAEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQ 949

Query: 943  NETKNKQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDL 1002
             ETK K++ I +L+++IMKIGGT LQ+QNSKV            K KK ++  KK+  D+
Sbjct: 950  AETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDV 1009

Query: 1003 KRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVK 1062
             + + Q +    DIE  + E+  I   + +++  + K DT +               ++K
Sbjct: 1010 TKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLK 1069

Query: 1063 TNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQAL 1122
              + E      +FKS+E+E+ N+LEKLN L ++IK +IK  + ELN L IRD+T TL  L
Sbjct: 1070 EKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLIL 1129

Query: 1123 NEGKLPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDID 1182
            +  ++                        + N  DI              + +   M+ID
Sbjct: 1130 DNNQMDILDKEGEDR-------------QETNQEDISGEAKGETQGEEGDNDDRHCMNID 1176

Query: 1183 EYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKR 1242
            E  +E S G+P+ SE +L+ + IE +E  I EL  Y+D  +VDI VLEEYARRLAE+K+R
Sbjct: 1177 ETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRR 1236

Query: 1243 KLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDS 1302
            KLDLNQAV KRDEV++  E LKKKR D+FM GF+IISMTLKEMYQMITMGGNAELELVDS
Sbjct: 1237 KLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDS 1296

Query: 1303 LDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1362
            LDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALD
Sbjct: 1297 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1356

Query: 1363 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420
            FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YK +N T+STT++NIDILN
Sbjct: 1357 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1437 bits (3719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 744/1434 (51%), Positives = 1004/1434 (70%), Gaps = 51/1434 (3%)

Query: 1    MSDSPLAKKQKTRTDDRGQIQS--NPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKL 58
            M D+PL K+Q+   ++  + ++    T SP+   S S++              S TP+KL
Sbjct: 1    MPDTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTI--------------SHTPKKL 46

Query: 59   VLGSPEKKYAYXX-XXXXXXXXVPNLQPPNVDGSRGR--RFYXXXXXXXXXXXXXXXXXX 115
            V+G+ +   +             P+LQ PN   SRGR  R Y                  
Sbjct: 47   VIGTNDDTTSQSQPIVSSSSLQAPSLQHPN-SSSRGREQRTYSQSPPRSPGRSPTRK--- 102

Query: 116  XLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTS 175
             LELI++SPVK NR ELQ++YD +    N    RLCI+KL L +FKSYAG Q++GPFH+S
Sbjct: 103  -LELIKISPVKKNRLELQRLYDAEQSQRNAA--RLCINKLVLQDFKSYAGRQVVGPFHSS 159

Query: 176  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYV 235
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIH SE +PNL+SCSV++HF+YV
Sbjct: 160  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYV 219

Query: 236  VDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFL 295
            VDE DGTTR D+EKP +V+TRKAF+NNSSKYY++ KESNYTEVTQLL+ +GIDLDHKRFL
Sbjct: 220  VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFL 279

Query: 296  ILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKEN 355
            ILQGEVE+I+QM+PKAE+E +DGLLEYLEDI GTAKYK  IE  L EI+ LN+ C+EKEN
Sbjct: 280  ILQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKEN 339

Query: 356  RFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNE 415
            RF +V++EK+SLE+GKDEA                  QY IWQ+  KL+ TL K S+L  
Sbjct: 340  RFHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKG 399

Query: 416  HLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRN 475
             L QE  KY +  +EV  L++      K++  L  E K L +++R +D+++ ++EEK ++
Sbjct: 400  QLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKS 459

Query: 476  LDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLS 535
            +++K  KAEKLLKS ++S+  ++  L EL  SQ  Y+++L  LN+ L+ ER+KL+++K+S
Sbjct: 460  VNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKIS 519

Query: 536  LRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTE 595
            L++KT  ISA IA +E+DLEPW+ QLQ+K+++++L ES++++LK++  +  ++I QLK E
Sbjct: 520  LKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNE 579

Query: 596  IEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEA 655
            I    E+   +E  I +L+ E++++   +     EC SAS++L +M  +LI+ RQR ++A
Sbjct: 580  IARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDA 639

Query: 656  RSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVD 715
            R+  S+ +NK+ VL+AL +LQ+SGRI+GFHGRLGDLG ID+ YDVAISTACPRL+DIVV+
Sbjct: 640  RAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVE 699

Query: 716  NVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAF 775
            +VECGQQCIE+LRKNKLGYARFI+LDKLRKF+   IQTPE VPRLFDLV+ K+ KF+PAF
Sbjct: 700  SVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAF 759

Query: 776  YSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQP 835
            YSVLRDTL    L QANRVAYGK+RFRVV+LDGKLID SGT+SGGG+HV++GLM+  Q  
Sbjct: 760  YSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNN 819

Query: 836  GAG---YTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLD 892
                  ++PEEV  +E EL E+EK+F IA +TF +ME+ LKK KDR PEI+++++K  ++
Sbjct: 820  SYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVME 879

Query: 893  IESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLI 952
             ES  +               +   + ++ E   AE++++ L +E   + ++T   +Q I
Sbjct: 880  TESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKI 939

Query: 953  NSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLENQCREA 1012
              LK+KIM+IGG++LQ+QNSKV            KQKK + + KKAEN+LK+        
Sbjct: 940  AVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNT 999

Query: 1013 SNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLEEKTNNT 1072
              D++  + EI+ +      ++  +  ++ S++              ++K  L +     
Sbjct: 1000 QKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGF 1059

Query: 1073 SDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEG------K 1126
            ++FKS++IEIN++LEKLN L  HI KE++  + +LN+LKIRD+T+TLQ L+EG      K
Sbjct: 1060 TEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSK 1119

Query: 1127 LPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYEN 1186
            +P                     +   +A   +            ++ E+  M++DE  +
Sbjct: 1120 MPNELQEKR--------------TEGADATRQEGEESDVSMEEEKSNDEV--MEVDEKPH 1163

Query: 1187 ETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDL 1246
            E  NGLP+ SEA+L+S+ +ED+  QI++L +YVD+ +VD+++LEEYA+RLAE+K+RK+DL
Sbjct: 1164 ELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDL 1223

Query: 1247 NQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPF 1306
            N+AV +RD +R+   ELKK+R D+FM+GF IISMTLKEMYQMITMGGNAELELVDSLDPF
Sbjct: 1224 NEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPF 1283

Query: 1307 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1366
            SEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNV
Sbjct: 1284 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343

Query: 1367 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420
            SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  NMT+S +L+N DILN
Sbjct: 1344 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1420 bits (3676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 773/1444 (53%), Positives = 990/1444 (68%), Gaps = 52/1444 (3%)

Query: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSP------- 53
            M DSPL+K+QK +  +       P +S     +   L A K +  R ++ P P       
Sbjct: 1    MCDSPLSKRQKRKAVEE------PELSLDDSDATQELQAEKQA-DRSEKTPDPNSPALET 53

Query: 54   ------TPRKLVLGSPEKKYAYXXXXXXXXXX--VPNLQPPNVDGSRGRRFYXXXXXXXX 105
                  TPRKLVL S E +YA+            VPNLQPP    SRGR +         
Sbjct: 54   SYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGT-SSRGRDY--KAYSQSP 110

Query: 106  XXXXXXXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAG 165
                       LEL+QLSPVKN+R ELQK+Y+       Q   RL I++L L NFKSYAG
Sbjct: 111  PRSPGRSPTRRLELLQLSPVKNSRVELQKLYNSHQSSTKQQ-GRLFINELVLENFKSYAG 169

Query: 166  TQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLES 225
             Q++GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSEA+PNL+S
Sbjct: 170  RQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQS 229

Query: 226  CSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQ 285
            CSV +HF YV+DES GT+R D+EKP +VITRKAF+NNSSKYYI+GKES+YTEVT+LL+++
Sbjct: 230  CSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNE 289

Query: 286  GIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDT 345
            GIDLDHKRFLILQGEVE+I+QMKPKAE+ESDDGLLEYLEDIIGTA YK  IE  + +I+ 
Sbjct: 290  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEA 349

Query: 346  LNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSE 405
            LN+VC+EKENRFE+V++EKNSLESGK+ A                  Q+ + Q   KL+ 
Sbjct: 350  LNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLAS 409

Query: 406  TLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDRE 465
            TL KIS LN+    EK K+ +  ++V +++ +  + K ++   D   KDL  +RR ++  
Sbjct: 410  TLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGT 469

Query: 466  KTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEE 525
            + S+EE+ +NL  K  K+E+  K T+ S+++++H L+EL+  Q +++ ++  LN+ L EE
Sbjct: 470  RVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEE 529

Query: 526  RSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKK 585
            RS LDEIKLSL+DKT +IS EI  HE++LEPW+ QLQEK+SQ++L ES++++L+E++ K 
Sbjct: 530  RSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKL 589

Query: 586  VQNIIQLKTEIEAF-AEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNV 644
             +N+  ++ +I A  A K  +Q++ ++ L+ + +++      GE+   SA  KL EM+ V
Sbjct: 590  KKNVETMEEKILARKAHKQELQDLILN-LKKKLSSLRDERSQGEENFSSAHLKLEEMQKV 648

Query: 645  LISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAIST 704
            L +HRQRAMEARS+LS  +NK+KVL+AL +LQ+SGRI GFHGRLGDLG ID+ +DVAIST
Sbjct: 649  LNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAIST 708

Query: 705  ACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLV 764
            ACPRLDD+VVD VEC QQCI++LRKNKLGYARFI+LD+LR+FNL PI TPE VPRLFDLV
Sbjct: 709  ACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLV 768

Query: 765  RSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHV 824
            + K+ KF  AFYSVLRDTLV   LKQAN VAYG++RFRVVT+DGKLID SGT+SGGG HV
Sbjct: 769  KPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHV 828

Query: 825  MKGLMK---SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPE 881
             KGLM+   ++      YTPEEV  IE EL+ERE NF +A +T H+ME  LK  +D+EP 
Sbjct: 829  SKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPA 888

Query: 882  IEVEIAKRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEI 941
            IE +I+K  ++ +S ++                     +  ++      L+ L  E+D++
Sbjct: 889  IESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDL 948

Query: 942  ENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAEND 1001
            ++ETK K++ I  L+ +IMKIGGTKLQ+QNSKV            K KK ++  KK+E D
Sbjct: 949  QSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGD 1008

Query: 1002 LKRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXX-----XXXX 1056
            + + + Q + +  D+E  + E+  I     E + K  KLD S N                
Sbjct: 1009 VLKFQKQLKNSERDVELSSNELKAI-----EEKLKHTKLDLSENDIKMTETFNLRSELKE 1063

Query: 1057 XXXRVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDIT 1116
               ++K  + E   N  +FKS+EIE+ N+LEKLN L  HIKKEI   +  L+ L IRD+T
Sbjct: 1064 ESEQLKEMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVT 1123

Query: 1117 QTLQALNEGKLPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEI 1176
             TL+ L+   +                        + N  +              T  + 
Sbjct: 1124 HTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQE-----------EERTCDDH 1172

Query: 1177 DSMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRL 1236
             SMDIDE  NE   G+P+FSE +L+ + IE +E +I EL++Y+D  +VDI VLEEYARRL
Sbjct: 1173 HSMDIDETSNEVIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRL 1232

Query: 1237 AEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAE 1296
            AE+K+RKLDLNQAV KRDEV+   E LKKKR D+FM GF+IISMTLKEMYQMITMGGNAE
Sbjct: 1233 AEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAE 1292

Query: 1297 LELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDE 1356
            LELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDE
Sbjct: 1293 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1352

Query: 1357 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNI 1416
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK +N TRSTT++NI
Sbjct: 1353 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNI 1412

Query: 1417 DILN 1420
            DILN
Sbjct: 1413 DILN 1416

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1420 bits (3675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/1439 (53%), Positives = 979/1439 (68%), Gaps = 45/1439 (3%)

Query: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSP------- 53
            M DSPL+KKQK +  +  ++  N T              V++   R ++ P P       
Sbjct: 1    MCDSPLSKKQKRKATEEPELSLNDT-------DAERESRVENRVNRTEKTPDPNSPSLES 53

Query: 54   ------TPRKLVLGSPEKKYAYXXXXXXXXXX--VPNLQPPNVDGSRGRRFYXXXXXXXX 105
                  TPRKLVL S E +YA+            VPNLQPP V  SRGR +         
Sbjct: 54   SYARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKV-SSRGRDY--KAYSQSP 110

Query: 106  XXXXXXXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAG 165
                       LEL+QLSPVKN+R ELQK+YD     G Q   RL I+KL L NFKSYAG
Sbjct: 111  PRSPGRSPARRLELLQLSPVKNSRIELQKLYDSHKSSGKQQ-GRLFINKLVLDNFKSYAG 169

Query: 166  TQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLES 225
             Q++GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSEA+P+L++
Sbjct: 170  RQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQA 229

Query: 226  CSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQ 285
            CSV +HF Y++DE  GT+R D+EKP +VITR+AF+NNSSKYYI+ KES+YTEVT+LL+ +
Sbjct: 230  CSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKE 289

Query: 286  GIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDT 345
            GIDLDHKRFLILQGEVE+I+QMKPKAE+ESDDGLLEYLEDIIGTA YK  IE  L +I++
Sbjct: 290  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIES 349

Query: 346  LNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSE 405
            LN++C+EK NRFE+V++EKNSLESGK+ A                  Q+ + Q   KL+ 
Sbjct: 350  LNEICLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLAS 409

Query: 406  TLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDRE 465
            TL KIS LN     EK K+ +  REV +++ +  D K ++       K L+ ++R ++  
Sbjct: 410  TLEKISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGS 469

Query: 466  KTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEE 525
            + S+EE+ +NL  K  KAEK LKST++S+++S+H  +EL   Q ++++++  LN+SL EE
Sbjct: 470  RVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEE 529

Query: 526  RSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKK 585
            R  LD+IKLSL+DKT +ISA+I  HE++ EPW+ QLQEKKSQ++L ES++++L+E++ K 
Sbjct: 530  RIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKL 589

Query: 586  VQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQ--ANILKRIDIGEKECGSASSKLGEMKN 643
             +N   L+ +I   ++K   QE+    L   Q   +++     GE++  SA  KL EM+ 
Sbjct: 590  KKNAEALEEKI--ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQR 647

Query: 644  VLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAIS 703
            +L +HRQRAMEARS+LS  +NKN VL+AL +LQ+SGRI GFHGRLGDLG ID+ +DVAIS
Sbjct: 648  ILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAIS 707

Query: 704  TACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDL 763
            TACPRLDD+VVD VEC Q CI++LRKNKLGYARFI+LD+LRKFNL PI TPE VPRLFD+
Sbjct: 708  TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDV 767

Query: 764  VRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTH 823
            V+ K+ KF  AFYSVL+DTLV  DLKQAN+VAYGKRRFRVVT+DGKLID SGT+SGGG H
Sbjct: 768  VKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNH 827

Query: 824  VMKGLMK---SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREP 880
            VMKGLM+   ++      YTPEEV  IE EL EREKNF +A +T H+MEE LKK +D+EP
Sbjct: 828  VMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEP 887

Query: 881  EIEVEIAKRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDE 940
            ++E +I++  ++ +S ++                D    E  ++ +    L+ L  EY++
Sbjct: 888  DLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYED 947

Query: 941  IENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAEN 1000
            +++ET+ K++ I  L+++IMKIGGTKL  QNSKV            K KK ++  KK+E 
Sbjct: 948  LQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEG 1007

Query: 1001 DLKRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXR 1060
            D+ + + Q +    D E  + E+  I     + +  + + DT++               +
Sbjct: 1008 DVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQ 1067

Query: 1061 VKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQ 1120
            +K  L E   N  +FKS+EIE+ N+LEKLN L  HIK EIK    ELN L IRD+T TLQ
Sbjct: 1068 LKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQ 1127

Query: 1121 ALNEGKLPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMD 1180
             L+  ++                         P+ +  D             D    SM+
Sbjct: 1128 MLDNNQMDVVEDGIKDEQDADQDK--------PSGIPDD----EKIQEKDDADNNHHSMN 1175

Query: 1181 IDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYK 1240
            IDE  +E S G+PK  E +L+ + IE +E  I  L  Y++   VDI VLEEY RRL E+K
Sbjct: 1176 IDEMSSEISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFK 1235

Query: 1241 KRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELV 1300
            +RKLDLNQAV KRDEV++  E LKK R D+FM GF+IISMTLKEMYQMITMGGNAELELV
Sbjct: 1236 RRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELV 1295

Query: 1301 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA 1360
            DSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA
Sbjct: 1296 DSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA 1355

Query: 1361 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDIL 1419
            LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK +N T+STT++NIDIL
Sbjct: 1356 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1405 bits (3636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 748/1378 (54%), Positives = 958/1378 (69%), Gaps = 34/1378 (2%)

Query: 52   SPTPRKLVLGSPEKKYAYXXXXXXXXXXVP-NLQPPNVDGSRGRRFYXXXXXXXXXXXXX 110
            S TPRKL+LG  + +YA+              LQPP+   SRGR+               
Sbjct: 53   SHTPRKLILGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGR 112

Query: 111  XXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIG 170
                  LELIQLSPVKNNR +L+++YD  N    +   RL I+KL+L+NFKSYAG Q++G
Sbjct: 113  SPKRR-LELIQLSPVKNNRIKLRELYDAHNSQSKK--ERLFINKLTLNNFKSYAGQQVVG 169

Query: 171  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDI 230
            PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE +P+L SCSVD+
Sbjct: 170  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDV 229

Query: 231  HFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLD 290
             F Y +DE DG T+  + KP +VI+RKAF+NNSSKYYI+GKESNYT+VT+LL+++GIDLD
Sbjct: 230  EFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLD 289

Query: 291  HKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVC 350
            HKRFLILQGEVE+I+QMKPKAE+ESDDGLLEYLEDIIGT+KYK  IE  L+EI++LN++C
Sbjct: 290  HKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEIC 349

Query: 351  VEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKI 410
            +EKENRFE+V++EKNSLESGK+ A                  QY++WQ+  KL+ TL KI
Sbjct: 350  IEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKI 409

Query: 411  SELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSME 470
            S LNE    EK+K    Q E+ + ++  N+ + ++  L+ E K     +R+++ E  S++
Sbjct: 410  SALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLD 469

Query: 471  EKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLD 530
            EK +NL +K+ K EK++ +TE +++    +++EL  SQK+Y ++L  LN+ L  ER  L+
Sbjct: 470  EKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLE 529

Query: 531  EIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNII 590
             +KL L++KTS IS EI  HE DLEPWN ++QEKK++++L ESQI++L+E + K   +I 
Sbjct: 530  AMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIK 589

Query: 591  QLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQ 650
             L  E+         +E  +  L+ +Q++I K I  GE EC    SKL EMKNVL   RQ
Sbjct: 590  VLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQ 649

Query: 651  RAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLD 710
            RA EAR  L+NV+N+ KVL+AL +LQ+SGRI GFHGRLGDLGTID+ YDVA+STACPRLD
Sbjct: 650  RASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLD 709

Query: 711  DIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGK 770
            DIVV+ VECGQQCIE+LRKNKLGYARFI+LDKLR FN + IQTP+ VPRLFDL++ K+ K
Sbjct: 710  DIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSK 769

Query: 771  FLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLM- 829
            F+PAFYSVLRDTLV  DLKQANRVAYG+RR+RVVTLDGKLID SGT+SGGG HV KGLM 
Sbjct: 770  FVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMM 829

Query: 830  --KSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIA 887
              +  Q     Y PE+V+ IEK+L+++EKNF +A   F++ME  L+K  +R+PEIE+EI+
Sbjct: 830  LQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEIS 889

Query: 888  KRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVED-RELADAESKLQVLSEEYDEIENETK 946
            K  ++I++ S              T+ D   ++D  EL  A   LQ L EE+  ++++TK
Sbjct: 890  KIIMEIDTYSA-EIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTK 948

Query: 947  NKQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLE 1006
             K++ I SLKEKIMKIGG +LQ+QNSKV            KQKKDRT+ KK++ +L++ +
Sbjct: 949  AKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAK 1008

Query: 1007 NQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLE 1066
                 + NDI     +I +IS    ++ + +  +D S+                +K  + 
Sbjct: 1009 KTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVV 1068

Query: 1067 EKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGK 1126
            +   N ++FKS EIE+NN+LEKLNGL +HIK +IK  +D L+ L +R + Q L AL+E  
Sbjct: 1069 DLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDE-- 1126

Query: 1127 LPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEI---DSMDIDE 1183
                                   +  PN   +             T+  +   DSMDID 
Sbjct: 1127 --------------------ESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDN 1166

Query: 1184 YENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRK 1243
                 SNGLP  S+ +L ++ I  VE ++ +L  Y+++   +I+VLEEY +RL E+K RK
Sbjct: 1167 GAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRK 1226

Query: 1244 LDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSL 1303
            LDLN AV KR+ VRK  EELKK R ++FM GF IISMTLKEMYQMITMGGNAELELVDSL
Sbjct: 1227 LDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSL 1286

Query: 1304 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDF 1363
            DPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDF
Sbjct: 1287 DPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1346

Query: 1364 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILNG 1421
            RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N T S T++N +ILN 
Sbjct: 1347 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNS 1404

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1399 bits (3621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 767/1443 (53%), Positives = 1004/1443 (69%), Gaps = 50/1443 (3%)

Query: 1    MSDSPLAKKQKTRTD-------DRGQIQSNPTVSPIPPVSGSS----LMAVKSSPTRQDR 49
            MSDSPL+K+QK ++        D+G  + +  V     +S ++    L A+++S ++   
Sbjct: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSK--- 57

Query: 50   LPSPTPRKLVLGSPEKKYAYXXXXXXXXXX--VPNLQPPNVDGSRGRRFYXXXXXXXXXX 107
              S TPRKLVL S E +YA+            VPNLQPP    SRGR             
Sbjct: 58   --SYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKT-SSRGRDH--KSYSQSPPR 112

Query: 108  XXXXXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQ 167
                     LEL+QLSPVKN+R ELQKIYD +++  ++   RL I++L L NFKSYAG Q
Sbjct: 113  SPGRSPTRRLELLQLSPVKNSRVELQKIYD-RHQSSSKQQSRLFINELVLENFKSYAGKQ 171

Query: 168  IIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCS 227
            ++GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSEA+P+L+SCS
Sbjct: 172  VVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCS 231

Query: 228  VDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGI 287
            V +HF+YV+DES GT+R D+EKP ++ITRKAF+NNSSKYYI+ KES+YTEVT+LL+++GI
Sbjct: 232  VAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGI 291

Query: 288  DLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLN 347
            DLDHKRFLILQGEVE+I+QMKPKAE+ESDDGLLEYLEDIIGTA YK  IE  + +I+ LN
Sbjct: 292  DLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLN 351

Query: 348  DVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETL 407
            +VC+EKENRFE+V++EKNSLESGK+ A                  Q+ + Q   KL+ TL
Sbjct: 352  EVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTL 411

Query: 408  GKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKT 467
             KIS  N+ L  EK K+ +  ++V +++ +  + K ++     + K L  +RR ++  + 
Sbjct: 412  EKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRV 471

Query: 468  SMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERS 527
            S+EE+ +NL  K  KAEK LKST++S++++++ LEEL   Q +++ ++  L + L +ERS
Sbjct: 472  SLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERS 531

Query: 528  KLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQ 587
             LD+IKLSL+DKT  ISAEI  HE++LEPW+ QLQEK+SQ++L ES++++L+E++ K  +
Sbjct: 532  ILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKK 591

Query: 588  NIIQLKTEIEAFAEKNNVQEIA--IHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVL 645
            N+  L+ +I   A+K + QE+   I  L+ +  ++      GEK   SA  KL EM+ VL
Sbjct: 592  NVETLEEKI--LAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVL 649

Query: 646  ISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTA 705
             +HRQRAMEARS+LS  +NK+KVL+AL RLQ+SGRI GFHGRLGDLG IDD +DVAISTA
Sbjct: 650  NAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTA 709

Query: 706  CPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVR 765
            CPRLDD+VVD VEC Q CI++LRKNKLGYARFI+LD+LR+FNL PI TPE VPRLFDLV+
Sbjct: 710  CPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVK 769

Query: 766  SKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVM 825
             KN KF  AFYSVLRDTLV  +LKQAN VAYGK+RFRVVT+DGKLID SGT+SGGG HV 
Sbjct: 770  PKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVA 829

Query: 826  KGLMK---SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEI 882
            KGLMK   ++      YTPEEV  IE+EL+ERE NF +A +T H+MEE LKK +D EP++
Sbjct: 830  KGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDL 889

Query: 883  EVEIAKRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIE 942
            E +I+K  ++ +S ++                     +  +L      L+ L  EY++++
Sbjct: 890  ESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQ 949

Query: 943  NETKNKQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDL 1002
            +ETK K++ I  L+++IMKIGG KLQ+QNSKV            K KK ++A+KK+  D+
Sbjct: 950  SETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDV 1009

Query: 1003 KRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVK 1062
             + +   + +  D+E  + E+  I       +  + + DT++N              ++K
Sbjct: 1010 VKFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLK 1069

Query: 1063 TNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQAL 1122
              +E+   + ++FKS+EIE+ N+LEKLN L ++IK EI   +  LN L IRD+T TL  L
Sbjct: 1070 EQMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGML 1129

Query: 1123 NEGKLPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDS---- 1178
            ++ K+                        +   +D +             D E       
Sbjct: 1130 DDNKMDSVKEDVK----------------NNQELDQEYRSCETQDESEIKDAETSCDNYH 1173

Query: 1179 -MDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLA 1237
             M+IDE  +E S G+P+ SE +L+ + +E +E +I+EL++YV+  +VDI VLEEYARRLA
Sbjct: 1174 PMNIDETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLA 1233

Query: 1238 EYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAEL 1297
            E+K+RKLDLN AV KRDEV++    LKKKR D+FM GF+IISMTLKEMYQMITMGGNAEL
Sbjct: 1234 EFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAEL 1293

Query: 1298 ELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEI 1357
            ELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEI
Sbjct: 1294 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1353

Query: 1358 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNID 1417
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YK +N T+STT++NID
Sbjct: 1354 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNID 1413

Query: 1418 ILN 1420
            ILN
Sbjct: 1414 ILN 1416

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1388 bits (3592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 754/1438 (52%), Positives = 977/1438 (67%), Gaps = 41/1438 (2%)

Query: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVS----PIPPVSGSSLMAVKSSPTRQDRLPSPTPR 56
            MS +PL+KKQK  +D+  +I  N          P V+ SS             L S TPR
Sbjct: 1    MSHTPLSKKQKVVSDEE-RITPNQNEQDNDKTHPEVTASSF------------LKSHTPR 47

Query: 57   KLVLGSPEKKYAYXX------XXXXXXXXVPNLQPPNVDGSRGRRFYXXXXXXXXXXXXX 110
            KL+LGS + KY                  VPNLQPP    SRGR                
Sbjct: 48   KLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRD--KKAYSQSPPRSPG 105

Query: 111  XXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIG 170
                  LELIQLSP+KNNR ELQK+Y+ KN    Q   RL IDKL L +FKSYAGTQI+G
Sbjct: 106  RSPVRKLELIQLSPIKNNRIELQKLYNSKN----QNKVRLYIDKLVLQDFKSYAGTQIVG 161

Query: 171  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDI 230
            PF+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSEA+PN++SCSV++
Sbjct: 162  PFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEV 221

Query: 231  HFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLD 290
            HF+YV+DE+DGT++  +++ P+V+ RKAF+NNSSKYYI+GKESNYTEVT+LL+++GIDLD
Sbjct: 222  HFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLD 281

Query: 291  HKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVC 350
            HKRFLILQGEVE+I+QMK KAE+E DDGLLEYLEDIIGT+KYK  IE  +VEI+ LN++C
Sbjct: 282  HKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEIC 341

Query: 351  VEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKI 410
            VEKE RFE+VE EKNSLES KD A                  QY ++Q   KL+ TL KI
Sbjct: 342  VEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKI 401

Query: 411  SELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSME 470
            S     L +E++KY++ Q E+ Q      +  +++     + ++L  K+R  D +  SME
Sbjct: 402  SNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSME 461

Query: 471  EKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLD 530
            E+ +NL +K+ KAEK L      +  ++  L++L + Q  Y  +   L + L +ERSKLD
Sbjct: 462  ERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLD 521

Query: 531  EIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNII 590
            +IKLSL+DKT +IS++I+ +E+D+EPW +++QEK+ Q++L ES+I++LKES+ K  + + 
Sbjct: 522  DIKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLG 581

Query: 591  QLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQ 650
             LK EI+   ++ + +   I  L+ EQ ++ K + +GE EC  A  K  EM+ +L SHRQ
Sbjct: 582  SLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQ 641

Query: 651  RAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLD 710
            RA++ARS L   ENK+ VLSAL RLQ+SGRI GFHGRLGDLG I D YD+AISTAC RLD
Sbjct: 642  RAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLD 701

Query: 711  DIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGK 770
            DIVVD+VECGQQCIE+LRKNKLGYARFI+LDKLR F L  +QTPE V RLFDLV+  + K
Sbjct: 702  DIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLK 761

Query: 771  FLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMK 830
            F  AFYSVLRDTLV +D++QANRVAYGKRR+RVVTLDGKLID SGT++GGG+HV KGLMK
Sbjct: 762  FSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMK 821

Query: 831  ---SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIA 887
               S  +    Y   +V+ IE++L ERE NF IA +T  +M   LK+ +D+EPEIE+EIA
Sbjct: 822  LKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIA 881

Query: 888  KRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIENETKN 947
            K  +D++S +               +      +   L  AE+ LQ L  E+  +E+++++
Sbjct: 882  KLLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQS 941

Query: 948  KQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLEN 1007
            K++ IN+LKE+IMKIGG +LQ+QNSKV            K KKD+   K+ E +L++++ 
Sbjct: 942  KKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQR 1001

Query: 1008 QCREASNDIESC--NLEISKISV--LNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKT 1063
              ++A  D  +C  +LE  + +V  + T L+    + D  LN              ++K 
Sbjct: 1002 LFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIK- 1060

Query: 1064 NLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQAL- 1122
            ++EE  N   ++KS EIEI N+LEKLN L  + KK+I+    EL S  +RD+TQ+L+ + 
Sbjct: 1061 DMEESMN---EYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQ 1117

Query: 1123 NEGKLPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDID 1182
            NE                        +    + + ++             + + D MD+D
Sbjct: 1118 NENANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLD 1177

Query: 1183 EYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKR 1242
                E S G+PK ++  L+SI ++ +E +I++L  YV+N++ DI++LEEY RRL E+KKR
Sbjct: 1178 NVTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKR 1237

Query: 1243 KLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDS 1302
            KLDLN  V +RDEVR   E+LKK R D+FMEGFSIIS+TLKEMYQMITMGGNAELELVDS
Sbjct: 1238 KLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDS 1297

Query: 1303 LDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1362
            LDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALD
Sbjct: 1298 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1357

Query: 1363 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420
            FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK +NMT+S TL+N DILN
Sbjct: 1358 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1377 bits (3563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 746/1403 (53%), Positives = 965/1403 (68%), Gaps = 35/1403 (2%)

Query: 40   VKSSPTRQD-------RLPSPTPRKLVLGSPEKKYAYXXXXX--XXXXXVPNLQPPNVDG 90
            +K SPT QD          S TP+KL+L   +                  P+L PP    
Sbjct: 36   IKVSPTTQDAAAVSHLNFKSQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESS 95

Query: 91   SRGR--RFYXXXXXXXXXXXXXXXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVH 148
            SRGR  R Y                   LELIQLSPVKN+R  LQKIY+ KN+   + + 
Sbjct: 96   SRGRTARTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRIALQKIYESKNE---KQIE 152

Query: 149  RLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 208
            RLCIDKL LH+FKSYAGTQ++GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQ 
Sbjct: 153  RLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQD 212

Query: 209  KLSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYI 268
            +LSDLIHKSE +P+L+SCSV++HF YV+D+ DGTT  +  K  +VITRKAF+NN+SKYYI
Sbjct: 213  RLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYI 272

Query: 269  DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
            +GKESNYT VT+LL+D+GIDLDH RFLILQGEVE+I+QMKPKAE + DDGLLEYLEDIIG
Sbjct: 273  NGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIG 332

Query: 329  TAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXX 388
            TAKYK  IE    EI+ LN++C+EKENRFE+V++EK SLESGKDEA              
Sbjct: 333  TAKYKPLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVK 392

Query: 389  XXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKL 448
                QY +WQD +KLS TL K+S + E   + K K+   + ++ ++ +  ++  K +   
Sbjct: 393  SKLYQYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKAS 452

Query: 449  DKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQ 508
             ++ K L  ++R  D E+ S+EE+++N+ KK+ K EK L+    +++++K K+E+L  ++
Sbjct: 453  QEQEKKLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNE 512

Query: 509  KQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQM 568
             +Y+ +L +LN  L  ER  L+EIK+SL+DKT E S EI+ HE++LEPWN QLQ KKSQ+
Sbjct: 513  SEYESQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQI 572

Query: 569  KLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGE 628
            ++ ES+I+++KE + K   +I  L + I    E+   +E  I  L+ E   I K + IG+
Sbjct: 573  QVKESEISLIKEGRVKLENDIENLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGD 632

Query: 629  KECGSASSKLGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRL 688
             E  +A  KL EMK VL  HRQ+A++AR++LS  ENKN+VL++L RLQ+SGRI+GF+GRL
Sbjct: 633  TEYTNAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRL 692

Query: 689  GDLGTIDDMYDVAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNL 748
            GDLG IDD YD+AISTACPRL+D+VV+ VECGQQCIE+LRKNKLGYARFI+L+KLR F++
Sbjct: 693  GDLGAIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDM 752

Query: 749  SPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDG 808
            + I TP  VPRLFDLV S + KFLPAFYSVLRDTLVV++LK ANRVAYG +RFRVVTL G
Sbjct: 753  NKISTPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSG 812

Query: 809  KLIDTSGTLSGGGTHVMKGLMKSKQQPGAG---YTPEEVQNIEKELNEREKNFHIAIETF 865
            +LID SGT+SGGGT   +GLMK  +   +G   YT E+V+ IEKEL  REKNF IA ETF
Sbjct: 813  ELIDVSGTMSGGGTQTSRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETF 872

Query: 866  HDMEEALKKFKDREPEIEVEIAKRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELA 925
             +ME  L++ KDR+P++E+EI+K  L+I S  T                D     + EL+
Sbjct: 873  TEMETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELS 932

Query: 926  DAESKLQVLSEEYDEIENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXX 985
              E +L  L  +Y  ++ ETK+K+  I  LK++IMK+GG KLQ+Q+SKV           
Sbjct: 933  TMEHELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILN 992

Query: 986  XKQKKDRTATKKAENDLKRLENQCREASND-------IESCNLEISKISVLNTELEAKIY 1038
             K KKD+   KKAE +LKRL  +  E S D       +E+ + ++SKIS   +E E  ++
Sbjct: 993  GKHKKDKNDLKKAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLH 1052

Query: 1039 KLDTSLNXXXXXXXXXXXXXXRVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKK 1098
            +L+ S                 +K  L+E   N + FK  ++E  N+ EKLN L + IKK
Sbjct: 1053 ELEFS-------REESLQNSENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKK 1105

Query: 1099 EIKYNKDELNSLKIRDITQTLQALNEGKLPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDI 1158
            +I+    EL SLKIRDIT TLQ L+ G +                     +    N+ ++
Sbjct: 1106 DIRSTDSELQSLKIRDITHTLQELDNGNIDQDEEDVSMKDNAVSVSANNSLG---NSENM 1162

Query: 1159 DXXXXXXXXXXXXTDGEID-SMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNH 1217
            +             D   D  M+IDE  NE S G+P+ SE + +++ +E++E Q  +L  
Sbjct: 1163 EGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQD 1222

Query: 1218 YVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSI 1277
            Y+D  +V+IDVLEEYARR+AEYK+RKLDLN AV +R++VR+  ++LKK R ++FM+GF +
Sbjct: 1223 YIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGV 1282

Query: 1278 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSL 1337
            IS+TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSL
Sbjct: 1283 ISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSL 1342

Query: 1338 ALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1397
            ALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+Q
Sbjct: 1343 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQ 1402

Query: 1398 LVGIYKNNNMTRSTTLQNIDILN 1420
            LVGIYK+NN T+S TLQN DI+N
Sbjct: 1403 LVGIYKSNNQTKSATLQNNDIIN 1425

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1349 bits (3492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 754/1430 (52%), Positives = 981/1430 (68%), Gaps = 34/1430 (2%)

Query: 3    DSPLAKKQKTRTDDRGQIQS-NPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLVLG 61
            D  L+K+QK   D   QI   +PTV       G +L    +S ++     + TPRKLV+G
Sbjct: 4    DDSLSKRQKV--DGLNQIDGKHPTVDL---DQGENLSLPTTSSSQNTFAHAKTPRKLVVG 58

Query: 62   SPEKKYAYXXXXXXXXX-XVPNLQPPNVDGSRGRRFYXXXXXXXXXXXXXXXXXXXLELI 120
            + + +YA+           VP LQPP    SRGR                      LELI
Sbjct: 59   NGDNRYAHSSQSISSSSLQVPPLQPP-ATSSRGRG--SKTYSQSPPRSPGRSPTRKLELI 115

Query: 121  QLSPVKNNRAELQKIYDEKNKDGNQCVH-RLCIDKLSLHNFKSYAGTQIIGPFHTSFSAV 179
            Q+SP+KN+R ELQKIYD +    NQ  H RLCID+L L +FKSYAG Q++GPF+TSFSAV
Sbjct: 116  QISPLKNSRLELQKIYDAQQ---NQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAV 172

Query: 180  VGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDES 239
            VGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE YP+L SCSV++HF+YV+DE 
Sbjct: 173  VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEP 232

Query: 240  DGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQG 299
             G TR D+EKP +V+TRKAFRNN+SKYY++ +E+NY EVT+LL+ +G+DLDHKRFLILQG
Sbjct: 233  SGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQG 292

Query: 300  EVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFEL 359
            EVE+I+QMK KAERE +DGLLEYLEDIIGTAKYK  IE  L ++++LND+C+EKENRF++
Sbjct: 293  EVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEKENRFQI 352

Query: 360  VEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQ 419
            V++EKNSLE+GK+EA                  QYHI     KL  TL KI+ LN+ L +
Sbjct: 353  VDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEK 412

Query: 420  EKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKK 479
            E  K    ++E+ +LR   ++ + ++   + E K L  K+R +D +    EEK +N +KK
Sbjct: 413  ESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKK 472

Query: 480  RLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDK 539
            R KAEK L S + S++ S+ +L EL   Q  Y+  L +LNE    E+ KL++IK SL+DK
Sbjct: 473  RDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDK 532

Query: 540  TSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAF 599
            T+ IS EIA  E++LEPWNAQLQEKK+Q++L ESQI+++KE++ K  Q I Q K EIE  
Sbjct: 533  TNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETR 592

Query: 600  AEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTL 659
             ++       +  L  +  ++ + I  GEKEC +A  +L EM+N+L + RQ+A++ARS L
Sbjct: 593  KQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSAL 652

Query: 660  SNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVEC 719
            SN ENK+KVL+AL RLQ+SGRI+GFHGRLGDLG ID+ YDVAISTACPRL+DIVV+ VEC
Sbjct: 653  SNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVEC 712

Query: 720  GQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVL 779
            GQQCIE+LRKNKLGYARFI+LDKLRKFNL  I TPE+VPRLFDL+  K+ KF  AF+SVL
Sbjct: 713  GQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVL 772

Query: 780  RDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLM---KSKQQPG 836
             +TLV +DLKQANRVAYGK+RFRVVTLDG LID SGT+SGGG+ V +GLM   ++K +  
Sbjct: 773  GNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDI 832

Query: 837  AGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESS 896
              Y+ EEV  +E  L EREKNF +A +T + MEE LK  K++EP IE  I++  ++IES 
Sbjct: 833  EIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESW 892

Query: 897  STXXXXXXXXXXXXXTDRDGGSVEDR--ELADAESKLQVLSEEYDEIENETKNKQQLINS 954
            ++             ++R   + +D   EL +    +Q L +E+  I+N+TK+K+  I +
Sbjct: 893  NS--EIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIET 950

Query: 955  LKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLENQCREASN 1014
            LK +IM+IGG +L++Q+SKV            KQKK+R+  KK EN++ +      E S 
Sbjct: 951  LKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSR 1010

Query: 1015 DIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLEEKTNNTSD 1074
            D+E+ N EI  +      L+  + K+  S+                ++  L +   + + 
Sbjct: 1011 DLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAI 1070

Query: 1075 FKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQAL----NEGKLPXX 1130
            FKS E+E+ N LEKLN L+ H+KKEIK+ +++L  LKIRD+TQ L  L    N    P  
Sbjct: 1071 FKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPSE 1130

Query: 1131 XXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYENETSN 1190
                               + D +A D               D ++D  D  EY   +  
Sbjct: 1131 NPVSDVEESESSVGEGKDENKDLDAQD------QVQDAEKQGDNQMDVEDGGEY---SDR 1181

Query: 1191 GLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAV 1250
            GL +FSE +L  I+IE++E +I++L +++D ++ DIDVLEEYARRL E+K R+LDLNQAV
Sbjct: 1182 GLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAV 1241

Query: 1251 LKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1310
             +R++V++  +ELKKKR D+FM+GF IISMTLKEMYQMITMGGNAELELVD+LDPFSEGV
Sbjct: 1242 EERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGV 1301

Query: 1311 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1370
             FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1302 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1361

Query: 1371 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420
            NYIKERTKNAQFIVISLRNNMFELAQQLVGIYK +N T+S T++NID ++
Sbjct: 1362 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVS 1411

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1310 bits (3391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 726/1430 (50%), Positives = 961/1430 (67%), Gaps = 50/1430 (3%)

Query: 2    SDSPLAKKQKTRTDDRGQI-----QSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPR 56
            S +P  +++  R DD   +     QS  ++SP P +S S                  TPR
Sbjct: 18   SHTPEQQEENRREDDESPLRFEHQQSAVSLSP-PAISKSH-----------------TPR 59

Query: 57   KLVLGSPEKKYAYXX-XXXXXXXXVPNLQPPNVDGS--RGRRFYXXXXXXXXXXXXXXXX 113
            KL+L   + +YA+           VP+LQPP    S  RGRR                  
Sbjct: 60   KLILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRR-DIKVYSQSPPRSPGRSP 118

Query: 114  XXXLELIQLSPVKNNRA-ELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPF 172
               LELIQLSPVKNNR  +LQ++Y+ + K       RL I+KL L+NFKSYAG Q+IGPF
Sbjct: 119  TRKLELIQLSPVKNNRIRKLQELYNSQIKK-----ERLFINKLVLNNFKSYAGEQVIGPF 173

Query: 173  HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHF 232
            +T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE++PNL SCSVD+ F
Sbjct: 174  NTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEF 233

Query: 233  RYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHK 292
            +YVVD+S+G+++ DD KP ++ITRKAF+NNSSKY+I+GKES+YTEVT+LL+++GIDLDHK
Sbjct: 234  QYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHK 293

Query: 293  RFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVE 352
            RFLILQGEVE+I+QMKPKAERE DDGLLEYLEDIIGTA YK+ IE   +E+DTLN++C+E
Sbjct: 294  RFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIE 353

Query: 353  KENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISE 412
            KENRFE+VE+EKNSLES K+ A                  QY+I ++  KL+ TL K+S 
Sbjct: 354  KENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSV 413

Query: 413  LNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEK 472
            L E    E  K++  QRE  +L +      K++V + ++ K+ TSK+R +  +K S+EEK
Sbjct: 414  LQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEK 473

Query: 473  QRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEI 532
             ++  +K+ KA K +  ++  + + ++++E LN  Q++ +  L  L   L +E++ L+EI
Sbjct: 474  IKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEI 533

Query: 533  KLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQL 592
            KLSL+DKT++IS EIA HER+LEPW  QLQEKK ++++ ESQI++L+E++ K    I +L
Sbjct: 534  KLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKL 593

Query: 593  KTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRA 652
            K +++   E    QE  +  L+ + + I    D GE EC +A SK+ +M++VL + RQ+ 
Sbjct: 594  KNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKV 653

Query: 653  MEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDI 712
            M+ARS L+ VENK+KVLSAL +LQ+SGRI+GF+GRLGDLG ID+ YD+AISTA  RLDDI
Sbjct: 654  MDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDI 713

Query: 713  VVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFL 772
            VVD+VECGQ CIE+LRKNKLGYARFI+L+KLR   L  IQTPE V RLFDLV+     F+
Sbjct: 714  VVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFI 773

Query: 773  PAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSK 832
            PAFYSVLR+TLV  DLKQANRVAYG  RFRVVT+DGKLID SGT++GGG    +GLMK +
Sbjct: 774  PAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLR 833

Query: 833  QQPGAG---YTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKR 889
            ++       Y+ ++++ IEKEL ERE NF  A +T+ +ME+AL++ KDR+PE+E+EI+K 
Sbjct: 834  KKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKC 893

Query: 890  RLDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQ 949
             +D + SS              T  +  +    E+ + E +L +L +EY  + + TKN  
Sbjct: 894  LMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNIS 953

Query: 950  QLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLENQC 1009
            + I+ LK++IM+IGG  LQ+QNSKV            KQK+  ++ KK EN+++R E   
Sbjct: 954  EKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKAL 1013

Query: 1010 REASNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLEEKT 1069
              A  D ++C+ E+   S     +E  +  +D +                 +K  + E  
Sbjct: 1014 SGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAE 1073

Query: 1070 NNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPX 1129
               + FKS EI++ +RLEKLN L  HIK+ IK   ++L +L++R+ T      +EG    
Sbjct: 1074 IEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFG--DEGDNNS 1131

Query: 1130 XXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYENETS 1189
                                    N M               T+ E   M+ID+  +E S
Sbjct: 1132 INGVDRTSHGGGVPLQDQNKVVRENNM---------RNEKNSTEAE---MEIDDVADEFS 1179

Query: 1190 NGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQA 1249
             G+P+ S+A+L  I ++ +E +I +L  YV   +V+IDVLEEYARRLA+Y  RKLDLNQA
Sbjct: 1180 PGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQA 1239

Query: 1250 VLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1309
            V +R+ ++K  +ELKKKR D+FM+GF IISMTLKEMYQMITMGGNAELEL+DSLDPFSEG
Sbjct: 1240 VERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEG 1299

Query: 1310 VLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIV 1369
            V FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIV
Sbjct: 1300 VTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1359

Query: 1370 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDIL 1419
            ANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK +N T+S  ++N D L
Sbjct: 1360 ANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1306 bits (3379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/1425 (49%), Positives = 946/1425 (66%), Gaps = 38/1425 (2%)

Query: 12   TRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLVLGSPEKKYAYX- 70
            TR D+R +  +N T S +      SL  ++SS +  D   + TPRKL++G  E KYA   
Sbjct: 31   TRNDERNK--NNATKSSL----HDSLPKLQSSVSPLDFKKTVTPRKLIIGPSENKYALSQ 84

Query: 71   -XXXXXXXXXVPNLQP---PNVDGSRGRR--FYXXXXXXXXXXXXXXXXXXXLELIQLSP 124
                      VP LQ    P    SRGRR   Y                   LELIQLSP
Sbjct: 85   PTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYSQSPPRSPGRSPNRSPVRKLELIQLSP 144

Query: 125  VKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNG 184
            +KN+R ELQK+YD  N    + ++RL I KL LHNFKSYAG Q IGPF  SFSAVVGPNG
Sbjct: 145  IKNSRLELQKLYDAHNAKIGK-MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNG 203

Query: 185  SGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTR 244
            SGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE + NL  CSV++HFRYV DE    T 
Sbjct: 204  SGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTD 263

Query: 245  SD--DEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVE 302
             D  + +  +VITRKAF+NNSSKY+I+GKESN+TEVT+LL++QGIDLDHKRFLILQGEVE
Sbjct: 264  GDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVE 323

Query: 303  SISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEK 362
            +I+QMK KAE++++DGLLEYLEDIIGT  YK  IE   VEI+ +N++C+EKENRF +V+ 
Sbjct: 324  NIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDD 383

Query: 363  EKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKA 422
            EKNSLE  KD A                  QYH++ +  K+  TLG+I  L     QEK 
Sbjct: 384  EKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQ 443

Query: 423  KYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLK 482
            ++ QF +EV  L+   ++ K  +  L  E K L  ++R ++ +  S+EE  +NLD+K  K
Sbjct: 444  RHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKK 503

Query: 483  AEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSE 542
            A+  ++S+++ ++ ++H+L+E +  Q++Y+ ++  L++    E   L +IKL L+DKT  
Sbjct: 504  AKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLSKQREVEEKILLDIKLQLKDKTVT 563

Query: 543  ISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEK 602
             S EIA+ E++LEP N ++QEKKSQ+KL E +I ++++SK K    I  LK E+    + 
Sbjct: 564  FSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKVGAEIESLKEELLKLQKD 623

Query: 603  NNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLSNV 662
                E  +  L   + N++K    G+KEC  A  KL EMK +L SHRQ+ MEARST+S  
Sbjct: 624  LEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTA 683

Query: 663  ENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECGQQ 722
            +NKNKVL++L+R+Q+SGRI GFHGRLGDLG I D YDVAISTACPRLDD+VV++VECGQ 
Sbjct: 684  QNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDVAISTACPRLDDMVVESVECGQT 743

Query: 723  CIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDT 782
            CIE LRKNKLGYARF++LDKL++F++SPIQTPE VPRLFDLV+ K  +F PA YSVLRDT
Sbjct: 744  CIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDT 803

Query: 783  LVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMK-SKQQPGAG--Y 839
            LV  DLKQANRVAYGKRRFRVVTLDG+LID SGT+SGGG+ V KGLM  + +  G    +
Sbjct: 804  LVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIF 863

Query: 840  TPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSSTX 899
            + E+++ +E EL  REK F +A ETFH ME+ L+K  DREP++E+EI+K+ +DI++ +  
Sbjct: 864  SLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQ 923

Query: 900  XXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKI 959
                         D +    +  +L      L+ L++E   +++++K   + ++ LK++I
Sbjct: 924  IQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLEALNQELKYLQDQSKTSSERVSFLKDEI 983

Query: 960  MKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKR----LENQCREASND 1015
            M+IGG++LQLQNSKV            K KK +T  KK   +LK+    L     E++N 
Sbjct: 984  MRIGGSELQLQNSKVSSLNQRIDILQAKLKKSKTVVKKLNTELKKARKSLIASTEESTNS 1043

Query: 1016 IES-----CNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLEEKTN 1070
             E         E++K S+L+         ++ SL                    L E   
Sbjct: 1044 TEEIAHAKARAEVAKNSLLD---------INKSLESIQDEKINLEQELENFSDKLHESNE 1094

Query: 1071 NTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPXX 1130
            N ++FK++++E+ N++E+ N + S++KKE     +ELN+ ++RD+T TL  L E +    
Sbjct: 1095 NVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVTHTLDLLREEEGTEA 1154

Query: 1131 XXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYENETSN 1190
                              M    +A   +               EI SMD+D+  +  S 
Sbjct: 1155 NQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEI-SMDVDDCGDLVSQ 1213

Query: 1191 GLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAV 1250
            G+P+ S+ +L +I  +++  +I++L  +++N  ++I++LEEYA+RL E+KKRK+DLN +V
Sbjct: 1214 GIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSV 1273

Query: 1251 LKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1310
             +R+++    EELKKKR ++FMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV
Sbjct: 1274 GERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1333

Query: 1311 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1370
             FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1334 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1393

Query: 1371 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQN 1415
            NYIKERTKNAQFIVISLRNNMFELA+QLVGIYK+ NMT++ T++N
Sbjct: 1394 NYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRN 1438

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1301 bits (3366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 724/1391 (52%), Positives = 935/1391 (67%), Gaps = 49/1391 (3%)

Query: 40   VKSSPTRQDRLPSPTPRKLVLGSPEKKYAYXXXXXXXXXX----VPNLQPPNVDGSRGRR 95
            V  SPTR       TPRKLVLGSPEKKYA                P+LQPP     RGR 
Sbjct: 21   VSQSPTR-------TPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGRE 73

Query: 96   FYXXXXXXXXXXXXXXXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKL 155
             Y                   LELI+LSP K+ R ELQK+++       Q   RLCIDKL
Sbjct: 74   -YSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQKMHEA----NTQTSQRLCIDKL 128

Query: 156  SLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIH 215
             L+NFKSYAG Q IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS+LIH
Sbjct: 129  VLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIH 188

Query: 216  KSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNY 275
            KSE +P+L SCSV IHF YV D  +G T+       MV+ R+AF+NNSSKYY++GKESNY
Sbjct: 189  KSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNY 248

Query: 276  TEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAG 335
            TEVT+LL+++GIDLDHKRFLILQGEVESI+QMK KAE+++DDGLLEYLEDIIGTAK+K  
Sbjct: 249  TEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQ 308

Query: 336  IEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYH 395
            IE  L EI+TLN+VC+EKENRFELV+KEK +LESGK+EA                  Q  
Sbjct: 309  IEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQ 368

Query: 396  IWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDL 455
            I+   RKL+ +  KIS LN    +EK++Y+  Q+E   L    N+ KK+   L+ E K++
Sbjct: 369  IYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNV 428

Query: 456  TSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKL 515
             SK+R ++++  + +EK +++ +K   AEK    +E++   + +++E L  +    + +L
Sbjct: 429  NSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIEL 488

Query: 516  LQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQI 575
              LN S+  E+ KL+EIK+ L +KT ++S E+ + ER LEP+  Q+QEK+S++KL+E++I
Sbjct: 489  HNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKI 548

Query: 576  AILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHK----LQCEQANILKRIDIGEKEC 631
             +LK S      N+++ K  IE+  E   ++E+   +    L+ E++ +  RI   +KEC
Sbjct: 549  TMLKSSH----SNLLKEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKEC 604

Query: 632  GSASSKLGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDL 691
              A  +  EM++VLI  RQ   EA++ L+  +NKN+VL AL +LQ SGRI GFHGRLGDL
Sbjct: 605  EEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDL 664

Query: 692  GTIDDMYDVAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPI 751
            GTIDD YD+AISTACPRLDDIVV+ VECGQQCI+HLRKNKLGY RFI+LDKLRK NL  I
Sbjct: 665  GTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRI 724

Query: 752  QTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLI 811
             TPE VPRLFDL+      F PAFYSVLRDTLV  DL+QANRVAYGKRRFRVVTLDGKLI
Sbjct: 725  ATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLI 784

Query: 812  DTSGTLSGGGTHVMKGLMKSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEA 871
            D SGT+SGGG+    GLM+SK    + Y+ +EV+ +E +L+ +E N+  A+   H+ME A
Sbjct: 785  DISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESA 844

Query: 872  LKKFKDREPEIEVEIAKRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKL 931
            L+K  DR PEI+++I+K +L+  S                 +        + L D E KL
Sbjct: 845  LQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKL 904

Query: 932  QVLSEEYDEIENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKD 991
             +L +   +  + +K  Q  I+ LK++IM+ GG +L++Q +KV            KQKK+
Sbjct: 905  DILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKE 964

Query: 992  RTATKKAENDLKRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXX 1051
            +T +KK + DL R   +  + S ++  CN +IS +S     +  +  +++  +       
Sbjct: 965  KTRSKKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERK 1024

Query: 1052 XXXXXXXXRVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLK 1111
                    ++K  L     ++++FK+ E+E ++RLEKL+GL  ++KK+++  +  L SLK
Sbjct: 1025 AELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLK 1084

Query: 1112 IRDITQTLQALNEGKLPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXX 1171
            IRD+++ L  LN+G +                     M+ D                   
Sbjct: 1085 IRDVSKLLSQLNDGII-----------ESCTDVTAKVMNGD------------IVQTQSI 1121

Query: 1172 TD-GEIDSMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLE 1230
            TD G  D+M+ D  E  T +GLP  +E +L+++ +E +EL++ +L  Y+DN + DI+VLE
Sbjct: 1122 TDVGNNDAME-DSGEAATHSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLE 1180

Query: 1231 EYARRLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMIT 1290
            EYARRLAEY++RKLDLNQAV KR+EVR  CE  K +RL+KFMEGF IISMTLKEMYQMIT
Sbjct: 1181 EYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMIT 1240

Query: 1291 MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTP 1350
            MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTP
Sbjct: 1241 MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1300

Query: 1351 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRS 1410
            LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYKNNNMT+S
Sbjct: 1301 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKS 1360

Query: 1411 TTLQNIDILNG 1421
            TTLQNIDIL+ 
Sbjct: 1361 TTLQNIDILHS 1371

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1280 bits (3313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/1449 (48%), Positives = 962/1449 (66%), Gaps = 59/1449 (4%)

Query: 1    MSDSPLAKKQK---TRTDDRGQIQSNPTVS---------------PIPPVSGSSLMAVKS 42
            M DSP++KKQK   +R +D+    +                     I P  G        
Sbjct: 1    MPDSPISKKQKITESRDEDKKINNNIIINHNNRDINRSHVDDADITIGPYQGQEKHIQPQ 60

Query: 43   SPTRQDRLPSPTPRKLVLGSPEKKYAYXX-XXXXXXXXVPNLQPPNVDGSRGRRFYXXXX 101
            S  R  R  S TPRKL++ S + ++              P+LQ P+V   R  +FY    
Sbjct: 61   SQDRHGR--SRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVSTGREHKFYSQSP 118

Query: 102  XXXXXXXXXXXXXXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFK 161
                           LELIQLSP+KNNRAELQK+Y+ +         RL I++L L NFK
Sbjct: 119  PRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTI--RLVIERLVLTNFK 176

Query: 162  SYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYP 221
            SYAG Q++GPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL DLIHKSE YP
Sbjct: 177  SYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYP 236

Query: 222  NLESCSVDIHFRYVVDESDG-TTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQ 280
             L SCSV+IHF+YV+D+ +G  ++ D+ K  +V+ RKAF+NNSSKYYI+ KES++T+VT 
Sbjct: 237  ELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTT 296

Query: 281  LLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGL 340
            LL+++GIDLDHKRFLILQGEVE+I+QMKPK+E+E DDGLLEYLEDIIGT+ YK  IE  L
Sbjct: 297  LLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNL 356

Query: 341  VEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQ 400
             +++ LN++C+EKENRF +VEKEK+SL  GK+EA                  Q+ ++ D 
Sbjct: 357  SKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDN 416

Query: 401  RKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRR 460
            +KL+ TL KI++  E+  +E  KY    +E+  L++      K++ +  K  + L S +R
Sbjct: 417  KKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQR 476

Query: 461  LMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNE 520
              + E  S +E  +N++KK+  AEKL+ +TE S+  + +KLE LNN Q+ Y +++ +LNE
Sbjct: 477  KNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNE 536

Query: 521  SLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKE 580
             L  E+SKL+EIK+SL+ KT + S EI  +E++LEP+  QLQEK SQ++L +S+I++L E
Sbjct: 537  KLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNE 596

Query: 581  SKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANIL---KRIDIGEKECGSASSK 637
            +K+     II +K  IE   +K +V  ++  K+   +  +L   K ++ G+ E    + K
Sbjct: 597  NKDNLSNEIISIKKLIEE--KKLSVVRMS-EKITGWKQQLLEQRKEVESGDIEFNKFTKK 653

Query: 638  LGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDM 697
            + EM++ L SHRQ+A ++R++LSNV+NKN VL+AL +LQ+SGRI+GF+GRLGDLG ID+ 
Sbjct: 654  IQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEK 713

Query: 698  YDVAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETV 757
            YDVAISTACPRL+D+VVD+V+CGQQCI++LRKN+LGYARFI+LDKLRKFNL+ I+TP+  
Sbjct: 714  YDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNA 773

Query: 758  PRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTL 817
            PRLFDL++ +  KFLPAFYSVLRDTLV ++L  AN+VAYGKRRFRVVTLDGKLID SGT+
Sbjct: 774  PRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTM 833

Query: 818  SGGGTHVMKGLMKSKQQ-PGAGY---TPEEVQNIEKELNEREKNFHIAIETFHDMEEALK 873
            SGGG +V++GLMK  Q  P   +   +PEEVQ +E+EL   EKNF +A  +  +M + + 
Sbjct: 834  SGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEIL 893

Query: 874  KFKDREPEIEVEIAKRRLDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQV 933
              K++ P  E+ I+K  ++IE                    D  S  + E+  A+ KLQ 
Sbjct: 894  HMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQA 953

Query: 934  LSEEYDEIENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRT 993
            L +EY  + ++TK  +Q I  L+++IM  GG +L++QNSKV            KQK D++
Sbjct: 954  LKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKS 1013

Query: 994  ATKKAENDLKRLENQCREA-SNDIE-SCNLEISKISVLNTELEAKIYKLDTSLNXXXXXX 1051
            A KK  N LK+L+N+      N +E   NLE SK  V  T L  ++ KL++ +N      
Sbjct: 1014 AIKKNNNILKKLQNELNTTKDNSLEFKTNLENSKKKV--TLLSEELAKLESDINDTQNAK 1071

Query: 1052 XXXXXXXXRVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLK 1111
                      K   +E   ++ +FKS E+EI N+L+KL  L+ H++K+I     ELN+L 
Sbjct: 1072 EEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALT 1131

Query: 1112 IRDITQTLQALNEGKLPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXX 1171
            IR+I+Q L++ +E                         SS  N++               
Sbjct: 1132 IREISQNLESFDE------RLEKYDISKNGATEDTQHTSSALNSV--------------- 1170

Query: 1172 TDGEIDSMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEE 1231
            ++   D+MDID  +NE + G+ + SE ++  + IE ++ +I+ L   ++++  +I++LEE
Sbjct: 1171 SNINTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEE 1230

Query: 1232 YARRLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITM 1291
            Y RRL+EYKKRK DL++++ +++  ++  E LKKKRL++F  GF IIS+TLKEMYQMITM
Sbjct: 1231 YVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITM 1290

Query: 1292 GGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPL 1351
            GGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPL
Sbjct: 1291 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1350

Query: 1352 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRST 1411
            YVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK+ NMT+S 
Sbjct: 1351 YVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSA 1410

Query: 1412 TLQNIDILN 1420
            TL N D+LN
Sbjct: 1411 TLVNNDMLN 1419

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1243 bits (3216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/1434 (48%), Positives = 937/1434 (65%), Gaps = 59/1434 (4%)

Query: 1    MSDSPLAKKQKTRTDDRGQIQSN-PTVSPIPPVSGSSLMAVKSSPTR--QDRLPSPTPRK 57
            MS  P AKKQK +      I+SN P  + IP ++ S       SP +   D L S TP K
Sbjct: 1    MSALPDAKKQKVK-----DIESNSPLNNDIPKIAQSR----NDSPLQVANDPLKSYTPMK 51

Query: 58   LVLGSPEKKY--AYXXXXXXXXXXVPNLQPPNVDGSRGR--RFYXXXXXXXXXXXXXXXX 113
            +++ +                    P+LQ P+   SRGR  + Y                
Sbjct: 52   VIISNNHSNSISPLPSQLMSSSTQPPSLQHPS-SSSRGRAVKAYSQSPPRSPDRSPVRSP 110

Query: 114  XXXLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFH 173
               LELIQLSP+KN+R+ELQKIY  K ++    + R+C++KL LHNFKSYAGTQ IGPFH
Sbjct: 111  TRKLELIQLSPIKNSRSELQKIYSSKQEEK---IERICLNKLVLHNFKSYAGTQTIGPFH 167

Query: 174  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFR 233
            +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL+DLIHKSE YP+L SC+VD+HF 
Sbjct: 168  SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFE 227

Query: 234  YVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKR 293
            Y++D  D TT+ +  K P++ITR+AF+N++SKYY++GKESNY  +T LL+++GIDLDH R
Sbjct: 228  YLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNR 287

Query: 294  FLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEK 353
            FLILQGEVE+I+QMKPKAE+E DDGLLEYLEDIIGT KYK  I+   +EI+ LND+C+E+
Sbjct: 288  FLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIER 347

Query: 354  ENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISEL 413
            ENRF+++++EK SLES K+ A                  QY IWQ+  KLS TL KI++L
Sbjct: 348  ENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKL 407

Query: 414  NEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQ 473
             +   QEK K  + + ++ +LR+     + ++  L K+ K+L + +R +D +  S  E+ 
Sbjct: 408  EDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQL 467

Query: 474  RNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIK 533
            +N++KK  K  K ++    +++ S  +L+  ++++K ++ +L++L+ +L+ E   L+ IK
Sbjct: 468  KNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIK 527

Query: 534  LSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLK 593
            L L+DKT  +S EI   E+DLEPWN +L E KS++++ ES+ A+ +ESK K   NI  L+
Sbjct: 528  LDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALE 587

Query: 594  TEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAM 653
             ++   ++    +   +  L  +  N+ K +  G  E   A+ KL EM+ +LI  RQ+A 
Sbjct: 588  KDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKAN 647

Query: 654  EARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIV 713
            +AR++LSNVEN++KVL AL++LQ+SGRI GFHGRLG+LG ID+ YDVAISTACPRL+DIV
Sbjct: 648  DARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIV 707

Query: 714  VDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLP 773
            VD+VECGQQCIE+LRKN LG+ARFI+LDKL KF++  I TP  VPRLFDL++  + KFLP
Sbjct: 708  VDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLP 767

Query: 774  AFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMK--- 830
            AFYSVLR+TLV +DLK+AN VAYGK R+RVVTL G LID SGT+SGGG    KG M+   
Sbjct: 768  AFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSN 827

Query: 831  SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRR 890
            S  +  + Y+ EEV  IEKEL+ REKN+  A  T  +ME  L+  K+ EP+IE+EI+K  
Sbjct: 828  STSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLN 887

Query: 891  LDIESSSTXXXXXXXXXXXXXTDRDGGSVEDRELAD---AESKLQVLSEEYDEIENETKN 947
             +I+S                      S+ED   AD    ++ L  L+E+   IE++ K+
Sbjct: 888  FEIDSLENECSLKRKQLNEPNA---SFSIEDNMSADITEMDNALYTLNEKQKLIESQMKS 944

Query: 948  KQQLINSLKEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLEN 1007
            K+  I  L++KIMKIGG KLQ+QNSKV            KQK ++    K E+D+++L  
Sbjct: 945  KKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSK 1004

Query: 1008 QCREASNDIESCNLEISKISVLN--TELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNL 1065
            + +E+ +D  +  L   KI++ N    +E  + + + ++N                   L
Sbjct: 1005 KLKESESD--NTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNEL 1062

Query: 1066 EEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEG 1125
             E     S+FK++E+E   + EKL  L + IKK +K  +++ +SL IR++   L  LN  
Sbjct: 1063 TEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLN-- 1120

Query: 1126 KLPXXXXXXXXXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYE 1185
                                      +  A  I              D   D M I++  
Sbjct: 1121 ------------------------IKEQEAQKIKTELYADFEQNQSNDVINDEMIIEDNN 1156

Query: 1186 NETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLD 1245
            NE + G+P + E+  +   I  +E ++ +L  Y + A VD+D+LEEY RR+ EY++RK D
Sbjct: 1157 NEIAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYD 1216

Query: 1246 LNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDP 1305
            LNQ+V +RD+VRK  E+LKK R ++FME F+IISMTLKEMYQ+ITMGGNAELELVDSLDP
Sbjct: 1217 LNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDP 1276

Query: 1306 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRN 1365
            FSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRN
Sbjct: 1277 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1336

Query: 1366 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDIL 1419
            VSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYKN N T+S TL+N DIL
Sbjct: 1337 VSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1181 bits (3055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 664/1424 (46%), Positives = 917/1424 (64%), Gaps = 34/1424 (2%)

Query: 1    MSDSPLAKKQK-TRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLV 59
            MSD P++K+QK T  D+   +   P             +  + SP       + TPR L 
Sbjct: 1    MSDRPVSKRQKVTEEDEEEDVIHTPKA-----------VTFEQSPR------AITPRNL- 42

Query: 60   LGSPEKKYAYXXXXXXXXXXVPNLQPPNVDGS-RGRRFYXXXXXXXXXXXXXXXXXXXLE 118
            LGS  +              +P+L PP   GS RGR F                    L+
Sbjct: 43   LGSENRNVL--PTGGSQNLQIPSLLPPESLGSARGRDF--KSYSQSPPRSPGRSPTRRLK 98

Query: 119  LIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSA 178
            LI+LSP+KN+RAELQK+Y+ K  D  +   RL I +L L++FKSYAG Q+IGPFHTSFSA
Sbjct: 99   LIELSPIKNSRAELQKLYESKKLDVKK--ERLFIHQLVLNDFKSYAGRQVIGPFHTSFSA 156

Query: 179  VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDE 238
            +VGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE +P+L+SCSV++HF+YV+D+
Sbjct: 157  IVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDK 216

Query: 239  SDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQ 298
             DG+T  D+ K  +V+TRKAF+NN+SKY+++GKESNYTEVT LL+ +GIDLDHKRFLILQ
Sbjct: 217  DDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQ 276

Query: 299  GEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFE 358
            GEVE+I+QMK KAE+E+DDGLLEYLEDIIGT+KYK  IE   +EI++LN++CVEKENRF 
Sbjct: 277  GEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFS 336

Query: 359  LVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLG 418
            +VE+EKNSLESGK+EA                  QY++ QD +KL + L K + + +   
Sbjct: 337  IVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQT 396

Query: 419  QEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDK 478
            +++ ++ +    ++ +    N  K  + K+  E  +L+  +R ++ +K   E+   NLD 
Sbjct: 397  KQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDS 456

Query: 479  KRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRD 538
            KR + E+  K  ++ +  +  +++ +   Q    E    L+ +L  E+ KL+ IKL LR+
Sbjct: 457  KRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLRE 516

Query: 539  KTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEA 598
            KT  ++ +IA +E++L PWN Q Q+ K ++K+TES+++I++E+++    +I  L+  I +
Sbjct: 517  KTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILS 576

Query: 599  FAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARST 658
                  VQE  I  L  ++  +++  ++GE+EC +A + L  ++  + + RQ+A+E RST
Sbjct: 577  QKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRST 636

Query: 659  LSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVE 718
             S  EN NKVLSAL+RLQ+SGR+ GFHGRLGDL  ID  YDVAISTACPRL+D+VVD VE
Sbjct: 637  YSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVE 696

Query: 719  CGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSV 778
             GQQCIE+LRKNKLGYARFI+LDKL  FN + I TP+   RLFDL+  K  +F  AFYSV
Sbjct: 697  SGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSV 756

Query: 779  LRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLM---KSKQQP 835
            LRDTLV  +++QANRVAYGK+R+RVVTLDG LID SGT++GGG +V KGLM   KS  + 
Sbjct: 757  LRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKG 816

Query: 836  GAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIES 895
             A ++PEEVQ IE ELN++E  +  A++ +H+MEE L++ +DR PEI+  ++K+ +DIE+
Sbjct: 817  SAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIET 876

Query: 896  SSTXXXXXXXXXXXXXTDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSL 955
            +                  +    ++       +KL+ L  + D+I+ +TK+ +  I ++
Sbjct: 877  AHNDINSNINVLEEKRKKLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKSTKDKIKTI 936

Query: 956  KEKIMKIGGTKLQLQNSKVXXXXXXXXXXXXKQKKDRTATKKAENDLKRLENQCREASND 1015
            K+KI+++GG +L+ Q+  V            + KK ++   K E+ LK+   +  EA+ +
Sbjct: 937  KDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEANEE 996

Query: 1016 IESCNLEISKISVLNTELEAKIYKLDTSLNXXXXXXXXXXXXXXRVKTNLEEKTNNTSDF 1075
            + + +       + + E+E+K+  +  S+                    LE      SD+
Sbjct: 997  LTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDY 1056

Query: 1076 KSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPXXXXXXX 1135
            KS+ +E NN+LEKL    + +KK IK   D L+ L IRD+TQ L       +        
Sbjct: 1057 KSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNT-----IMTEENASV 1111

Query: 1136 XXXXXXXXXXXXXMSSDPNAMDIDXXXXXXXXXXXXTDGEIDSMDIDEYENETSNGLPKF 1195
                         +++D + +                D + + M+ID      + G+P  
Sbjct: 1112 DKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVL 1171

Query: 1196 SEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDE 1255
            S ++L  +  ++VEL I  L+ ++ ++  ++DVLEEYA R  E+ KRK DLN AV  RD 
Sbjct: 1172 SASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDS 1231

Query: 1256 VRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVM 1315
            V+   E +K+KR D+FMEGF IISMTLKEMYQMIT+GGNAELELVDSLDPFSEGV FSVM
Sbjct: 1232 VKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVM 1291

Query: 1316 PPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKE 1375
            PPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKE
Sbjct: 1292 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1351

Query: 1376 RTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDIL 1419
            RTKNAQFIVISLRNNMFEL +QLVGIYK+ NMT+S  L N D++
Sbjct: 1352 RTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
           chromosome segregation protein
          Length = 1223

 Score =  147 bits (372), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 176/708 (24%), Positives = 316/708 (44%), Gaps = 86/708 (12%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L+NFKSY GT  +    ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 215 HKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAF--------------- 259
           ++            DI  R    E+  T   +DE        KAF               
Sbjct: 67  YR------------DIISR----ENTPTGADNDENGNRTAYVKAFYEYDGKVVELMRLIS 110

Query: 260 RNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGL 319
           R   + Y +DG    Y E +Q L  Q I +  K FL+ QG+VE I+   P        GL
Sbjct: 111 RLGDTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GL 163

Query: 320 LEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESG--KDEAXXX 377
            + +E++ G+ +YK   E    + D +     E   +   +  E  + + G  +DE    
Sbjct: 164 TKLIEEVSGSMQYKKEYEELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRK 223

Query: 378 XXXXXXXXXXXXXXAQYHIWQDQR-----KLSETLGKISELNEHLGQEKAKYDQFQREVA 432
                          Q +  +D+R     KL E+   +  + E L  E+   + F++ ++
Sbjct: 224 YVQKKKRVQTNLSLWQLYHMEDERYQCLQKLEESQNDVDVIREKLEAEEKNLEVFKKALS 283

Query: 433 QLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTEN 492
           +        K  +  + KE +   S  +++   + +   + +NLDK+    +K L+  E 
Sbjct: 284 KEAVLLTKKKNHIRSISKEKEKAESDLKVVKIPQNASINRLKNLDKRVDSLQKDLEREEA 343

Query: 493 SMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANH-- 550
           ++   KH+L+ + +S+  +++++  L++S    +  L E  L L D   E+  E  N+  
Sbjct: 344 NLEKYKHQLKVVTDSKNAFEQEI--LSKSKNNNKFTLSEDDLKLYD---ELKGEYLNNGG 398

Query: 551 ---ERDLEPWNAQLQEKKSQMKLTESQIAILKESKE-----KKVQNIIQLKTEIEAFAEK 602
              E  L   + + +E  + +K+   ++ I K+  E     KK +   +++       EK
Sbjct: 399 IEIEDTLNLLDNKKEEITADLKIINDKVEISKQRIEDELVTKKEEQDAKIRDSTLLLNEK 458

Query: 603 NNVQEIAIHKLQCEQANIL----KRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARST 658
           N++    + +L+  Q +I     K  D+  K           +++ L+  +   + A   
Sbjct: 459 NDLHSHKLDELRKTQKDIEYWNNKEFDLNHK-----------LRDTLV--KLDDLNATQR 505

Query: 659 LSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTID-DMYDVAISTACPR-LDDIVVDN 716
            SN E K +   A+++        G  G + +L     D Y +A+ST   +  D ++VD+
Sbjct: 506 ESNKERKLRENVAMLK----RFFPGVRGLVHELCKPKRDKYKLAVSTVLGKNFDSVIVDS 561

Query: 717 VECGQQCIEHLRKNKLGYARFIILDKLRKFN-LSPIQTPETVPRLFDLVRSKNGKFLPAF 775
           +   Q+CI  L+K + G   FI LD +       P+   ET     + V  K+   + A 
Sbjct: 562 LSVAQECISFLKKQRAGVISFIPLDTIDAATPRMPVPESETYTLAINTVEYKDD-LVRAM 620

Query: 776 YSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGGGT 822
           Y V  DT++  +L  A  + + K    ++VTLDG LI+ +G ++GG T
Sbjct: 621 YYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALINKTGLMTGGIT 668

 Score =  126 bits (316), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 96/151 (63%), Gaps = 10/151 (6%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1313
            +K+KR + F   F  I+  L  +Y  +T          GG+A + + D  +PF+ G+ + 
Sbjct: 1054 VKQKRKELFENAFEKINEHLDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYH 1113

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI
Sbjct: 1114 ATPPMKRFKDMEYLSGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYI 1173

Query: 1374 KER-TKNAQFIVISLRNNMFELAQQLVGIYK 1403
            +     + QFIVISL+N MFE +  LVG+++
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVFR 1204

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  141 bits (355), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 114/174 (65%), Gaps = 12/174 (6%)

Query: 1252 KRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDS 1302
            K  +V ++   +K+ R + F + F  +S ++ E+Y+ +T          GGNA L L D 
Sbjct: 1045 KEKKVNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDE 1104

Query: 1303 LDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1362
             +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD
Sbjct: 1105 DEPYLAGIRYHATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALD 1164

Query: 1363 FRNVSIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYK--NNNMTRSTTL 1413
              NV  VA+YI+ +   + QFIVISL+N MFE +Q LVG+++   NN +++ TL
Sbjct: 1165 ISNVERVASYIRRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTL 1218

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 103/235 (43%), Gaps = 35/235 (14%)

Query: 613 LQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEA----RSTLSNVENKNKV 668
           L+ E  +I K  D    E      KL E+++   S+  R  E     + TL+ +++ N V
Sbjct: 447 LEIEVQDITKSFDKKSHETSRTVKKLKELQSRAESNNNREYEINYKLKETLTKLDDMNAV 506

Query: 669 -------------LSALIRLQRSGRIAGFHGRLGDL-GTIDDMYDVAISTACPR-LDDIV 713
                        +S L RL       G  G + DL     + + VA+ST   +  D ++
Sbjct: 507 QRESAKEKKLRENVSMLRRL-----FPGVRGLVHDLCHPKKEKFAVAVSTVLGKNFDAVI 561

Query: 714 VDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNG-KFL 772
           VDN    QQC+  L+K + G   FI LD +   ++S +  P         + + +   + 
Sbjct: 562 VDNFLVAQQCVSFLKKQRSGVVSFIPLDTV---DVSKV--PMIASEFKGCILAIDAIDYE 616

Query: 773 P----AFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGGGT 822
           P    A   V  D+++   L+ A  + +    R ++V+++G ++  +G ++GG +
Sbjct: 617 PDLERAMQYVCSDSIICDTLQIAKDLKWKHNIRSKLVSINGSIVHRAGLMTGGAS 671

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  141 bits (355), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 110/170 (64%), Gaps = 12/170 (7%)

Query: 1256 VRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1306
            V +   ++++ R D F   F  +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1307 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1366
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1367 SIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYKN--NNMTRSTTL 1413
              +A YI++R   N QFIVISL+N MFE +Q LVG+++   +N +R+ TL
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score =  125 bits (313), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 177/738 (23%), Positives = 314/738 (42%), Gaps = 140/738 (18%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           + L+NFKSY G   IG   ++F++V+GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7   IELYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLI 66

Query: 215 HKSEAYPNLESCSVDIHFRYVVDESDGTTR---------SDDEKPPMVITRKAFRNNSSK 265
           ++      L+    D  +    D  +  +          S  E     +TR    +  S 
Sbjct: 67  YRG----TLQDGDADSGYSETHDNENNPSSAYVKAFYSPSGQENDVAELTRTITLSQEST 122

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y ++G+  ++ +    L  + I +  + FL+ QG+VE ++  KP+        L    E 
Sbjct: 123 YKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTLFEQ 175

Query: 326 IIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNS---LESGKDEAXXXXXXXX 382
           + G+ +YK   +    E++       E      L++  K +   L+S K+          
Sbjct: 176 VSGSIQYKQEYDRLREELEKARSATSE------LIQSRKRANIGLKSFKEGVNKDEEYRK 229

Query: 383 XXXXXXXXXAQYHIWQ------DQRKLSETLGKI--------SELNEH---LGQEKAKYD 425
                     Q  +WQ       +  L+E+L           SELN     + ++K  Y 
Sbjct: 230 HLEERNKLQQQLIVWQLFHLQAKRDSLTESLKSSQRELQSLDSELNSEEQIVAKKKLSYA 289

Query: 426 QFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDRE----KTSMEEKQRNLDKKRL 481
           + Q   A+ R R +D  K++  L      + S +  +D+      T +E  QR++D++  
Sbjct: 290 KKQTLAAKQRTRLSDKTKKVDHLTSSLLPIKSSKESIDKRLSAAVTKIESLQRDIDRQ-- 347

Query: 482 KAEKLLKSTENSMADSKHKLEELNNSQKQYKEKL---------LQLNESLLEERSKLDEI 532
             E L+K  E       H+L+ +N ++  ++ ++          +LNE+ L+    L E 
Sbjct: 348 --ESLVKQYE-------HQLKVVNKAKTNFQAEIDESAKSSGDFKLNEANLKRYEDLKET 398

Query: 533 KLS-----LRDK-------TSEISAEIANHERDLEP----WNAQLQEKKSQMKLTESQIA 576
            LS     L DK       + EIS EI  + R L+      N +L  +K  ++   S++ 
Sbjct: 399 FLSSGGSELEDKLLLEKNESQEISDEIELYSRQLDASRLKVNEELGAEKEALENEVSELT 458

Query: 577 ILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAI-HKLQCEQANILKRIDIGEKECGSAS 635
                K  +V   ++   E+++ AE NN +E  +  KL+                     
Sbjct: 459 KELSGKTSQVSAAVKKLKELQSRAEYNNNREYEVSFKLK--------------------- 497

Query: 636 SKLGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTID 695
             L ++ ++  + R+ A E R    NV       S L RL       G  G + +L    
Sbjct: 498 ETLTKLDDMNATQRETAKE-RKLRENV-------SILRRL-----FPGVRGLVHELCRPK 544

Query: 696 -DMYDVAISTACPR-LDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKL--RKFNLSPI 751
            + Y VA+ST   +  D ++VD+    QQC+  L+K + G   FI LD +   K ++  +
Sbjct: 545 KEKYTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMAL 604

Query: 752 QTP------ETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVV 804
            T       + +    DL R        A   V  D+++   L  A  + + +  R ++V
Sbjct: 605 DTKGCTLAIDAIDYERDLER--------AMQYVCSDSIICDSLAIAKDLKWRRNVRAKLV 656

Query: 805 TLDGKLIDTSGTLSGGGT 822
           +LDG ++  +G ++GG T
Sbjct: 657 SLDGSIVHKAGLMTGGTT 674

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  139 bits (351), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/209 (39%), Positives = 125/209 (59%), Gaps = 19/209 (9%)

Query: 1213 DELNHYVDNAHVDIDVLEEYAR---RLAEYKKRK--LDLNQAVLKRDEVRKNCEE---LK 1264
            +EL+  + N    +DVL+  AR   R  E ++R   +D     +K  E RK  ++   +K
Sbjct: 1005 NELDTKIKNVEDLLDVLQPNARAADRFTEAQERFEIIDGETEKIKTTE-RKALQQFLKIK 1063

Query: 1265 KKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVM 1315
            KKR + F   F  +S  L  +Y+ +T          GGNA L L D  +PF+ GV +   
Sbjct: 1064 KKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHAT 1123

Query: 1316 PPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKE 1375
            PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+ 
Sbjct: 1124 PPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRR 1183

Query: 1376 R-TKNAQFIVISLRNNMFELAQQLVGIYK 1403
                N QFIVISL+N MFE +  LVG+++
Sbjct: 1184 HGNPNLQFIVISLKNTMFEKSDALVGVFR 1212

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 105/206 (50%), Gaps = 16/206 (7%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L+NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R   + DLI
Sbjct: 7   LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 215 HK--------SEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKY 266
           ++        +  +  + S  V   +     +       DDE+ P+ + R    N  + Y
Sbjct: 67  YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDER-PVELMRAISTNGDTTY 125

Query: 267 YIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDI 326
            I+GK   Y E ++ L  + I +  K FL+ QG+VE I+   P         L +  E++
Sbjct: 126 KINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLFEEV 178

Query: 327 IGTAKYKAGIEAGLVEIDTLNDVCVE 352
            G+ +YK   +    +I+ LN    E
Sbjct: 179 SGSIQYKKEYDELKEQIEKLNQSAAE 204

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  139 bits (349), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 108/163 (66%), Gaps = 12/163 (7%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1313
            +KKKR + F + F  +S  ++ +Y+ +T          GGNA L L D  +PF  G+ + 
Sbjct: 1050 IKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYH 1109

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI
Sbjct: 1110 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYI 1169

Query: 1374 KERT-KNAQFIVISLRNNMFELAQQLVGIYKNN--NMTRSTTL 1413
            ++ +  + QFIVISL+N+MFE +  LVGI++    N +R  TL
Sbjct: 1170 RKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVVTL 1212

 Score =  125 bits (315), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 182/710 (25%), Positives = 326/710 (45%), Gaps = 98/710 (13%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7   LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 215 HKSEAYPNLESCSVDIHFRYVVD---ESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGK 271
           ++  A  +      D      V    E DGT         + + R       S Y ID K
Sbjct: 67  YRDIASADENEFGEDGERSAYVKAFYEKDGTV--------VELMRAITAGRDSVYKIDNK 118

Query: 272 ESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAK 331
            + Y   +  L  + I +  + FL+ QG+VE I+   P+        L +  E++ G+ K
Sbjct: 119 TTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPRQ-------LTKLFEEVSGSIK 171

Query: 332 YKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESG--KDEAXXXXXXXXXXXXXXX 389
           YK   E    +I+ L++   E       ++ E    E G  KDE                
Sbjct: 172 YKKEYEELKEKIEKLSESAAESAKNRRRIQGEMKIYEDGISKDEKYKKQLEVRDKLQVHL 231

Query: 390 XXAQ-YHIWQDQ----RKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQ 444
              Q +H+ Q++    +KL E   K+ +L + + +E+    + + EV  ++E     K+Q
Sbjct: 232 ALWQLFHLEQEEKLSTKKLKEVKNKVMKLTDQVNEEETNVKKAKNEV--IKETSLQMKQQ 289

Query: 445 MVKLD---KEHKDLTS------------KRRLMDREKTSMEEKQRNLDKKRL---KAEKL 486
             +LD   KE  +L S            ++RL + EK  +E   R++++++    + EK 
Sbjct: 290 N-RLDYKEKEKDNLLSELTPIQLSQRSAEKRLANIEK-RIESIARDMERQKTYVSRYEKQ 347

Query: 487 LKSTENSMADSKHKLEELNNSQKQYK-----EKLLQ-LNESLLEERSKLDEIKLSLRDKT 540
           LK  + +    + +L++ N++  +Y+      KL + LNE  L E     + KLSL    
Sbjct: 348 LKVVKKTKDTFEEELKQSNSNPDKYRLNDEDMKLYERLNEQYLTEGGFELDTKLSL---- 403

Query: 541 SEISAEIANHERDLEPWNAQLQEK--KSQMKLTESQIAILKESKEKKVQNIIQLKTEIEA 598
                 + N ++D++     LQ++   S+ ++T+ + A+  E+ E +    ++L +E+  
Sbjct: 404 ------LNNEKKDIDDELELLQKRIDMSKNRITD-EFAVKGENFELQA---VELSSELN- 452

Query: 599 FAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGE----MKNVLISHRQRAME 654
             EKN+        L    AN LK+I   + +  S S+K  E    +++ L+     +  
Sbjct: 453 --EKNS--------LHLNLANKLKKI---QSDIESTSNKEYELNHKLRDTLVKLDDASAN 499

Query: 655 ARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDL-GTIDDMYDVAISTACPR-LDDI 712
            R TL   + +  V S L R        G  G + DL     + Y +A+ST   +  D +
Sbjct: 500 QRETLKEKKLRENV-SMLKRF-----FPGVKGLVSDLCHPKKEKYALAVSTILGKNFDSV 553

Query: 713 VVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLS-PIQTPETVPRLFDLVRSKNGKF 771
           VVD +   Q+CI +L+K + G   FI LD +  F  + P    + +  + + +   + ++
Sbjct: 554 VVDTLSVAQECITYLKKQRAGIISFIPLDTIDAFVPTLPTTNIQGITLVLNAI-DYDQEY 612

Query: 772 LPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGG 820
             A   V  D+++   L  A  + +      ++VTL+G LI  +G ++GG
Sbjct: 613 DKAMQYVCSDSIMCDTLSIAKSLKWKHNVTSKLVTLEGTLIHRAGLMTGG 662

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 106/163 (65%), Gaps = 12/163 (7%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1313
            +KKKR + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1095 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKYH 1154

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1155 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1214

Query: 1374 -KERTKNAQFIVISLRNNMFELAQQLVGIYKNN--NMTRSTTL 1413
             + R  + QFIVISL+N MFE +  LVG+Y+    N +++ TL
Sbjct: 1215 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTVTL 1257

 Score =  134 bits (337), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 167/702 (23%), Positives = 319/702 (45%), Gaps = 73/702 (10%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 43  LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 215 HKSEA----YPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVI--TRKAFRNNSSKYYI 268
           ++         N++S + D       + +    ++  +K   ++  TR   RN  + Y I
Sbjct: 103 YRGVLDDGNDENIDSGADDNAI--TSNPNSAYVKAFYQKGNKLVELTRLISRNGDTTYKI 160

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           DGK   Y + +  L ++ I +  K FL+ QG+VE I+   P         L    E++ G
Sbjct: 161 DGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT-------DLSRMFEEVSG 213

Query: 329 TAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXX 388
           + +YK   +    +I+ L+    E       +  E  + + G ++               
Sbjct: 214 SIQYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVDKKNELQ 273

Query: 389 XXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYD----QFQREVAQLRERCNDFKKQ 444
              A + ++  ++K  E   K+S  N  +   K + +      QR  +   +      KQ
Sbjct: 274 KFQALWKLYHLEQKKEELTDKLSASNSEIMSLKERINNETKSLQRSKSSFVKESTVISKQ 333

Query: 445 MVKLD---KEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKL 501
             KLD   K+ + L S  RL+   + +   +  +++K+    ++ L+  E+ +   + +L
Sbjct: 334 KSKLDYIVKDKEKLMSDLRLIKVPQQAAGRRISHIEKRIGSLQRDLERQESYVERFETQL 393

Query: 502 EELNNSQKQYKEKL---------LQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHER 552
           + +  S+K ++E++          +LNES L+    L E  L+      E    ++N+++
Sbjct: 394 KVITKSKKTFEEEIKESARNYDKFKLNESDLKTYDSLHEKYLTQGGSILEEKISLSNNDK 453

Query: 553 -----DLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQE 607
                +L+ +N +     S+ ++TE ++ I  E  + ++ ++        +  EKN    
Sbjct: 454 QEIVDELDRFNKRAD--ISKRRITE-ELFITGEKLDTQLNDLRA------SLNEKN---- 500

Query: 608 IAIHKLQCEQANILKRIDIGEKECGSASSKLG-EMKNVLISHRQRAMEARSTLSNVENKN 666
            A+H    E+ N LK++    +   +    L  +++  L+     +   R T+     + 
Sbjct: 501 -ALH---TERLNELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRETMK----ER 552

Query: 667 KVLSALIRLQRSGRIAGFHGRLGDL-GTIDDMYDVAISTACPR-LDDIVVDNVECGQQCI 724
           K+   +  L+R     G  G + DL     + Y +A+ST   R  D ++V+N+   Q+CI
Sbjct: 553 KLRENIAMLKRF--FPGVKGLVHDLCHPKKEKYGLAVSTILGRNFDSVIVENLTVAQECI 610

Query: 725 EHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNG-----KFLPAFYSVL 779
             L+K + G A FI LD +    L  +  P++     D + S N      ++  A   V 
Sbjct: 611 AFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQ----DYILSINAIDYEPEYEKAMQYVC 665

Query: 780 RDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGG 820
            D+++ + L  A  + + K  R ++VT++G LI  +G ++GG
Sbjct: 666 GDSIICNTLNIAKDLKWKKGVRAKLVTIEGALIHKAGLMTGG 707

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 103/161 (63%), Gaps = 10/161 (6%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1313
            +K+KR + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1061 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1120

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1121 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1180

Query: 1374 -KERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTL 1413
             + R  + QFIVISL+N MFE +  LVG+Y+      S T+
Sbjct: 1181 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTI 1221

 Score =  127 bits (320), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 167/709 (23%), Positives = 311/709 (43%), Gaps = 85/709 (11%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 215 HKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAF--------------- 259
           ++      L   + + +      + D TT +     P     KAF               
Sbjct: 67  YRG----ILNDGNDNDNDDDSASDDDATTSN-----PKSAYVKAFYQKGNKLVELMRIIS 117

Query: 260 RNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGL 319
           RN  + Y IDGK  +Y + +  L ++ I +  K FL+ QG+VE I+   P         L
Sbjct: 118 RNGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------L 170

Query: 320 LEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXX 379
            +  E++ G+ +YK   +    +I+ L     E       +  E  + + G ++      
Sbjct: 171 SKMFEEVSGSIQYKKEYDELKEKIEKLGKSATESIKNRRRIHGELKTYKEGINKNEEYIK 230

Query: 380 XXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYD----QFQREVAQLR 435
                       A + ++  +++  E + K+S  N  +   K K +      QR  +   
Sbjct: 231 QVDKKNELQRFQALWQLYHLEQQKEELMDKLSASNSEVSSLKEKINNEMKSLQRSKSSFV 290

Query: 436 ERCNDFKKQMVKLD---KEHKDLTSKRRLMDREKTS-----------MEEKQRNLDKKRL 481
           +      KQ  KL+   K+ + L S  RL+   + +           +E  QR+L ++  
Sbjct: 291 KEGTIISKQKSKLEYIVKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQRDLGRQEA 350

Query: 482 KAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTS 541
             E+     +      K   EE+  S + Y++   +LNE+ L+    L E  L+      
Sbjct: 351 YVERFETQLKVVTKSKKTFEEEIKESARNYEK--FKLNENDLKTYDLLHEKYLTQGGSVL 408

Query: 542 EISAEIANHER-----DLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEI 596
           E    ++N+ +     +L+ +N +     S+ ++TE ++ I  E  + ++ ++       
Sbjct: 409 EEKISLSNNHKQEILDELDRFNKRAD--ISKRRITE-ELLITGEKLDTQLNDLRA----- 460

Query: 597 EAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLG-EMKNVLISHRQRAMEA 655
            +  EKN     A+H    E+ N LK++    +   +    L  +++  L+     +   
Sbjct: 461 -SLNEKN-----ALH---TERLNQLKKLQSDIESANNKEYDLNFKLRETLVKIDDLSANQ 511

Query: 656 RSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDL-GTIDDMYDVAISTACPR-LDDIV 713
           R T+     + K+   +  L+R     G  G + DL     + Y +A+ST   R  D ++
Sbjct: 512 RETMK----ERKLRENIAMLKRF--FPGVKGLVHDLCHPKKEKYGLAVSTILGRNFDSVI 565

Query: 714 VDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDL-VRSKNGKFL 772
           V+N+   Q+CI  L+K + G A FI LD +   +L  +  P++   +  +     + ++ 
Sbjct: 566 VENLTVAQECIAFLKKQRAGTASFIPLDTIET-DLPTLSLPDSQDYILSINAIDYDSEYE 624

Query: 773 PAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGG 820
            A   V  D+++ + L  A  + + K  R ++VT++G LI  +G ++GG
Sbjct: 625 KAMQYVCGDSIICNTLNIAKDLKWKKSVRAKLVTIEGALIHKAGLMTGG 673

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  136 bits (343), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 129/224 (57%), Gaps = 12/224 (5%)

Query: 1191 GLPK-FSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQA 1249
            GLPK + E    S + E +E +I E+   ++    +   LE Y      ++    +  Q 
Sbjct: 984  GLPKKYKENNTDSARKE-LEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETEQL 1042

Query: 1250 VLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELV 1300
              +  ++     ++KKKR + F + F  +S  L  +Y+ +T          GGNA L + 
Sbjct: 1043 KAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIE 1102

Query: 1301 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA 1360
            D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAA
Sbjct: 1103 DEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAA 1162

Query: 1361 LDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYK 1403
            LD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+
Sbjct: 1163 LDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYR 1206

 Score =  129 bits (324), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 177/724 (24%), Positives = 317/724 (43%), Gaps = 120/724 (16%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 215 HK-------SEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVI--TRKAFRNNSSK 265
           ++       S+ Y N  + S +    YV        ++  +K   ++   R   RN  + 
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYV--------KAFYQKGNKLVELMRIISRNGDTS 118

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y IDGK  +Y + +  L ++ I +  K FL+ QG+VE I+   P         L    E+
Sbjct: 119 YKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVE-------LSRMFEE 171

Query: 326 IIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXX 385
           + G+ +YK   E    +I+ L+    E       +  E  + + G ++            
Sbjct: 172 VSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKN 231

Query: 386 XXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYD----QFQREVAQLRERCNDF 441
                 A + ++  +++  E   K+S LN  +   K K +      QR  +   +     
Sbjct: 232 ELQKFQALWQLYHLEQQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKESAVI 291

Query: 442 KKQMVKLDKEHKD---LTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSK 498
            KQ  KLD   KD   L S  RL+   + +  ++  +++K+    +K L+  +  +   +
Sbjct: 292 SKQKSKLDYIFKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQKDLQRQKTYVERFE 351

Query: 499 HKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWN 558
            +L+ +  S++ ++E++ Q            D+ KL               +E DL+ +N
Sbjct: 352 TQLKVVTRSKEAFEEEIKQ-------SARNYDKFKL---------------NENDLKTYN 389

Query: 559 AQLQEK--KSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCE 616
             L EK       + E +IA+L   K        +++ E+E F ++ ++ +  I     E
Sbjct: 390 C-LHEKYLTEGGSILEEKIAVLNNDKR-------EIQEELERFNKRADISKRRI----TE 437

Query: 617 QANILKRIDIGEK---ECGSASSKLGEMKNVLISHRQRAMEARSTLSNVENKN------- 666
           + +I      GEK   +       L E KN L  H +R  E +   S++E+ N       
Sbjct: 438 ELSI-----TGEKLDTQLNDLRVSLNE-KNAL--HTERLHELKKLQSDIESANNQEYDLN 489

Query: 667 -KVLSALIRL------------QRSGR---------IAGFHGRLGDL-GTIDDMYDVAIS 703
            K+   L+++            +R  R           G  G + DL     + Y +A+S
Sbjct: 490 FKLRETLVKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVS 549

Query: 704 TACPR-LDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFD 762
           T   +  D ++V+N+   Q+CI  L+K + G A FI LD +    L  +  P++     D
Sbjct: 550 TILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQ----D 604

Query: 763 LVRSKNG-----KFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGT 816
            + S N      ++  A   V  D+++ + L  A  + + K  R ++VT++G LI  +G 
Sbjct: 605 YILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIHKAGL 664

Query: 817 LSGG 820
           ++GG
Sbjct: 665 MTGG 668

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 107/167 (64%), Gaps = 14/167 (8%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1313
            +KK+R + F + F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1374 KER-TKNAQFIVISLRNNMFELAQQLVGIYK----NNNMTRSTTLQN 1415
            +     N QFIVISL+N MFE +  LVG+Y+    N++   +  LQN
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTLNLQN 1220

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 97/185 (52%), Gaps = 20/185 (10%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L+NFKSY G+  +G   ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 215 HK----SEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVI--TRKAFRNNSSKYYI 268
           ++     E   + E  SV+       + S    ++  EK    I   R   RN  + Y I
Sbjct: 67  YRGVITGEDSESDEDGSVN-------NPSTAYVKAFYEKENKTIELMRTISRNGDTNYKI 119

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
            GK  +Y + +  L  + I +  K FL+ QG+VE I+   P         L    E++ G
Sbjct: 120 GGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM-------DLSRLFEEVSG 172

Query: 329 TAKYK 333
           + +YK
Sbjct: 173 SIQYK 177

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/171 (42%), Positives = 111/171 (64%), Gaps = 14/171 (8%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1313
            +KKKR + F + F  ++  +  +Y+ +T          GGNA L L D  +P++ GV + 
Sbjct: 1052 IKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYH 1111

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI
Sbjct: 1112 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYI 1171

Query: 1374 KERTKNA--QFIVISLRNNMFELAQQLVGIYKNN--NMTRSTTLQNIDILN 1420
             +R  N   QFIVISL+N+MFE ++ LVGIY++   N +R  TL   + +N
Sbjct: 1172 -QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQKENSSRIITLNLTNYVN 1221

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 176/712 (24%), Positives = 307/712 (43%), Gaps = 100/712 (14%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L+NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 215 HKSEAYPNLESCS---VDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGK 271
           ++     + E  +   V+ +  YV            E     + R    +  S Y I+ K
Sbjct: 67  YRGFLSGDDEDNNNEDVNPNSAYV------KAFYQKEDVTHELMRSISNSGDSTYKINNK 120

Query: 272 ESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAK 331
             +Y + T  L D+ I +  K FL+ QG+VE I+        +S   L +  E++ G+ +
Sbjct: 121 TVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIAS-------QSTTDLTKLFEEVSGSIQ 173

Query: 332 YKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESG--KDEAXXXXXXXXXXXXXXX 389
           YK   E    +++ L+    E       +  E    + G  KDE                
Sbjct: 174 YKKEYEELKEKVEKLSQSTAESIKNRRRINNEIKVYKDGITKDEKYKAQLEKRRNLLVYS 233

Query: 390 XXAQ-YHI----WQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQ 444
              Q YH+     Q + KL E   K+S+L E L  E+    + +  + +       +K +
Sbjct: 234 SLWQLYHLDEKKSQSKNKLKEAKSKVSKLKEKLANEEKILQKAKNSIVKDTAAITKYKNK 293

Query: 445 MVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEEL 504
           +    KE + L S+          ++  QRN  KK    E+ ++  E  +   K  +E  
Sbjct: 294 LEYRSKEKEKLASQL-------IPIKVSQRNTTKKISNIERRIEGIERDIERQKSYVERY 346

Query: 505 NNSQK---QYKEKL-LQLNESLLE-ERSKLDEIKLSLRDKTSE--ISAEIANHERDLEPW 557
            +  K   + KE   L++ ES    ++ +L +  L   D  SE  +S+   + +  +   
Sbjct: 347 ESQLKVVTKSKESFELEIKESAKNFDKYRLSDEDLVTYDALSEKYLSSGGFDIDTKISLL 406

Query: 558 NAQLQEKKSQMKLTESQIAILKESKEKKVQNII----QLKTEI----EAFAEKNNVQEIA 609
           N   QE   ++ + +++I +   +K K   +++    +L+ EI     +  EKN++    
Sbjct: 407 NNDKQETSDEVAMFKNRIEL---AKSKIADDLVLQGERLELEISELTSSLNEKNSLHSQK 463

Query: 610 IHKLQCEQANIL----KRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLSNVENK 665
           + +L+  Q  I     K  D+  K        L ++ ++  S R+   E R    NV   
Sbjct: 464 VSELKTLQGEIESTSNKEYDLNYK----LRETLVKLDDLSASQRESTNE-RKLRENV--- 515

Query: 666 NKVLSALIRLQRSGRIAGFHGRLGDLGTI-DDMYDVAISTACPR-LDDIVVDNVECGQQC 723
               S L RL       G  G + DL     + Y +A+ST   +  D I+ DN+   Q+C
Sbjct: 516 ----SMLRRL-----FPGVRGLVSDLCQPKKEKYALAVSTILGKNFDSIITDNISVAQEC 566

Query: 724 IEHLRKNKLGYARFIILDKLRK--------------FNLSPIQTPETVPRLFDLVRSKNG 769
           I +L+K + G A FI L+ +                  ++ I+      R    V S   
Sbjct: 567 IAYLKKQRAGVASFIPLESIESEVPTLPFSDGQGCILTINAIEYEPEYERAMQYVCSD-- 624

Query: 770 KFLPAFYSVLRDTLVVS-DLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGG 820
                  S++ DTL ++ DLK  + V     + ++VTL+G LI  +G ++GG
Sbjct: 625 -------SIICDTLTIAKDLKWKHNV-----KSKLVTLEGALIHKAGLMTGG 664

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  135 bits (341), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 100/151 (66%), Gaps = 10/151 (6%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1313
            +K+KR + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1059 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1118

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1178

Query: 1374 -KERTKNAQFIVISLRNNMFELAQQLVGIYK 1403
             + R  + QFIVISL+N MFE +  LVG+Y+
Sbjct: 1179 RRHRNPDLQFIVISLKNTMFEKSDALVGVYR 1209

 Score =  129 bits (325), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 171/697 (24%), Positives = 309/697 (44%), Gaps = 63/697 (9%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 215 HKSEAYPNLESCSVDIHFRYVVDES--DGTTRSDDEKP-PMV-ITRKAFRNNSSKYYIDG 270
           ++     + +    D     V   +      ++  +K   MV + R   RN  + Y ID 
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 271 KESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTA 330
           K  +Y + +  L ++ I +  K FL+ QG+VE I+   P         L    E++ G+ 
Sbjct: 127 KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFEEVSGSI 179

Query: 331 KYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESG--KDEAXXXXXXXXXXXXXX 388
           +YK   +    +I+ L+    E       +  E  + + G  K+E               
Sbjct: 180 QYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVEKKSELQKF 239

Query: 389 XXXAQ-YHIWQDQRKLSETL----GKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKK 443
               Q YH+ Q + +L++ L     +IS L E +  E       QR  +   +      K
Sbjct: 240 QALWQLYHLEQQKEELTDKLSASNSEISSLKEKINHE---MKSLQRSKSSFVKESAVISK 296

Query: 444 QMVKLD---KEHKDLTSKRRLMDREKTS-----------MEEKQRNLDKKRLKAEKLLKS 489
           Q  KL+   K+ + L S  RL+   + +           +E  QR+L +++   E+    
Sbjct: 297 QKSKLNYIIKDKEKLVSDLRLIKVPQQAAGKRVLHIEKRIESLQRDLQRQKAYVERFETQ 356

Query: 490 TENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIAN 549
            +      K   EE+  S + Y +   +LNE+ LE  + L E  L+  +  S +  +IA 
Sbjct: 357 LKVVTKSKKTFEEEIKESARNYDK--FKLNENDLETYNCLHEKYLT--ENGSILEEKIAL 412

Query: 550 HERDLEPWNAQLQEKKSQMKLTESQIA-ILKESKEKKVQNIIQLKTEIEAFAEKNNVQEI 608
           +  D +    +L     +  +++ +I   L  + EK    +  L+    +  EKN V   
Sbjct: 413 YNNDKQEIQEELDRFNKRADISKRRITEELSVTGEKLDTQLNDLRA---SLNEKNAVHTE 469

Query: 609 AIHKLQCEQANILKRIDIGEKECGSASSKLG-EMKNVLISHRQRAMEARSTLSNVENKNK 667
            +H+L+  Q++I        +   +    L  +++  L+     +   R T+     + K
Sbjct: 470 RLHELKKLQSDI--------ESANNQEYDLNFKLRETLVKIDDLSANQRETMK----ERK 517

Query: 668 VLSALIRLQRSGRIAGFHGRLGDL-GTIDDMYDVAISTACPR-LDDIVVDNVECGQQCIE 725
           +   +  L+R     G  G + DL     + Y +A+ST   +  D ++V+N+   Q+CI 
Sbjct: 518 LRENIAMLKRF--FPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIA 575

Query: 726 HLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDL-VRSKNGKFLPAFYSVLRDTLV 784
            L+K + G A FI LD +    L  +  P++   +  +       ++  A   V  D+++
Sbjct: 576 FLKKQRAGTASFIPLDTIET-ELPTLSLPDSQEYILSINAIDYEPEYEKAMQYVCGDSII 634

Query: 785 VSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGG 820
            + LK A  + + K  R ++VT++G LI  +G ++GG
Sbjct: 635 CNSLKIAKGLKWNKGVRAKLVTIEGALIHKAGLMTGG 671

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  135 bits (341), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 99/151 (65%), Gaps = 10/151 (6%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1313
            +KK+R + F   F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYH 1113

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
             MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1114 AMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1173

Query: 1374 KER-TKNAQFIVISLRNNMFELAQQLVGIYK 1403
            +     + QFIVISL+N MFE +  LVG+Y+
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVYR 1204

 Score =  125 bits (314), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 181/727 (24%), Positives = 315/727 (43%), Gaps = 128/727 (17%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L NFKSY G   IG   ++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 215 HKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFR-------------- 260
           ++                  + D S+      +E+ P     KAF               
Sbjct: 67  YRG----------------VIRDFSEEDPEDGEEQHPTSAYVKAFYEMDGKVVELMRTIN 110

Query: 261 -NNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGL 319
            N  + Y ID K  +Y +    L  + I +  K FL+ QG+VE I+        +S   L
Sbjct: 111 INGDTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIAS-------QSALDL 163

Query: 320 LEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESG--KDEAXXX 377
            +  E+I G+ +YK   ++   E++ L     E       +  E  + + G  KDE    
Sbjct: 164 SKLFEEISGSIQYKKEYDSLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISKDE---- 219

Query: 378 XXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRER 437
                          +Y ++        TL K+  L+    Q K K  Q + E+++L+E+
Sbjct: 220 -----EYKNNVEKKKKYEMYF-------TLWKLFHLDAQRIQFKDKLKQAKTEMSKLKEK 267

Query: 438 CNDFKKQMVK----LDKEHKDLTSKRRLMDREKTSMEEKQR-----NLDKKRLKA-EKLL 487
            N+ +K + +      KE+  LT KR  +D    +++EK++     N  K  L+A  K +
Sbjct: 268 INNEEKHLTRSKSAFLKENSILTKKRSQLD---YTVKEKEKVISQCNSIKIPLRASSKRI 324

Query: 488 KSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEI 547
            + E  +   K  +E   +    ++ +L      ++ +  +L E+         EI    
Sbjct: 325 MNIEKRIESFKRDIERQKDYVSTFENQL-----KVVTKAKELFEV---------EIKKSA 370

Query: 548 ANHER------DLEPWNAQLQEK--KSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAF 599
            NH++      DL+ W  QL EK   +   L E +I++L   K++K   +  L   I+  
Sbjct: 371 RNHDKFRLTDTDLK-WYEQLNEKYLSTGGSLLEQKISLLNNDKQEKTDEMELLNRHID-- 427

Query: 600 AEKNNVQE---IAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAME-- 654
             KN V E   I    LQ +  ++   ++           KL + +  + S   +  +  
Sbjct: 428 VSKNRVTEELNITGENLQNQVTDMTSTLNEKNATYAEQMKKLKDYQMQVESSNNQEYDLN 487

Query: 655 --ARSTLSNVEN----------KNKVLSALIRLQRSGRIAGFHGRLGDLGTI-DDMYDVA 701
              R TL  +++          + K+   +  L+R     G  G + DL     + Y +A
Sbjct: 488 YKLRETLVKLDDLSANQRESLKEKKLRENVTMLKRF--FPGVKGLVHDLCRPKKEKYGLA 545

Query: 702 ISTACPR-LDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKL--RKFNLSPIQTPETVP 758
           +S    +  D I+V+N+   ++CI  L+K + G A FI LD +   +  LS   + E + 
Sbjct: 546 VSVMLGKNFDSIIVENLSVARECISFLKKQRAGTASFIPLDTIDSEQPTLSAPPSQEYIL 605

Query: 759 RL----FDLVRSKNGKFLPAFYSVLRDTL-VVSDLKQANRVAYGKRRFRVVTLDGKLIDT 813
            +    +DL   +  +++    S++ DTL +  DLK    V     R ++V+LDG LI  
Sbjct: 606 TINAIEYDLAYERAMQYVCG-DSIICDTLDIARDLKWNRGV-----RSKLVSLDGSLIHK 659

Query: 814 SGTLSGG 820
           +G ++GG
Sbjct: 660 AGLMTGG 666

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 104/162 (64%), Gaps = 12/162 (7%)

Query: 1264 KKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSV 1314
            KKKR + F   F  +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +  
Sbjct: 1058 KKKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHA 1117

Query: 1315 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI- 1373
             PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI 
Sbjct: 1118 TPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIR 1177

Query: 1374 KERTKNAQFIVISLRNNMFELAQQLVGIYKNN--NMTRSTTL 1413
            K    + QFIVISL+N+MFE +  LVG+Y+    N +R  TL
Sbjct: 1178 KHGNPSLQFIVISLKNSMFEKSDALVGVYRRQQENSSRLVTL 1219

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 97/184 (52%), Gaps = 17/184 (9%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L+NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R   ++DLI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 215 HKS----EAYPNLESCSVDIHFRYV-VDESDGTTRSDDEKPPMVITRKAFRNNSSKYYID 269
           ++     E          D H  YV    S G   S  E     + R   +N  S Y ID
Sbjct: 67  YRGVVPEEEDDGEGEGDGDAHRAYVSAFYSKGPQESTVE-----LKRTISKNGDSTYQID 121

Query: 270 GKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGT 329
            ++  Y + ++ L  Q I +  K FL+ QG+VE ++   P         L +  E++ G+
Sbjct: 122 RRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKLFEEVSGS 174

Query: 330 AKYK 333
           A+YK
Sbjct: 175 AQYK 178

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1217

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 165/690 (23%), Positives = 314/690 (45%), Gaps = 60/690 (8%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L+NFKSY GT  +G   ++F +++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 215 HKS--EAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKE 272
           ++         +      + +    +SD T           ++R   RN  ++Y ++GK 
Sbjct: 67  YRGVEGEEDEEDGEGRTAYVKAFYLKSDSTVE---------LSRSISRNGDTQYKMNGKN 117

Query: 273 SNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKY 332
             Y +  + L ++ I +  + FL+ QG+V  I+        +S   L +  E+I G+ +Y
Sbjct: 118 CGYKQYAEFLEEENILIKAQNFLVFQGDVVQIAS-------QSATDLTKLFEEISGSIQY 170

Query: 333 KAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXXXXA 392
           K   ++   ++D+LN    E       +  E  S   G D+                  A
Sbjct: 171 KKEYDSLKGKVDSLNQSAAESIKNRRRIHGELKSYREGIDKNQEFYHQVEKRKELQRHYA 230

Query: 393 QYHIWQDQRKLSETLGKISELNEHL----GQEKAKYDQFQREVAQLRERCNDFKKQMVKL 448
            + ++  + +  E   K++ L   +    G+E ++    QR  A          KQ  K+
Sbjct: 231 LWQLYHLETQRHELEDKLANLKNSIKTIRGKETSQEQILQRSRASFARESASILKQRSKM 290

Query: 449 DKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQ 508
           + + ++    +  ++++   ++  QR+  K+    +K + S +  +   +  +E   N Q
Sbjct: 291 ESKSRE----KEKINQQLLPIKLSQRSAAKRIANVQKRISSLQRDIDRQREYVERFEN-Q 345

Query: 509 KQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQM 568
                K     E  ++E SK D  K  L +  +++ A +  +E+ L      L+ +K Q+
Sbjct: 346 LNVVTKAKSDFEKEIKESSK-DHDKYKLNEDDTKLYASL--NEKYLNQGGFSLESQK-QL 401

Query: 569 KLTESQIAILKESKEKKVQNII---QLKTEIEAFAEK--NNVQEIA--IHKLQCEQANIL 621
            L + Q  ++ E +  K +N I   ++  E+   AEK  + + EI+  +++     ++ +
Sbjct: 402 TLNDKQ-ELMDEMETLKKRNDISRSRVTDELSVIAEKLESQLSEISSTLNERNSTHSDKV 460

Query: 622 KRIDIGEKECGSASSKLGE----MKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQR 677
           K +     +  S+S+K  +    ++ VL+   + +   R T+     + K+   +  L+R
Sbjct: 461 KELQKLHSQIESSSNKEYDLNYKLREVLVKIEELSASQRETV----KERKLRENIATLKR 516

Query: 678 SGRIAGFHGRLGDLGTI-DDMYDVAISTACPR-LDDIVVDNVECGQQCIEHLRKNKLGYA 735
                G  G + DL     D Y +AIST   +  D ++VDNV   Q+CI +L+K + G A
Sbjct: 517 F--FPGVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQECIAYLKKQRAGIA 574

Query: 736 RFIILD----KLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQA 791
            FI LD    ++    LS  Q         D  +    ++  A   V  D+++  D+  A
Sbjct: 575 SFIPLDTIDVEIPTLTLSDSQGCTLAINAIDYEQ----EYERALQYVCSDSIICDDMNIA 630

Query: 792 NRVAYGKR-RFRVVTLDGKLIDTSGTLSGG 820
             + + K  R ++VTL+G LI  +G ++GG
Sbjct: 631 KDLKWNKGVRSKLVTLEGALIHKAGLMTGG 660

 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 146/267 (54%), Gaps = 28/267 (10%)

Query: 1172 TDGEIDSMDIDEYENET----------SNGLP-KFSEAQLQSIQIEDVELQIDELNHYVD 1220
            +D ++D + ID  + ET           + LP K+ E+  ++I+ ED E  I      ++
Sbjct: 947  SDTDLDQLPIDRIDEETIAIAHEIEIDFHELPAKYKESGAETIR-EDFEKSIKHAEDILN 1005

Query: 1221 NAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNCE--ELKKKRLDKFMEGFSII 1278
            +   +    E ++   A+ K   +D     LK +E R   +  ++KKKR   F   F   
Sbjct: 1006 DLQPNAKANERFSE--AQNKFEAIDYETEELKSEEKRVIAQFLKIKKKRKALFERAFEYA 1063

Query: 1279 SMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSG 1329
            S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K ++++  LSG
Sbjct: 1064 SEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYHATPPFKRFKDMEYLSG 1123

Query: 1330 GEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLR 1388
            GEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI +   ++ QFIVISL+
Sbjct: 1124 GEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYISRHGNRDLQFIVISLK 1183

Query: 1389 NNMFELAQQLVGIYKNN--NMTRSTTL 1413
            N MFE +  LVG+Y+    N ++  TL
Sbjct: 1184 NTMFEKSDALVGVYRQQQENSSKIVTL 1210

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  134 bits (337), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 114/174 (65%), Gaps = 12/174 (6%)

Query: 1252 KRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDS 1302
            K  ++R+   ++K+ R + F + ++ +S  + ++Y+ +T          GG+A L L D 
Sbjct: 1048 KEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDE 1107

Query: 1303 LDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1362
             +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1108 DEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALD 1167

Query: 1363 FRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKNN--NMTRSTTL 1413
              NV  +A YIK   + N QFIVISL+N+MFE +Q LVG+++    N ++  TL
Sbjct: 1168 NTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVITL 1221

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 99/203 (48%), Gaps = 27/203 (13%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L NFKSY GT  +G    +F++++GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 215 HKSEAYPNLESCSVDIHFR---------YVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
           ++     + E    +             YV          + E+ P+   R   R+  S 
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYV----KAFYLKEGEESPIEFMRTISRSGESA 122

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y ++GK   Y + T +L  + I +  + FL+ QG+VE I+        +S   L +  E 
Sbjct: 123 YKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIAS-------QSAGELTKLFEQ 175

Query: 326 IIGTAKYKAGIEAGLVEIDTLND 348
           I G+ +YK        E + LND
Sbjct: 176 ISGSVQYKR-------EYEILND 191

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  134 bits (336), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 128/213 (60%), Gaps = 21/213 (9%)

Query: 1226 IDVLEEYARRLAEYKKRKLDLNQAVLK----RDEVRKNCE---ELKKKRLDKFMEGFSII 1278
            +++L+  ++ +  Y + K  L+Q   +    R++ RK  E   E+K KR + F   F  +
Sbjct: 1029 LEILQPNSKAVQRYDETKHKLDQVSNENERLRNKERKAKEKFLEVKAKRKELFEACFKHV 1088

Query: 1279 SMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSG 1329
               + ++Y+ +T          GGNA L + +  +P+  G+ +   PP K ++++  LSG
Sbjct: 1089 DKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRFKDMEYLSG 1148

Query: 1330 GEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTK-NAQFIVISLR 1388
            GEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     NAQFIVISL+
Sbjct: 1149 GEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQFIVISLK 1208

Query: 1389 NNMFELAQQLVGIYK----NNNMTRSTTLQNID 1417
            N MFE +Q LVGI++    N++   S  L+N D
Sbjct: 1209 NAMFEKSQSLVGIFREQEDNSSRMVSLNLENYD 1241

 Score =  125 bits (315), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 167/717 (23%), Positives = 321/717 (44%), Gaps = 88/717 (12%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L LHNFKSY  T  +G   + F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 215 HK----------------------SEAYP-NLESCSVDIHFRYVVDESDGTTRSDDEKPP 251
           ++                      SEA P N      +    YV        + DD   P
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYV----SCVYQKDDLDEP 122

Query: 252 MVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKA 311
              TR    +  S Y I+ +  +Y +  + L  + I +  K FL+ QG+VE I+   P++
Sbjct: 123 TKFTRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPES 182

Query: 312 ERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESG- 370
                  L   LE + G+  YK   E    E         +  N  + V+ +  S + G 
Sbjct: 183 -------LTLLLEQVSGSINYKNDYEKLKEEHKLALAEFTDAHNSRKKVQNDLKSFKEGV 235

Query: 371 -KDEAXXXXXXXXXXXXXXXXXAQ-YHIWQDQRKLSETL----GKISELNEHLGQEKAKY 424
            +DE                   + +HI + ++KL ++L     + + L   L  E+   
Sbjct: 236 QRDEQYRTSLEIRDQLKHNFILWELFHILKRRKKLVDSLTVSKTETTALKNKLSDEERIL 295

Query: 425 DQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAE 484
            + +   A+   + +  K  +V+L+ E   L S    +  E+ +  ++  NL+K+    +
Sbjct: 296 TKIKSTTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIKRIHNLEKRISSFK 355

Query: 485 KLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRD-KTSEI 543
           K ++  +  +   +++L+ ++ ++K ++++L  ++       + L++  LS  D K  E+
Sbjct: 356 KDMERQQAYVKQFENQLKVVSKTKKSFEKELENIH-------ANLNKFNLSEEDLKQYEL 408

Query: 544 SAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKN 603
                  E+ L    + ++EK + +K  E ++     ++E ++ N  +LKT  E  +++ 
Sbjct: 409 LK-----EKYLSSGGSHIEEKLAILKNDEFEL-----NEESELIN-KRLKTTRERISDE- 456

Query: 604 NVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLSNVE 663
              ++ +  L+ +   + +R++       + S +   ++  L S + +  E   +L +V 
Sbjct: 457 --LQVDVDALEADLNEVTQRLNDKNSIAAAKSKEWKGIQTNLESLKNKEYELNFSLRDVL 514

Query: 664 NKNKVLSALIRLQRSGR------------IAGFHGRLGDL-GTIDDMYDVAISTACPR-L 709
            K   L+A  R  +  R              G  G + DL     + Y +A+ST   +  
Sbjct: 515 LKIDDLNADQRETKKERKLRENVSMLKRLYPGVKGLVHDLCHPKKEKYAIAVSTILGKNF 574

Query: 710 DDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKN- 768
           D I+VD++    +CI +L+K + G A FI LD +   +++P   P  V  +   + + N 
Sbjct: 575 DSIIVDSIATAHECITYLKKQRAGSASFIPLDTI---DVNPPSLP--VSNVQGCLLTINA 629

Query: 769 ----GKFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGG 820
               G    A   V  D+++  +L  A  + + +  + ++VTL+G LI  +G ++GG
Sbjct: 630 IEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIHKAGQMTGG 686

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  132 bits (333), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 106/172 (61%), Gaps = 12/172 (6%)

Query: 1251 LKRDE--VRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELEL 1299
            LK+DE  V     ++K+KR   F E F  ++  +  +Y+ +T          GG+A L L
Sbjct: 1039 LKKDEKKVLAQFIKIKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTL 1098

Query: 1300 VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDA 1359
             D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DA
Sbjct: 1099 EDEDEPFNAGIRYHATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDA 1158

Query: 1360 ALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRS 1410
            ALD  NV  VA YI+     + QFIVISL+N MFE +  LVG+Y+   +  S
Sbjct: 1159 ALDTTNVERVATYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTS 1210

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 92/194 (47%), Gaps = 39/194 (20%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L LHNFKSY GT  +G   ++F++++GPNGSGKSN++D++ FV G R+  +R   L DLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 215 HKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAF--------------- 259
                            +R V  E +G   SD    P     KAF               
Sbjct: 67  -----------------YRGVASEEEGDGESDVVNNPTTAYVKAFYSKGDSTIELSRSIS 109

Query: 260 RNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGL 319
           +   + Y ++GK  +Y      L D+ I +  K FL+ QG+V  I+        +S   L
Sbjct: 110 KGGDTTYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIAS-------QSAMEL 162

Query: 320 LEYLEDIIGTAKYK 333
            ++ E+  G+ +YK
Sbjct: 163 TQFFEEFSGSIQYK 176

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  129 bits (324), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 105/163 (64%), Gaps = 12/163 (7%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1313
            +KKKR + F   F  ++  ++ +Y+ +T          GG A L L D  +PF+ GV + 
Sbjct: 1063 IKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKYH 1122

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1123 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAYI 1182

Query: 1374 -KERTKNAQFIVISLRNNMFELAQQLVGIYK--NNNMTRSTTL 1413
             K   K+ QFI+ISL+N MFE +  LVG+++    N +++ TL
Sbjct: 1183 RKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKALTL 1225

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 96/182 (52%), Gaps = 19/182 (10%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L NFKSY GT  IG   ++F++++GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 215 HKS---EAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGK 271
           H+S       N +  S  +   Y V ++   T          + R    +  + Y I+GK
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFYKVTDASEITE---------LMRIVNLSGETIYKINGK 117

Query: 272 ESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAK 331
            +++   +  L  + I +  K FL+ QG+VE+I+        +S   L +  E + G+ +
Sbjct: 118 TTSFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFEQVSGSIQ 170

Query: 332 YK 333
           YK
Sbjct: 171 YK 172

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  128 bits (321), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 101/161 (62%), Gaps = 10/161 (6%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1313
            +K+KR+  F+  F  ++  +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYH 1110

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1374 KER-TKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTL 1413
            K   +   QFIVISL++N+F  +Q + G+++N     S  +
Sbjct: 1171 KRHASPKFQFIVISLKSNLFGKSQSMAGVFRNQQANSSMVI 1211

 Score =  122 bits (307), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 180/724 (24%), Positives = 312/724 (43%), Gaps = 124/724 (17%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L L+NFKSY GT  +G  +  F ++VGPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 215 HKSE---------AYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
           ++           A P     S  +   Y+ D++       ++   +   R       S 
Sbjct: 67  YRGRMDDRSDEHVASPK----SAYVKAFYLKDDNG------EQGTKIEFMRIIQNTGDSV 116

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y IDGK  ++    + L  + I +  + FL+ QG+VE I+        +S   L +  E 
Sbjct: 117 YRIDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQ 169

Query: 326 IIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXX 385
           + G+ +Y+   E    E     +   E  +  +   K +  L+S K+             
Sbjct: 170 VSGSVQYQREYERLKEEYQKATE---EYGDSLKSKRKMQIDLKSFKEGVHKEQHYKNLLS 226

Query: 386 XXXXXXAQYHIWQ-----DQRK-----LSETLGKISELNEHLGQE-----KAKYDQFQRE 430
                  QY +WQ     D+R      L ++  K+++L   L  E     K+K    + E
Sbjct: 227 ERTKLNRQYVLWQLYHLEDRRSGLISSLKDSKSKLAQLKSKLTNEEHILHKSKSQAAKDE 286

Query: 431 VAQLR--ERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLK 488
           +   R  E+ +  +++  KL+ E   + S R+   +    +E++  +L +   + E  ++
Sbjct: 287 IVITRKKEKLSQLQQERSKLNSELLPVGSSRQSASKRINHIEKRIDSLKRDITRQESYVQ 346

Query: 489 STENSM---ADSKHKLE---------ELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSL 536
             +N +     +K  LE         + N S++Q KE        L    S L+E    L
Sbjct: 347 QFQNQLKVVTKAKDSLEIDIKASSSGKFNLSKEQLKEYESLKETYLCSGGSALEEKMTLL 406

Query: 537 RDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEI 596
           ++K  E+  EI+ +ER              +  +++S+I++    + +K++  ++L    
Sbjct: 407 QNKREELLEEISLYER--------------RANISKSRISVELNVEREKLE--LELSEVT 450

Query: 597 EAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEM----KNVLISHRQRA 652
                KN +    + + +  Q+ I            SA++K  E+    K VL+      
Sbjct: 451 RVLNSKNALHSAKVKEWKEVQSAI-----------ESANNKEYELNYKLKEVLVKLDDLT 499

Query: 653 MEARSTLSNVENK-NKVLSALIRLQRSGRIAGFHGRLGDLGTID-DMYDVAISTACPR-L 709
            + R   SN E K  + ++ L RL       G  G + DL     D Y +A+S+   +  
Sbjct: 500 ADQRE--SNKERKLRENVATLKRL-----FPGVKGLVHDLCRPKKDKYALAVSSMLGKNF 552

Query: 710 DDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNG 769
           D IVVD+V   QQCI +L+K++ G A FI LD +       I TP T+P     VR+  G
Sbjct: 553 DSIVVDSVSVAQQCISYLKKHRSGAASFIPLDTI------DINTP-TLP-----VRNLKG 600

Query: 770 KFLP------------AFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGT 816
             L             A   V  D+++   L  A  + + +  + ++VT+ G LI  +G 
Sbjct: 601 CILTVNAIEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGALIHRAGL 660

Query: 817 LSGG 820
           ++GG
Sbjct: 661 MTGG 664

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  127 bits (320), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 176/725 (24%), Positives = 304/725 (41%), Gaps = 122/725 (16%)

Query: 155 LSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLI 214
           L + NFKSY G   +G    +F ++VGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 215 HK------SEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYI 268
           ++        A+ N    +    F YV  ++ G  R       M  TR       S Y +
Sbjct: 67  YRGRMEEGGSAHENNPKSAYVTAF-YVKQDASGAERR------MEFTRVIHNTGDSTYKL 119

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           DGK   Y E   +L  + I +  + FL+ QG+VE I+        +S   L +  E + G
Sbjct: 120 DGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS-------QSGVDLTKLFEQVSG 172

Query: 329 TAKYKAGIEAGLVEIDTLND----VCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXX 384
           + +Y+        E + L D       E     +   K +  L+S K+            
Sbjct: 173 SVQYQR-------EYERLKDDYEKASAEYNESLKARRKMQIDLKSFKEGVQKEEQYISLL 225

Query: 385 XXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQ 444
                   Q+ +WQ    L     K S L   L   KAK  Q +R+++           +
Sbjct: 226 AERVKLQQQFMLWQ----LFHLQSKRSGLVASLKDSKAKLSQLKRQLSN----------E 271

Query: 445 MVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKL-----LKSTENSMADSKH 499
              L K    +  +  L+ R + ++ +KQ+  DK RL A+ L      + T   M + + 
Sbjct: 272 EAILGKSKSLVAKEELLLARRRETLLQKQQ--DKARLNAQLLPVGSARQGTTRRMVNIEK 329

Query: 500 KLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEI---ANHERDLEP 556
           +++ L    ++ +  + QL           +++K+  + K S   AE+   A+ +  L  
Sbjct: 330 RIDSLQRDIERQESYVKQLK----------NQLKVVGKTKAS-FEAELEKSASGKFTLSE 378

Query: 557 WNAQLQEKKSQMKLT------ESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAI 610
              +  E+  ++ L+      E ++AIL+  KE       +L  EI  F ++     I I
Sbjct: 379 EQKKEYEELKEVYLSSGGSEFEEKLAILQNKKE-------ELSEEIAVFEKR-----IGI 426

Query: 611 HKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLSNVENKN---- 666
            K + E      ++DI   E    S + G + +    H ++  E +   S +E+ N    
Sbjct: 427 SKTRAEHD---LKVDIERLEV-EVSERTGNLNDKNAIHSEKVREWKQIQSEIESANNKEY 482

Query: 667 -------KVLSALIRLQRSGRIAGFHGRL------------GDLGTIDDM-------YDV 700
                  +VL+ L  L  + R      +L            G  G + D+       Y V
Sbjct: 483 ELSYKLREVLAKLDDLSANQRETNKERKLRENVATLRRLFPGVRGLVHDLCRPKKEKYAV 542

Query: 701 AISTACPR-LDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLS-PIQTPETVP 758
            +ST   +  D ++VD++   QQCI +L+K++ G A FI LD +   + + P        
Sbjct: 543 GVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTIDTSSPTLPAGDNTGCI 602

Query: 759 RLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTL 817
              D +  ++     A   V  D+++   L  A  + + +  + ++VTL+G LI  +G +
Sbjct: 603 LTLDAIEYESS-LEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRAGLM 661

Query: 818 SGGGT 822
           +GG T
Sbjct: 662 TGGIT 666

 Score =  126 bits (317), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 103/161 (63%), Gaps = 10/161 (6%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1313
            +K+KR++ F+  F+ +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYH 1110

Query: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1374 KER-TKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTL 1413
            +   +   QFIVISL++N+F  ++ + G+++N +   S  +
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  121 bits (303), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 198/798 (24%), Positives = 340/798 (42%), Gaps = 110/798 (13%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           I++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESD------GTTRSDDEKPPMVITRKAFRNNSS 264
            DLI+K      +   SV + F    D SD      G T S    P + +TR+     +S
Sbjct: 63  QDLIYK-RGQAGVTKASVTVVF----DNSDRDNSPIGFTNS----PKISVTRQVVLGGTS 113

Query: 265 KYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLE 324
           KY I+G  +    V QL +   +++++  FLI+QG++  +  MKP         +L  +E
Sbjct: 114 KYLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIE 166

Query: 325 DIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEA------XXXX 378
           +  GT  ++   E    E          +ENR  L E+ +  LE  + E           
Sbjct: 167 EAAGTKMFEDRREKA--ERTMAKKETKLQENRALLAEEIEPKLEKLRSEKRIFLDFQTTQ 224

Query: 379 XXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERC 438
                          Y++   Q    +TL    +   HL +E  K  +   E+  L E  
Sbjct: 225 TDLERTSRVVSAFNYYNMKHRQSSFEQTLQDSEDKCNHLKEEIEKVSE---EIKSLNEDL 281

Query: 439 NDFKKQ----------MVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLK 488
            + K Q          +V  +KE  DL  +   + R KT++  K  ++D+   + +KL  
Sbjct: 282 EELKLQKKNEMDNEGRLVNFEKEESDLLKQ---ISRIKTTLSIKNDSIDEAEKELQKLNS 338

Query: 489 STENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIA 548
           + E    + + KL +  +++K+Y        E    E ++L E++    +  S +S  I+
Sbjct: 339 NNEELTKELEMKLAQYTSTEKEY--------EIANSELTRLKELQGKKSELLSTLSTGIS 390

Query: 549 NHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEI 608
           ++    + ++AQL   K   KL ++++ I K + ++ +     L+ E+ +        E 
Sbjct: 391 SNGATDDGYSAQLVATKK--KLNDTEVLIKKLNMKRSM-----LQKELAS-------NEP 436

Query: 609 AIHKLQCEQANILKRIDIGEKECGSASSKLGEM---KNVLISHRQRAMEARSTLSNVENK 665
            + + + E     K ++  EK CG   S+L       ++L   R+   E +  L     +
Sbjct: 437 KLFQAKREHEKSSKIMEQNEKYCGELRSQLASFGYDPDLLKFLRKEESEVQQQLYRANEE 496

Query: 666 NKVLS---ALIRLQRSGRIAGF-----HGRLGDLGTID-DMYDVAIS---TACPRLDDIV 713
            + L    A I    +   A F      G    L T+D   +D AI+    A  RL +I+
Sbjct: 497 AEALKRRVANIEFNYTRPSANFDPKSVKGVAAQLFTVDQQQFDNAIALQVCAGGRLYNII 556

Query: 714 VDNVECGQQCIEHLRKNKLGYARFIILDKL--RKFN-----LSPIQTPETVPRLFDLVRS 766
           VDN     Q +E  R  K      I L K+  R  N     L+    P  V    +L+  
Sbjct: 557 VDNEITASQLLERGRLKK--RVTIIPLSKIATRTLNKNTLALAKELAPGKVELALNLI-G 613

Query: 767 KNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGGGTHVM 825
            + +   A   +  + LV  D   A +V +    R R +T  G + D  GTLSGG  +  
Sbjct: 614 YDDEVSKAMEFIFGNGLVCKDADTAKKVTFHPNIRTRSITQQGDVYDPEGTLSGGSRNTT 673

Query: 826 KGLMKSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEI--- 882
           + L+   Q+    +   +V  +E +L E +K          + EE  +K K  + E+   
Sbjct: 674 RSLLVDIQK--YNHAVAKVNELELKLIEMQKK-------LKEQEETSQKTKSLQNELNLA 724

Query: 883 --EVEIAKRRLDIESSST 898
             ++ IA+RRL +E+S+ 
Sbjct: 725 DHKLNIAQRRL-VENSAA 741

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score =  119 bits (299), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 192/795 (24%), Positives = 354/795 (44%), Gaps = 105/795 (13%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDD-----EKPPMVITRKAFRNNSSK 265
            DLI+K      +   SV I F       D T +S+        P + +TR+     +SK
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF-------DNTDKSNSPIGFTNSPQISVTRQVVLGGTSK 114

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y I+G  +    V QL +   +++++  FLI+QG++  +  MKP         +L  +E+
Sbjct: 115 YLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEE 167

Query: 326 IIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEA------XXXXX 379
             GT  ++   E    E          +ENR  L E+ +  LE  ++E            
Sbjct: 168 AAGTKMFEDRREKA--ERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQT 225

Query: 380 XXXXXXXXXXXXAQYHIWQDQRKLSETL----GKISELNEHLGQEKAKYDQFQREVAQLR 435
                         Y+I      + ETL     ++  LNE + +   + D    +V +++
Sbjct: 226 DLEKTERIVVSYEYYNIKHKHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEIK 285

Query: 436 -ERCNDFKKQ--MVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTEN 492
            ++  +  K+  + KL+ +   L ++   + R KTS+  K  NL+    K+    K+ E+
Sbjct: 286 LQKEKELHKEGTISKLENKENGLLNE---ISRLKTSLSIKVENLNDTTEKS----KALES 338

Query: 493 SMADSKHKLEE----LNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIA 548
            +A S  KL E      N++K Y  K++Q      E+ SK  ++     +  S ++  I+
Sbjct: 339 EIASSSAKLIEKKSAYANTEKDY--KMVQ------EQLSKQRDLYKRKEELVSTLTTGIS 390

Query: 549 NHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKV--QNIIQLKTEIEAFAEKNNVQ 606
           +       +NAQL + K++  L E  +AI K S + ++  + ++ ++ +++   + N + 
Sbjct: 391 STGAADGGYNAQLAKAKTE--LNEVSLAIKKSSMKMELLKKELLTIEPKLKEATKDNELN 448

Query: 607 EIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMK---NVLISHRQRAMEARSTLSNVE 663
               H  QC++     ++     E G   S++ ++K   + L SH  +      T  N E
Sbjct: 449 --VKHVKQCQET--CDKLRARLVEYGFDPSRIKDLKQREDKLKSHYYQ------TCKNSE 498

Query: 664 NKNKVLSAL----IRLQRSGRIAGFHGRLGDLGTIDD---MYDVAIST-ACPRLDDIVVD 715
              + ++ L     +   +   +  HG +G L  ID+    Y  A+ T A  RL ++VV 
Sbjct: 499 YLKRRVTNLEFNYTKPYPNFEASFVHGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQ 558

Query: 716 NVECGQQCIEHLRKNKLGYARFIILDKL-------RKFNLSPIQTPETVPRLFDLVRSKN 768
           + +   Q +E  R  K      I LDK+       +  +L+    P  V    +L+R  +
Sbjct: 559 DSQTATQLLERGRLRK--RVTIIPLDKIYTRPISSQVLDLAKKIAPGKVELAINLIRF-D 615

Query: 769 GKFLPAFYSVLRDTLVVSDLKQANRVAYG-KRRFRVVTLDGKLIDTSGTLSGGGTHVMKG 827
                A   +  ++L+  D + A ++ +  K R R +TL G + D  GTLSGG  +  + 
Sbjct: 616 ESITKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSES 675

Query: 828 LMKSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEI----- 882
           L+   Q+       ++++ I+ +LN      H+  E         +K K  + ++     
Sbjct: 676 LLVDIQK--YNQIQKQIETIQADLN------HVT-EELQTQYATSQKTKTIQSDLNLSLH 726

Query: 883 EVEIAKRRLDIESSS 897
           ++++AKR LD   SS
Sbjct: 727 KLDLAKRNLDANPSS 741

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  118 bits (295), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 180/727 (24%), Positives = 313/727 (43%), Gaps = 101/727 (13%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYV--VDESDGTTRSDDEKPPMVITRKAFRNNSSKYYI 268
            DLI+K      +   SV I F     ++   G T S    P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFNNTDKLNSPIGFTNS----PQISVTRQVVLGGTSKYLI 117

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           +G  +    V QL +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 329 TAKYK----------AGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXX 378
           T  ++          +  E  L E  TL  +  E E + E +  EK        E     
Sbjct: 171 TKMFEDRREKAERTMSKKETKLQESRTL--LTEEIEPKLEKLRNEKRMFL----EFQSTQ 224

Query: 379 XXXXXXXXXXXXXAQYHIWQDQRKLSETL----GKISELNEHL---GQEKAKYDQFQREV 431
                          Y+I      + ETL      + +LN+ +    +E    ++  RE+
Sbjct: 225 TDLEKTERIVASYDYYNIKHKHTSIRETLENGEAHMKKLNDFIRKTSEEIESLNEDIREI 284

Query: 432 AQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTE 491
              +E+    + ++ KL+ +   L ++   + R KTS+  K  NL+    K    LK+ E
Sbjct: 285 KHQKEKELHKEGRIFKLEAQENGLLNE---ISRSKTSLSIKMENLNDTNGK----LKAVE 337

Query: 492 NSMADSKHKLEELNN----SQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEI 547
           + +A +  KL E       +++ YK    QL        SK  ++     +  S ++  I
Sbjct: 338 SEIASASAKLNEKKTEYIKTEEDYKTAQGQL--------SKQRDLYKRKEELVSTLTTGI 389

Query: 548 ANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEK-NNV- 605
           ++       +NAQL + K++  L +  +AI K + + ++     LK E+ A   K  N  
Sbjct: 390 SSTGAADGGYNAQLIKAKTE--LNDISLAIKKSNMKMEL-----LKKELLAIEPKLKNAT 442

Query: 606 --QEIAI-HKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLSNV 662
              E+ I H   C++  +  R+     E G   S++ ++K       QR  E +S    +
Sbjct: 443 MDNELNIKHVKDCQE--VCNRLQAQLTEYGFDPSRIKDLK-------QRENELKSRYYQI 493

Query: 663 ENKNKVLS---ALIRLQRSGRIAGF-----HGRLGDLGTIDD---MYDVAIST-ACPRLD 710
            N ++ L    A +    +     F     HG +G L  +D     Y  A+ T A  RL 
Sbjct: 494 SNDSEYLKRRVANLEFNYTTPYPDFKANFVHGVVGQLFQLDYDNIRYSTALQTCAGGRLF 553

Query: 711 DIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSP-------IQTPETVPRLFDL 763
           ++VV + +   Q +E  R  K      I LDK+    ++P          P  V    +L
Sbjct: 554 NVVVQDSQTATQLLERGRLRK--RVTIIPLDKIYARTINPQVLELAKTVAPGKVELAINL 611

Query: 764 VRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYG-KRRFRVVTLDGKLIDTSGTLSGGGT 822
           ++  +     A   +  ++L+  D + A ++ +  K R R +TL G + D  GTLSGG  
Sbjct: 612 IKF-DKTVTKAMEFIFGNSLICEDPETAKKITFHPKIRIRSITLQGDVYDPEGTLSGGSK 670

Query: 823 HVMKGLM 829
           +    L+
Sbjct: 671 NTSDSLL 677

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1321 WRN-ISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W++ +  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMFELAQQL 1398
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  117 bits (293), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 197/805 (24%), Positives = 344/805 (42%), Gaps = 125/805 (15%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDD-----EKPPMVITRKAFRNNSSK 265
            DLI+K      +   SV I F       D T +S+        P + +TR+     +SK
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF-------DNTDKSNSPIGFTNSPQISVTRQVVLGGTSK 114

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y I+G  +    V QL +   +++++  FLI+QG++  +  MKP         +L  +E+
Sbjct: 115 YLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEE 167

Query: 326 IIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEA------XXXXX 379
             GT  ++   E    E          +ENR  L E+ +  LE  ++E            
Sbjct: 168 AAGTKMFEDRREKA--ERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQT 225

Query: 380 XXXXXXXXXXXXAQYHIWQDQRKLSETL----GKISELNEHLGQEKAKYDQFQREVAQLR 435
                         Y+I      + ETL      + ELNE +       ++  +E+  L 
Sbjct: 226 DLEKTERIVASCDYYNIKHKHTSIRETLENGEAHMKELNEFI-------EKTAQEIESLN 278

Query: 436 ERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKL------LKS 489
           E   + K Q  K  + HKD +   +L  +E T + E  R      +KAE +      LK+
Sbjct: 279 EDVKEIKLQ--KQKELHKD-SEISKLETQESTLLNEISRLKTSLSIKAESVNDTTEKLKA 335

Query: 490 TENSMADSKHKLE----ELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISA 545
            E  +A+S  +L     E   +++ YK        ++ EE SK  E+     +  S ++ 
Sbjct: 336 LELEIANSSARLNEKKIEYTKTEEDYK--------TVQEELSKQRELYKKKEELVSTLTT 387

Query: 546 EIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAF------ 599
            I++       +NAQL   K++  L++  +AI K + +  +     LK E+         
Sbjct: 388 GISSTGAADGGYNAQL--IKAKAGLSDVSLAIKKSTMKMDL-----LKRELSVIEPKLTQ 440

Query: 600 AEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTL 659
           A K+N   I  H  +C+      ++     E G   S++ ++K       Q+  E +S  
Sbjct: 441 ATKDNELNIK-HVKECQDN--CNKLQAQLTEYGFDPSRIKDLK-------QKENELKSQY 490

Query: 660 SNVENKNKVLS---ALIRLQRSGRIAGF-----HGRLGDLGTIDD---MYDVAIST-ACP 707
             + N ++ L    A +    +     F     +G +G L  +DD    Y  A+ T A  
Sbjct: 491 YQISNDSEYLKRRVANLEFNYTTPYPDFKANLVYGVVGQLFELDDDKIRYSTALQTCAGG 550

Query: 708 RLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQ-------TPETVPRL 760
           RL ++VV + +   Q +E  R  K      I L+K+    +SP          P  V   
Sbjct: 551 RLFNVVVQDSQTATQLLERGRLRK--RVTIIPLNKISTRPISPQVLELAKKIAPGKVELA 608

Query: 761 FDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYG-KRRFRVVTLDGKLIDTSGTLSG 819
            +L++  +     A   +  ++L+  D + A ++ +  K R R +TL G + D  GTLSG
Sbjct: 609 INLIKF-DKSVTKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSG 667

Query: 820 GGTHVMKGLMKSKQQPGAGYTPEEVQNIEKELN----EREKNFHIAIET---FHDMEEAL 872
           G  +    L+   Q+        +++ I+ +LN    E +K +  + +T    +D+  +L
Sbjct: 668 GSRNTSDSLLVDIQK--YNQIQRKIEIIQADLNHVTEELQKQYTTSQKTKTIQNDLNASL 725

Query: 873 KKFKDREPEIEVEIAKRRLDIESSS 897
            K         +++AKR L++  SS
Sbjct: 726 HK---------LDLAKRNLEVNPSS 741

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WRN-ISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W++ +  LSGG+++L +LAL+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  111 bits (277), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 171/727 (23%), Positives = 313/727 (43%), Gaps = 101/727 (13%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTR--SDDEKPPMVITRKAFRNNSSKYYI 268
            DLI+K      +   SV I F    D +D ++     +  P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNTDKSSSPIGFESYPKISVTRQIILGGTSKYLI 117

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           +G  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 329 TAKYK----------AGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXX 378
           T  ++          A  E  L EI TL  +  E E + E +  +K +      E     
Sbjct: 171 TRMFEDRREKAEKTMAKKETKLQEIRTL--LEEEIEPKLEKLRNQKRAFL----EFQETQ 224

Query: 379 XXXXXXXXXXXXXAQYHIWQDQRKLSETL----GKISELNEHLGQEKAKYDQFQREVAQL 434
                          Y +      + ETL     ++ ELN  + + K        E++ L
Sbjct: 225 TDLEKTLRILNAYEYYDMATKNSTIKETLQNSTARVEELNNFIQKTK-------NEISNL 277

Query: 435 RERCNDFKKQ----------MVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAE 484
            E     K Q          + +L+K+  DL ++   + R KT++     N++++  K +
Sbjct: 278 DEDLKTIKIQKQEQVQKDGKLSQLEKQENDLANE---ISRLKTALGISVENINEESYKLK 334

Query: 485 KLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEIS 544
           KL ++ +    D   K     +++ ++ +    LNE +   + +    +  L   T+ IS
Sbjct: 335 KLHENVQKFERDLSEKSVIYTSTESEFND----LNEGVKRLKGQFKAKEELLSTLTTGIS 390

Query: 545 AEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKNN 604
           +           +N+QL   K+  KL ++QI I + +             +I+   +++ 
Sbjct: 391 STGGTD----SGYNSQLSAAKT--KLNDAQICIKRST------------MKIDMLKKESA 432

Query: 605 VQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEM---KNVLISHRQRAMEARSTLSN 661
           + E  I   + E    ++ I   E+ C +  ++L ++     ++   +Q+  + R+    
Sbjct: 433 INEPKIAHAERENEQNIREIKGYEQVCENLKAQLNDLGFNPMMIKDLKQKEFKLRNESYQ 492

Query: 662 VENKNKVL---SALIRLQRSGRIAGF-----HGRLGDLGTID-DMYDVAIS---TACPRL 709
           + N  + L   +A +    S   A F      G    L T++ + +D A +    A  RL
Sbjct: 493 LSNDTEHLRRKTANLEFTYSTPSANFDPKSVKGVAAQLFTLEKENFDSATALQVCAGGRL 552

Query: 710 DDIVVDNVECGQQCIEHLRKNKLGYARFIILDKL--RKFNLSPIQTPETV-PRLFDLVRS 766
            ++VVDN     Q +E  R  K      I L+K+  R  N + ++  ++V P   +L  +
Sbjct: 553 FNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENALKLAKSVAPGNVELALN 610

Query: 767 KNG---KFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGGGT 822
             G   +   A   +   +L+  D + A RV +  + R R +TLDG + D  GTLSGG  
Sbjct: 611 LIGYEDEVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSITLDGDIYDPEGTLSGGSR 670

Query: 823 HVMKGLM 829
           +    L+
Sbjct: 671 NTKNSLL 677

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 180/721 (24%), Positives = 308/721 (42%), Gaps = 107/721 (14%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           I++L +  FKSYA   +I  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDG 270
            DLI+K      +   SV I F  +  +   +    +  P + +TR+     +SKY I+G
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFSNL--DPKCSPIGFENSPKLSVTRQIILGGTSKYLING 119

Query: 271 KESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTA 330
             +    V QL +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 331 KY-----KAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAX-----XXXXX 380
            +     KA    G  E+         KENR  L E+ +  LE  ++E            
Sbjct: 173 MFEDRKGKAERTMGKKELKL-------KENRTLLQEEIEPQLEKLRNEKRIFLEFQEIQT 225

Query: 381 XXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQ-------REVAQ 433
                       +YH           +GK S + E L   +++  +          EV  
Sbjct: 226 DLEKIQRIVLAYEYH---------SLVGKQSSIKETLDTGESRMAELHGLISKTGEEVMH 276

Query: 434 LRERCN--DFKKQ--------MVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKA 483
           L E  N  +++KQ        + KL+K+   L +    + R + S +    N++    + 
Sbjct: 277 LTEDLNRINYEKQKELDSDGKLGKLEKQESTLMNN---LSRLRASFDICVENIN----ET 329

Query: 484 EKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLN---ESLLEERSKLDEIKLSLRDKT 540
            K L+ST+ ++  +K KLEE + + K  + +   LN   + L E  SK  E+  +L+   
Sbjct: 330 AKNLESTKANIKTNKGKLEEKSEAWKNMEAEYRHLNKKGKELKESHSKKSELLSTLQTGI 389

Query: 541 SEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFA 600
           S +      +   L      LQE  +++ + +S++ I   +KE       + K E     
Sbjct: 390 SSVGTTGGGYTEQLAATKGNLQE--AEIVVQKSRLKIEHLNKELHAN---KPKLEKARMD 444

Query: 601 EKNNVQEIAIHK-LQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQ------RAM 653
            +  + +I  HK +Q      L R        G   S + E++    S RQ      R  
Sbjct: 445 NEEGLNQIKKHKSIQDTFTEELNR-------YGYDPSVVKELRQKEYSMRQELHNVGRET 497

Query: 654 E-ARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAIS---TACPRL 709
           E  R +++N+E    + S          + G   +L  L   ++ YD A++    A  RL
Sbjct: 498 EYLRRSVANIEFNYTMPSEKF---DPNSVKGVAAQLFTLS--ENNYDSALALQVCAGGRL 552

Query: 710 DDIVVDNVECGQQCIEH--LRK-------NKLGYARFIILDKLRKFNLSPIQTPETVPRL 760
            +++VD+     Q +E   LRK       NK+   R I  + L+   L+    P  V   
Sbjct: 553 FNVIVDDQNTASQLLERGKLRKRVTIIPLNKIA-TRVINSESLK---LAKQLAPGKVQLA 608

Query: 761 FDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTLSG 819
            +LV  +  +   A   +  ++LV +D + A R+ +  + R R +T  G + D  GTLSG
Sbjct: 609 LNLVGYEE-EVSKAMEYIFGNSLVCNDAETAKRLTFHPQIRTRSITQQGDVYDPEGTLSG 667

Query: 820 G 820
           G
Sbjct: 668 G 668

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMFELAQQL 1398
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 96/188 (51%), Gaps = 23/188 (12%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           I++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESD------GTTRSDDEKPPMVITRKAFRNNSS 264
            DLI+K      +   SV + F    D SD      G T S      + +TR+     SS
Sbjct: 63  QDLIYK-RGQAGVTKASVTVVF----DNSDKSNSPIGFTNS----AKISVTRQVMLGGSS 113

Query: 265 KYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLE 324
           KY I+G  +    V QL +   +++++  FLI+QG++  +  MKPK        +L  +E
Sbjct: 114 KYLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIE 166

Query: 325 DIIGTAKY 332
           +  GT  +
Sbjct: 167 EAAGTKMF 174

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 58/86 (67%)

Query: 1307 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1366
            +EG+ F V        ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1367 SIVANYIKERTKNAQFIVISLRNNMF 1392
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 96/187 (51%), Gaps = 21/187 (11%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSD-----DEKPPMVITRKAFRNNSSK 265
            DLI+K      +   SV I F       D T +S+      E P + +TR+     +SK
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF-------DNTDKSNTPIGFSEYPKISVTRQIVLGGTSK 114

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y I+G  +    V QL +   +++++  FLI+QG++  I  MKP         +L  +E+
Sbjct: 115 YLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEE 167

Query: 326 IIGTAKY 332
             GT  +
Sbjct: 168 AAGTKMF 174

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 71/160 (44%), Gaps = 16/160 (10%)

Query: 705 ACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKL-------RKFNLSPIQTPETV 757
           A  RL +++VDN + G   ++  R  K      I LDK+        K  L+    P  V
Sbjct: 548 AGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIPLDKVISRPLNQNKLKLAKQLAPGKV 605

Query: 758 PRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGT 816
               +L+   + + + A   +  ++L+  D + A ++ +    R R +TL+G + D  GT
Sbjct: 606 ELALNLI-GYSDEVVKAMEFIFGNSLICDDAETAKKITFNPGIRTRSITLEGDIYDPEGT 664

Query: 817 LSGGGTHVMKGLMKSKQQPGA-----GYTPEEVQNIEKEL 851
           LSGG  +    L+   QQ            EE QNI K+L
Sbjct: 665 LSGGTRNNTNTLLVDIQQYNTLKKELLAMNEEKQNIHKQL 704

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 96/184 (52%), Gaps = 15/184 (8%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTR--SDDEKPPMVITRKAFRNNSSKYYI 268
            DLI+K      +   SV I F    D SD ++     +  P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVIKASVTIVF----DNSDPSSSPFGFETYPKISVTRQIILGGTSKYLI 117

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           +G  +    V  L +   +++++  FLI+QG++  +  MKP       D +L  +E+  G
Sbjct: 118 NGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAG 170

Query: 329 TAKY 332
           T  +
Sbjct: 171 TRMF 174

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 73/164 (44%), Gaps = 17/164 (10%)

Query: 705 ACPRLDDIVVDNVECGQQCIEH--LRK-------NKLGYARFIILDKLRKFNLSPIQTPE 755
           A  RL +++VDN +   Q +E   LRK       NK+  AR I  D L K   +    P 
Sbjct: 548 AGGRLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDALNK---AKSLAPG 603

Query: 756 TVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTS 814
            V    +L+     +   A   +   +L+  D   A +V +  + R R +TLDG + D  
Sbjct: 604 AVELALNLI-GYEAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIYDPE 662

Query: 815 GTLSGGGTHVMKGLMKSKQQPGAGYTPEEVQNIEKELNEREKNF 858
           GTLSGG       L+   Q+       +++  +EKEL + + N 
Sbjct: 663 GTLSGGSRSHTSSLLIDIQKYNEA--AKQMMVLEKELYQVQANI 704

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 95.5 bits (236), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 95/184 (51%), Gaps = 15/184 (8%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTR--SDDEKPPMVITRKAFRNNSSKYYI 268
            DLI+K      +   SV I F    D +D T      +    + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGITKASVTIVF----DNTDKTNSPIGFNNSAKISVTRQVVLGGTSKYLI 117

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           +G  +    V QL +   +++++  FLI+QG++  +  MKPK        +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAG 170

Query: 329 TAKY 332
           T  +
Sbjct: 171 TKMF 174

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1380 AQFIVISLRNNMFELAQQL 1398
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 72/158 (45%), Gaps = 14/158 (8%)

Query: 705 ACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKL--RKFNLSPIQT------PET 756
           A  RL ++VVDN +     +E  R  K      I L+K+  R  N     T      P  
Sbjct: 548 AGGRLYNVVVDNEKTASSLLERGRLRK--RVTIIPLNKISARTLNERSCTTKRKKLAPGK 605

Query: 757 VPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSG 815
           V    +L+   + +   A   +   +L+  D   A +V +  + R R +TL+G + D  G
Sbjct: 606 VELALNLI-GYDDEVSNAMEFIFGGSLICQDADTAKKVTFHPQIRTRSITLEGDVYDPEG 664

Query: 816 TLSGGGTHVMKGLMKSKQQPGAGYTPEEVQNIEKELNE 853
           TLSGG  +    L+   Q+     + +++Q+ EKELNE
Sbjct: 665 TLSGGSRNNSSSLLLDIQRYNE--SSQKLQSTEKELNE 700

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 96/187 (51%), Gaps = 21/187 (11%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDD-----EKPPMVITRKAFRNNSSK 265
            DLI+K      +   SV I F       D T +S+        P + +TR+     +SK
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF-------DNTDKSNSPIGFANSPQISVTRQVVLGGTSK 114

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y I+G  +    V QL +   +++++  FLI+QG++  +  MKP         +L  +E+
Sbjct: 115 YLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEE 167

Query: 326 IIGTAKY 332
             GT  +
Sbjct: 168 AAGTKMF 174

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMFELAQQL 1398
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 95/184 (51%), Gaps = 15/184 (8%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTR--SDDEKPPMVITRKAFRNNSSKYYI 268
            DLI+K      +   SV I F    D SD T      +    + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNSDKTNSPIGFNNSSKISVTRQIILGGTSKYLI 117

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           +G  +    V QL +   +++++  FLI+QG++  +  MKP       + +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAG 170

Query: 329 TAKY 332
           T  +
Sbjct: 171 TKMF 174

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1321 WRN-ISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W++ +  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMFELAQQL 1398
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1229

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 172/774 (22%), Positives = 322/774 (41%), Gaps = 75/774 (9%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++++  FK+Y  T +I  F    + V+G NGSGKSN   ++ FV     N +++ +
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHFRYVVDESDG---TTRSDDEKPPMVITRKAFRNNSSKY 266
              LIH+     ++ S  V+I F    D SDG      +    P  V+ R+       +Y
Sbjct: 61  RQGLIHQGSG--SVMSAYVEIVF----DNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 267 YIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDI 326
            ++ K  +  E+  LL   G    +  +++ QG + +++  K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 327 IGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXX 386
            G   ++  +       D+LN +     NR + ++ E   L+    E             
Sbjct: 168 TGANSFEKKLR------DSLNKMDATNRNR-KKIDSELRELDEKLQELNEEREELEKYNA 220

Query: 387 XXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMV 446
                  +      R+L++    I +L+          +Q+ +E+ +     ++  K +V
Sbjct: 221 LERDRKVFQFTLYDRELNDVTNHIEKLDSEYNNTVDSSEQYVQEMDKREVLISNVTKNLV 280

Query: 447 KLDKEHK-----DL-TSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKST-ENSMADSKH 499
            +D E K     DL  SK   +D     +EEK+ +LD K  + ++ ++ST E +  D  +
Sbjct: 281 NIDAELKIKKSTDLEQSKANQLD-----VEEKKADLDVKCEELQRQIRSTSEQAKTDESN 335

Query: 500 --------------------KLEELNNSQKQYK---EKLLQLNESLLEERSKLDEIKLSL 536
                               + EEL   + Q+K   E L Q    LL +R +  + K + 
Sbjct: 336 LASVLNDISRKETQIKRISPRFEELTREEHQFKTDLELLQQKQRDLLAKRGRYAQFK-TQ 394

Query: 537 RDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEI 596
            ++   I +EIA+ +++ +   +  QE   +    + Q+A L E + K++ + IQ    I
Sbjct: 395 EERNGWIQSEIADLKQEAQILESTYQELSQERSDLQEQLAELDE-QAKELNDSIQ-GPGI 452

Query: 597 EAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEAR 656
            A  E  N +   + +L   + +  K +   E++  +    L  M +V  S R       
Sbjct: 453 TAELEDLNSEISQLKQLYTTKIDERKELWRSEQKLQTILETL--MDDVKRSERSVNETMD 510

Query: 657 STLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPR-LDDIVVD 715
            +L+N     + +S  ++L  +      +G LG+L  +++ Y     T     L  +VVD
Sbjct: 511 RSLANGLKAVREISERLKLPEN----AVYGPLGELIKVNEKYKTCAETVGGNSLFHVVVD 566

Query: 716 NVECGQQCIEHLRKNKLGYARFIILDKLRKFN--LSPIQTPETVPRLFDLVRSKNGKFLP 773
             +     ++ L   K G   F+ L++L   N    P         L   ++  + KF  
Sbjct: 567 TEDTAGLLMQELYNVKGGRVTFMPLNRLHADNNVTYPSNEQSNCTALIKKIKY-DEKFER 625

Query: 774 AFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGG-GTHVMKGLMKSK 832
           A   V   T+VV DL    ++A  + +   +TLDG   D  G L+GG   H  K  + S 
Sbjct: 626 AVKHVFGKTIVVRDLTLGTKLAR-QYKLNAITLDGDRADKRGVLTGGYHDHHKKTRLDSL 684

Query: 833 QQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEI 886
           +      T  E   + ++LN  +K  H+  +    +   +K+   ++  I V+I
Sbjct: 685 KDLKHAKT--EYSTVSQKLNSLKKQLHVVDDEVDQLNNKIKQATTKKESIMVDI 736

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%)

Query: 1323 NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1382
            ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  + VAN IKE + NAQF
Sbjct: 1119 HVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYRTSVANTIKELSANAQF 1178

Query: 1383 IVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILNGV 1422
            I  + R++M  +A     +   N ++    +   D +N +
Sbjct: 1179 ICTTFRSDMLRVADVFYRVKYENKISTVAEVSQRDAINFI 1218

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 94/184 (51%), Gaps = 15/184 (8%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTR--SDDEKPPMVITRKAFRNNSSKYYI 268
            DLI+K      +   SV I F    D SD +      +  P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNSDKSNAPIGFESSPTISVTRQVALGGTSKYLI 117

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           +G  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 329 TAKY 332
           T  +
Sbjct: 171 TKMF 174

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 93/182 (51%), Gaps = 11/182 (6%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDG 270
            DLI+K      +   SV I F    D+   +    +  P + +TR+     +SKY I+G
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFTN--DDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 271 KESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTA 330
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 331 KY 332
            +
Sbjct: 173 MF 174

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 9/120 (7%)

Query: 705 ACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKL--RKFNLSPIQTP-ETVPRLF 761
           A  RL ++VVDN     Q +E  R  K      I L+K+  R  + + ++   E  P   
Sbjct: 548 AGGRLFNVVVDNEGTASQLLERGRLRK--RVTIIPLNKISARSLHQNAVKAAKELAPGNV 605

Query: 762 DLVRSKNG---KFLPAFYSVLRDTLVVSDLKQANRVAYGKR-RFRVVTLDGKLIDTSGTL 817
           +L  +  G   +   A   +   +L+  D + A +V +  R R R +TL G + D  GTL
Sbjct: 606 ELALNLIGYEEEVSKAMEFIFGTSLICQDAETAKKVTFHPRVRARSITLQGDIYDPEGTL 665

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 92.0 bits (227), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 94/182 (51%), Gaps = 11/182 (6%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDG 270
            DLI+K      +   SV I F     + + +    +  P + +TR+     +SKY I+G
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF--ANSDKNNSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 271 KESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTA 330
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 331 KY 332
            +
Sbjct: 173 MF 174

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 97/434 (22%), Positives = 184/434 (42%), Gaps = 42/434 (9%)

Query: 408 GKISELNEHLGQEKAKYDQFQREVAQLR-ERCNDFKK--QMVKLDKEHKDLTSKRRLMDR 464
            +ISEL   + Q K +    + ++  +R ++ N+ +K   + KL+     L ++   + R
Sbjct: 258 SRISELTASVQQTKVELTNLEEDLDTIRTQKRNEMRKDGALSKLEALETQLINE---VSR 314

Query: 465 EKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLE 524
            KTS+     N++++  K E L +S        + K     N++ +Y E L  L ++L +
Sbjct: 315 LKTSLSLTIENINQENGKRESLERSIRGIQTSLQEKSAISKNAENEYNE-LHDLVQNLSQ 373

Query: 525 ERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEK 584
           +    +E+  +L    S   A  + +   L    A+L + + Q++  E +I ILK+    
Sbjct: 374 QLQTKEELLSTLTTGISSTGATNSGYSAQLSNTKARLNDARIQVQRFEMKINILKKELAA 433

Query: 585 KVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANI-LKRIDIG-------EKECGSASS 636
               I+  K+  E  A+K    ++ +  +QC    + L+++          ++E  S  S
Sbjct: 434 NEPKIVDAKSLSEE-AKK----QVEVTGIQCSDLKMHLEKLGFNPDLFKSLKEEESSLKS 488

Query: 637 KLGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDD 696
           K+  + N +   R++        S   +K    S          + G   +L  L   + 
Sbjct: 489 KIYNLSNDMEGLRRKVANIDFAYSKPSDKFDPTS----------VKGVAAQLFSLNEENF 538

Query: 697 MYDVAIS-TACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRK-------FNL 748
               A+   A  RL ++VV+N     Q +E  R  K      I L+K+          N 
Sbjct: 539 SSATALQICAGGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNF 596

Query: 749 SPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYG-KRRFRVVTLD 807
           +    P++V    +L+  ++ +   A   +   +L+  D + A +V +  K R R +TL 
Sbjct: 597 AKQLAPDSVELALNLIGYED-EVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQ 655

Query: 808 GKLIDTSGTLSGGG 821
           G + D  GTLSGG 
Sbjct: 656 GDIYDPEGTLSGGS 669

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 92.0 bits (227), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 94/184 (51%), Gaps = 15/184 (8%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESD--GTTRSDDEKPPMVITRKAFRNNSSKYYI 268
            DLI+K      +   SV I F    D SD   +    +  P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVIKASVTIVF----DNSDIKSSPIGFERYPKISVTRQIALGGTSKYLI 117

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           +G  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAG 170

Query: 329 TAKY 332
           T  +
Sbjct: 171 TRMF 174

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 20/167 (11%)

Query: 681 IAGFHGRLGDLGTIDDMYDVAIS---TACPRLDDIVVDNVECGQQCIEH--LRKNKLGYA 735
           + G   ++  LG   D +D A +    A  RL +I+VDN +   Q +E   LRK      
Sbjct: 523 VKGVAAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLEKGMLRKR----V 576

Query: 736 RFIILDKL-------RKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDL 788
             I L+K+           L+    P  V    +L+  +      A   +   +L+ +D 
Sbjct: 577 TIIPLNKISTRVLSDESLALAKKIAPGKVELALNLIGYEED-VSKAMQYIFGGSLICADA 635

Query: 789 KQANRVAYGKR-RFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQ 834
           + A ++ +  + R R +TLDG + D  GTLSGG ++    L+K  Q+
Sbjct: 636 ETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNSLLKDIQK 682

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 96/184 (52%), Gaps = 15/184 (8%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTR--SDDEKPPMVITRKAFRNNSSKYYI 268
            DLI+K      +   SV I F    D SD +      ++   + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNSDKSNSPIGFNDSLKISVTRQIVLGGTSKYLI 117

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328
           +G  +    V QL +   +++++  FLI+QG++  +  M+P         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAG 170

Query: 329 TAKY 332
           T  +
Sbjct: 171 TKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1380 AQFIVISLRNNMF 1392
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 93/182 (51%), Gaps = 11/182 (6%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           +++L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDG 270
            DLI+K      +   SV I F     ++  +    +    + ITR+      SKY I+G
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFNN--SDTSNSPIGFESHAKISITRQIILGGVSKYLING 119

Query: 271 KESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTA 330
             +    V QL +   +++++  FLI+QG++  +  MKP+        +L  +E+  GT 
Sbjct: 120 HRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAGTR 172

Query: 331 KY 332
            +
Sbjct: 173 MF 174

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 84/140 (60%), Gaps = 1/140 (0%)

Query: 1253 RDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLF 1312
            + ++++  E+L + + +  ++ +  +S+    ++  +     A+LE  +  D  +EG+  
Sbjct: 1011 KQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEV 1069

Query: 1313 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANY 1372
             V   K    ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1373 IKERTKNAQFIVISLRNNMF 1392
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 88.6 bits (218), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 92/190 (48%), Gaps = 27/190 (14%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 210
           + +L +  FKSYA   +I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 211 SDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPP--------MVITRKAFRNN 262
            DLI+K      +   SV I F            SD  K P        + +TR+     
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----------DNSDKSKAPIGFETSLTISVTRQIVLGG 111

Query: 263 SSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEY 322
           +SKY I+G  +    V  L +   +++++  FLI+QG++  +  MKP         +L  
Sbjct: 112 TSKYLINGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILAL 164

Query: 323 LEDIIGTAKY 332
           +E+  GT  +
Sbjct: 165 IEEAAGTKMF 174

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1319 KSWR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT 1377
            K W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1378 KNAQFIVISLRNNMFELAQQL 1398
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa]
           {ON} YJL074C (REAL)
          Length = 1229

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 178/751 (23%), Positives = 313/751 (41%), Gaps = 156/751 (20%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    II  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHF----RYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
              LIH+     ++ S SV+I F      ++  S   +R DDE    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y ++ +     ++ ++L   G  +++   ++ QG++ +++  K K ER      L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK-ER------LQLLED 168

Query: 326 IIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXX 385
           ++G   ++  ++A L               + E  E++K                     
Sbjct: 169 VVGAKSFEVKLKASL--------------KKMEETEQKK--------------------- 193

Query: 386 XXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQ--REVAQ--LRER-CND 440
                      +Q  +++ E   K++E+ E   +E  KY++ +  R++ Q  L +R  ND
Sbjct: 194 -----------FQINKEMDELNSKLTEM-EQERKELEKYNELERKRKIYQYTLYDRELND 241

Query: 441 FKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHK 500
              QM +LD ++ +         +E    E+    + KK    E  LK  +N+    + K
Sbjct: 242 VINQMERLDGDYNNTVYSSEQYIQELDKREDMIEQVSKKLSNIEASLK-IKNTTDLQQAK 300

Query: 501 LEELNNSQK------QYKEKLLQLNESLLEERS----KLDEIKLSLRDKTSEIS------ 544
           L E   SQ       + KE  LQ+ ES  E+RS     L+EIK  +R +  ++S      
Sbjct: 301 LRESETSQNLTDVNVKIKEVELQI-ESNSEQRSLDSTTLEEIKSIIRQRKKKLSKILPRY 359

Query: 545 AEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKV---QNIIQLKTEIEAFAE 601
            E+   E   +   A LQ+K+  + L + + A  K  +E+       I +LK+ ++   E
Sbjct: 360 QELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKEERDAWIYSEIEELKSSVQNLNE 419

Query: 602 KNNVQEIAIHKLQCEQANI---LKRIDIGEKE-------CGSASSKLGEMKNVLISHRQR 651
           + N       KLQ E+A++     +ID GE E             +L +  + LI+ +Q+
Sbjct: 420 QGN-------KLQTERASLKEQYSKID-GEIEELIDSVNGPDIKGQLEDFDSELINLKQK 471

Query: 652 ---AMEAR---------------STLSNV-ENKNKVLSALIRLQRSGRI----------- 681
              +++ R               + LS+V +N+  V   + R   +G I           
Sbjct: 472 LNGSLDTRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKI 531

Query: 682 --AGFHGRLGDLGTIDDMYDV-AISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFI 738
                 G LG+L  ++D Y   A       L  +VVD  E     +  L + K G   FI
Sbjct: 532 SPESVFGTLGELIKVNDKYKACAEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFI 591

Query: 739 ILDKLR-----KFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRD----TLVVSDLK 789
            L++L      KF  +     +  P +      K  K+ P F   ++     T+VV DL 
Sbjct: 592 PLNRLSLDSDVKFPSNTTTQIQFTPLI------KKIKYQPRFEKAVKHVFGRTIVVKDLG 645

Query: 790 QANRVAYGKRRFRVVTLDGKLIDTSGTLSGG 820
           Q  ++A  K +   +TLDG   D  G L+GG
Sbjct: 646 QGLKLA-KKHKLNAITLDGDRADKRGVLTGG 675

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 54/86 (62%)

Query: 1323 NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1382
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE +KNAQF
Sbjct: 1121 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQF 1180

Query: 1383 IVISLRNNMFELAQQLVGIYKNNNMT 1408
            I  + R +M ++A +   +   N ++
Sbjct: 1181 ICTTFRTDMLQVADKFFRVKYENKIS 1206

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1229

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 160/708 (22%), Positives = 301/708 (42%), Gaps = 72/708 (10%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    II  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHF----RYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
              LIH+      + S SV+I F      ++  S    R +DE    V  R+        
Sbjct: 61  RQGLIHQGSGGAVM-SASVEIVFHDPNHKIILPSGVVPRENDE----VYIRRTVGLKKDD 115

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y ++ +     +V ++L   G  +++   ++ QG++ +++  K K ER      L  LED
Sbjct: 116 YQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDK-ER------LNLLED 168

Query: 326 IIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXX 385
           ++G   ++  ++A L ++D       E E +   ++ E N L S   E            
Sbjct: 169 VVGAKSFELKLKASLKKMD-------ETEQKRNQIDMEMNELNSKLKEMNQERKELEKFN 221

Query: 386 XXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCN---DFK 442
                   +      R+L++ + +I  L+   G   +  D  ++ + +L +R N   +  
Sbjct: 222 SLDKNRKVFQFTLYDRELNDIITQIENLD---GDYNSTVDSSEKYIKELDKRENIISELT 278

Query: 443 KQMVKLDKEHK-DLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADS-KHK 500
           K++ ++D   K   T+  ++     + +     NLD  ++K  KL   T+N   +S K  
Sbjct: 279 KKLTEIDSSLKIKTTNDLQIAKANNSEILNNLTNLD-VQIKDLKLQLETQNEQTNSDKSN 337

Query: 501 LEELNNSQKQYKEKL----------------LQLNESLLEERSK---LDEIKLSLRDKTS 541
           LE +N   +  + KL                 +L  + L+ER +   L + + S      
Sbjct: 338 LELINKEIESRRLKLSKISPRFQQLTNEESRFKLQSNTLKERQRDLLLKKGRYSRFHTAQ 397

Query: 542 EISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNI---IQ---LKTE 595
           E +  I N  ++L      L + K++ K+ + ++A    + ++++Q +   IQ   +  E
Sbjct: 398 ERNEWIENEIKELNQLQQSLNDTKTKNKIEKDEVAERINTIDEEIQELNDSIQGPSINAE 457

Query: 596 IEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEA 655
           +E    ++N+ +I     Q   ++I +R ++   E    +     + NV  S R      
Sbjct: 458 LEDL--ESNIDDIK----QQYNSSIDQRKELWRNEQKLETVLQTILDNVKDSERAVGETM 511

Query: 656 RSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDV-AISTACPRLDDIVV 714
             +L+N     K ++  ++L          G LG+L +++  Y   A       L  ++V
Sbjct: 512 DRSLANGLKSVKEIAEKLKLPED----SVFGTLGELVSVNSKYKTCAEVIGGNSLFHVIV 567

Query: 715 DNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVR--SKNGKFL 772
           D  E   + ++ L + K G   FI L+K+  F+ S    PE       L++    + KF 
Sbjct: 568 DTEETASKIMKELYRMKGGRVTFIPLNKVY-FDNSITFPPEDQSSYTPLIKKIKYDEKFD 626

Query: 773 PAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGG 820
            A   V   T+VV DL    ++A  K +   +TLDG   D  G L+GG
Sbjct: 627 KAVKHVFGKTIVVKDLSTGLKLA-KKYKLSAITLDGDRADKRGVLTGG 673

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 1303 LDPFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA 1360
            ++P   GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1361 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI-YKN 1404
            LD +  + VA  I++ + NAQFI  + R +M E+A     + Y+N
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRVKYEN 1203

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
           YJL074C (SMC3) - SMC chromosomal ATPase family member
           [contig 224] FULL
          Length = 1247

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 167/715 (23%), Positives = 302/715 (42%), Gaps = 87/715 (12%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I  + +  FK+Y     +  F   F+ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 210 LSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYID 269
              LIH+     ++ S  V+I F    D+   T+     +  +V  R+       +Y ++
Sbjct: 85  RQGLIHQGTG--SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 270 GKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGT 329
           GK  + ++++++    G    +   ++ QG + +++  K K ER      L  LED++G 
Sbjct: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDK-ER------LLLLEDVVGA 195

Query: 330 AKYKAGIEAGLVEIDTLN-------DVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXX 382
             ++  +     +++  N           E + R E +++E+  LE  ++          
Sbjct: 196 RSFEIKLRESSKKMEATNRDRAKITSELSELKARLEELDEERQELEKYQE---------- 245

Query: 383 XXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLG---QEKAKYDQ--FQRE--VAQLR 435
                     Q+ ++   R+L+E   +I  L +      Q   +Y Q  ++RE  +A L 
Sbjct: 246 --LERDRRIFQFVLY--DRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLT 301

Query: 436 ERCNDFKKQMVKLDKEHKDLTS-KRRLMDREKTSMEEKQRNLDKKRLKAE---------K 485
           +  ++ + ++ KL KE  D    K RL +  K   + + R  + KR + +         K
Sbjct: 302 KNISNVEAEL-KL-KESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRK 359

Query: 486 LLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISA 545
            L + E  + ++  +L  L+   +Q K +       L + + K  EI +S R     I A
Sbjct: 360 NLATVEEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQYQRKQREI-ISKRG----IYA 414

Query: 546 EIANH-ERDLEPWNA-QLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKN 603
           +  N  ERD   W A +L   K+Q    +  + I++  KE+    I Q K   EA  E N
Sbjct: 415 QFENQSERD--AWIAKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQQDK---EAITELN 469

Query: 604 N----------VQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAM 653
           +          +Q+I  H L   + + L++ID   KE   +  +L  +   L+   +R  
Sbjct: 470 DSVRGPGISSELQDIQTH-LNDLKRSYLEKID-ERKELWRSEQRLQTVSEALLDGVKR-- 525

Query: 654 EARSTLSNVENKNKV--LSALIRLQRSGRI--AGFHGRLGDLGTIDDMYDV-AISTACPR 708
            +   LS   ++N    L A+  + +  ++     HG LG+L  +++ Y   A +     
Sbjct: 526 -SERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPLGELIKVNEKYKTCAEAVGGNS 584

Query: 709 LDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPI---QTPETVPRLFDLVR 765
           L  +VVD  E     +  L   K G   FI L+++   N          E  P L+ +  
Sbjct: 585 LLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRNAVTFPENAQAECTPLLWKIKY 644

Query: 766 SKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGG 820
            K   F  A   V   T+VV DL   +++A        VTLDG   D  G ++GG
Sbjct: 645 DK--VFEKAVRHVFGRTIVVRDLGNGSKLARS-YNLDAVTLDGDRADNRGVITGG 696

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 88/187 (47%), Gaps = 26/187 (13%)

Query: 1253 RDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELEL------------- 1299
            ++ + K  E LKK++++     FS ++     +++ +   G   L +             
Sbjct: 1043 KESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGTGQ 1102

Query: 1300 -----------VDSLDPFSEGVLFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKY 1346
                        D+LD    GV  SV    K+     +  LSGG+KT+ ++AL+ A+   
Sbjct: 1103 RSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMV 1162

Query: 1347 RPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNN 1406
             P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R +M ++A     +   N 
Sbjct: 1163 DPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENK 1222

Query: 1407 MTRSTTL 1413
            ++   T+
Sbjct: 1223 ISEIATV 1229

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1174

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1321 WR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1380 AQFIVISLRNNMFELAQQL 1398
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 84/187 (44%), Gaps = 21/187 (11%)

Query: 689 GDLGTIDDMYDVAISTA-----CP--RLDDIVVDNVECGQQCIEHLRKNKLGYARFIILD 741
           G   T+  + D AI +A     C   RL ++VVDN     Q +E  R  K      I L+
Sbjct: 529 GVAATLFTINDNAIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRK--RVTIIPLN 586

Query: 742 KL--RKFNLSPIQ-TPETVPRLFDLVRSKNG---KFLPAFYSVLRDTLVVSDLKQANRVA 795
           K+  R+ N + +    +  P   DL  +  G   +   A   +   +L+  D + A +V 
Sbjct: 587 KIASRRLNENTVNFAKQLAPGKVDLALNLIGYSDELSRAMEFIFGTSLICKDSETAKKVT 646

Query: 796 YGKR-RFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQPGAGYT-----PEEVQNIEK 849
           + +  R R +TL+G + D  GTLSGG  +    L+   Q             E +++I+ 
Sbjct: 647 FHQNIRQRSITLEGDVYDPEGTLSGGSRNNKNSLLLDIQHYNKTCNEIKILEENLRDIKI 706

Query: 850 ELNEREK 856
           +LNE+EK
Sbjct: 707 KLNEQEK 713

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1227

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 151/708 (21%), Positives = 299/708 (42%), Gaps = 71/708 (10%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    +I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHF-----RYVVDESDGTTRSDDEKPPMVITRKAFRNNSS 264
              LIH+     ++ S SV+I F     + ++        ++DE    +  R+       
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPEHKMILPSGVVPRENNDE----ICIRRTVGLKKD 115

Query: 265 KYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLE 324
            Y ++ +     +V ++L   G  + +   ++ QG++ S++  K K ER      L+ LE
Sbjct: 116 DYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDK-ER------LQLLE 168

Query: 325 DIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXX 384
           D++G   ++  ++A L +++       E E +   + KE + L S   E           
Sbjct: 169 DVVGAKSFEVKLKASLKKME-------ETEQKRARIAKEMDELNSKLKEMEQERKELEKY 221

Query: 385 XXXXXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQ 444
                    +      R+L++ + ++  L++         +Q+ +E+ +  E  ++  K 
Sbjct: 222 NALEKNRKVFQFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKN 281

Query: 445 MVKLD---------------KEHKDLTSKRRLMDRE------KTSMEEKQRNLDKKRLK- 482
           + ++D                 H +LT++   +  +      +   +E+Q N D+K L  
Sbjct: 282 LSEIDSTLKIKTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDI 341

Query: 483 AEKLLKSTENSMADSKHKLEELNNSQKQYK---EKLLQLNESLLEERSKLDEIKLSLRDK 539
               ++  E  ++    K +EL+  + ++K    KL Q    LL ++ +      S+ ++
Sbjct: 342 INDEIQKREQKLSSISPKFQELSKEELKFKLQYNKLQQRQRDLLLKKGRYARFA-SIEER 400

Query: 540 TSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAF 599
              I  EI   ++ L+     L + K+++ +   +I     S ++ + N   L   IE  
Sbjct: 401 NEWIQNEIEESDKTLQG----LVDIKNKILIERDEINSKVRSLDEDIDN---LNDSIEGP 453

Query: 600 AEKNNVQEIA--IHKLQCE-QANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEAR 656
                ++ I   + KL+ E  A+I KR ++   E    +     ++NV +  R       
Sbjct: 454 NVTGELEVIQDELEKLKSEYAASIDKRKELWRNEQKIETVLQNLLENVKVLERNVNETMD 513

Query: 657 STLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDV-AISTACPRLDDIVVD 715
            +L+N     K ++  ++L          G LG+L  +++ Y + A       L  IVVD
Sbjct: 514 RSLANGIKSVKEIATKLKLPED----SVFGTLGELINVNEKYKICAEVVGGNSLFHIVVD 569

Query: 716 NVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSK---NGKFL 772
             E     ++ L K K G   FI L+++  +  + IQ P      F  + +K   + +F 
Sbjct: 570 TEETATIIMKELYKMKGGRVTFIPLNRI--YLDANIQYPPNDQTSFTPLINKIKYDQRFD 627

Query: 773 PAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGG 820
            A   +   T+VV DL    R++  K +   +TLDG   D  G L+GG
Sbjct: 628 KAVRHIFGKTIVVKDLTTGLRIS-KKFKLNSITLDGDRADKRGVLTGG 674

 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (55%), Gaps = 2/127 (1%)

Query: 1298 ELVDSLDPFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMD 1355
            E++++ +    GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1356 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQN 1415
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   +   N ++    +  
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYENKISTVIEVDK 1211

Query: 1416 IDILNGV 1422
             D +N +
Sbjct: 1212 QDAINFI 1218

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1224

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 166/743 (22%), Positives = 308/743 (41%), Gaps = 143/743 (19%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I  + +  FK+Y  T  +      F+ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYID 269
              LIH+     ++ S  V+I F     +   T+     +  +V  R+       +Y ++
Sbjct: 61  RQGLIHQGTG--SVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDEYSVN 118

Query: 270 GKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGT 329
           GK  + ++++++    G    +   ++ QG + +++  K + ER      L  LE+++G 
Sbjct: 119 GKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAKDR-ER------LALLEEVVGA 171

Query: 330 AKY-----------------KAGIEAGLVE----IDTLNDVCVEKEN-----------RF 357
             +                 +  I++ L E    +D LN+   E E            +F
Sbjct: 172 KSFEIKLRESAKKMEATNRDRTRIDSELAELRTRLDELNEERQELEKYQKLERDRRIFQF 231

Query: 358 ELVEKEKN----SLESGKDEAXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISEL 413
            L ++E N     +ES +DE                     H+ Q   +  + L K  EL
Sbjct: 232 VLYDRELNEVTSQIESLEDEYN-------------------HVLQSSEEFLQELYKREEL 272

Query: 414 NEH-------------------LGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKD 454
            E+                   L QEK++  +  +  A L     + K+Q     + HK 
Sbjct: 273 IENVTKNISNIETELRVKESMDLQQEKSRLQEISKRKADLEVHLEEAKRQA----EAHKK 328

Query: 455 LTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEK 514
            TS       ++ +++  +  ++KK L+ E+L+   E   ++S+    +L+N Q+  +E 
Sbjct: 329 QTSV------DQNNLKTVEEEIEKKSLQLERLIPRFEQLKSESQEFESQLSNYQRSQRE- 381

Query: 515 LLQLNESLLEERSKLDEIKLSL-RDK--TSEISAEIANHERDLEPWNAQLQEKKSQMKLT 571
                  ++ +R    + K  + RD+   +EI++  A H+ DL    A L  +K Q   T
Sbjct: 382 -------IVSKRGIYAQFKSKVERDEWLKNEIASLKAQHQ-DLAEQLAALTREKEQ---T 430

Query: 572 ESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKEC 631
            S++ +  E        I +L   +     +  +Q++  H L   + + L +ID   KE 
Sbjct: 431 GSEVEVFNE-------EITELNDSVRGPGIQAELQDLQSH-LDSLKQSYLGKID-ERKEL 481

Query: 632 GSASSKLGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQR--SGRIA----GFH 685
             A  K   + + L    +R+    S     E  ++ L++ +R  R  S R+       H
Sbjct: 482 WRAEQKFLTVSDALNDGVKRSERNLS-----ETMDRGLASGLRAVREISERLKLPADSVH 536

Query: 686 GRLGDLGTIDDMYDV-AISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLR 744
           G LG+L  +++ Y   A +     L  +VVD  E     +E L   K G   FI L+++ 
Sbjct: 537 GPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPLNRIA 596

Query: 745 KFNLSPIQTP-----ETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKR 799
             N  P+  P     E  P ++ +   K  +F  A   V   T+VV D+   +++A   +
Sbjct: 597 DSN--PVTFPDNSQAECTPLIWKMKYEK--RFEKAVRHVFGRTIVVRDIGTGSKLA---K 649

Query: 800 RFRV--VTLDGKLIDTSGTLSGG 820
            F +  VTLDG   D  G ++GG
Sbjct: 650 SFNLDAVTLDGDRTDKRGLITGG 672

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 69/121 (57%), Gaps = 2/121 (1%)

Query: 1301 DSLDPFSEGVLFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEID 1358
            DS++    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1359 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDI 1418
            AALD +  + VAN IKE + +AQFI  + R++M ++A     +  +N ++  + +   D 
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRVRFDNKISEISAVSQQDA 1211

Query: 1419 L 1419
            +
Sbjct: 1212 I 1212

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 66/109 (60%), Gaps = 2/109 (1%)

Query: 1302 SLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDA 1359
            S++    GV  SV     K   +++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1360 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMT 1408
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A +   +   N ++
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRVKYENKIS 1204

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 64/141 (45%), Gaps = 11/141 (7%)

Query: 686 GRLGDLGTIDDMYD-VAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLR 744
           G LG+L  ++D Y   A       L  IVVD  E     I+ L + K G   F+ L+++ 
Sbjct: 537 GTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRVY 596

Query: 745 K---FNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRF 801
                   P +     P L   +R  + +F  A   V   T+VV DL    R+A   +RF
Sbjct: 597 SDPNITYPPNEQASCTP-LIKKIRY-DARFEKAVKQVFGKTIVVRDLSTGARLA---KRF 651

Query: 802 RV--VTLDGKLIDTSGTLSGG 820
           R+  +TLDG   D  G L+GG
Sbjct: 652 RLNAITLDGDRADKKGALTGG 672

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 63/103 (61%), Gaps = 3/103 (2%)

Query: 1305 PFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1362
            P   GV  SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1363 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI-YKN 1404
             +  + VAN +KE +KNAQFI  + R +M ++A +   + Y+N
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRVKYEN 1201

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 109/233 (46%), Gaps = 25/233 (10%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    II  F    + ++G NGSGKSN+  ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 210 LSDLIHK-SEAYPNLESCSVDIHFR------YVVDESDGTTRSDDEKPPMVITRKAFRNN 262
              LIH+ +    ++ SCSV+I F        +   +    R ++E    V  R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFHDPDNRMILASNASIVPRPNNE----VFIRRTVGLK 116

Query: 263 SSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEY 322
              Y I+ +    +++ ++L   G  + +   ++ QG++ +++  K K ER      L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDK-ER------LQL 169

Query: 323 LEDIIGTAKYKAGIEAGLVEI-------DTLNDVCVEKENRFELVEKEKNSLE 368
           LED++G   ++  +   L +I        T++    E +N+   +E EK  LE
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKIKETEFKKSTIDKELSELKNKLNEMEWEKLELE 222

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 61/140 (43%), Gaps = 8/140 (5%)

Query: 686 GRLGDLGTIDDMYDVAIST-ACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLR 744
           G +G+L    + Y   +      +L  I+VD  E     ++ L + K G   FI L+K+ 
Sbjct: 543 GTVGELIKASEKYKNCVEIIGGNQLFHIIVDTEETASLLMQELYRMKGGRVTFIPLNKI- 601

Query: 745 KFNLSPIQTP--ETVPRLFDLVRS--KNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRR 800
            +N   I  P  +       L++      KF  A   +   T+VV DL    ++A  K +
Sbjct: 602 -YNDPNITYPPADQYSSFTPLIKKLKYESKFEGAMKHIFGKTIVVKDLSYGLKLA-KKFK 659

Query: 801 FRVVTLDGKLIDTSGTLSGG 820
              +TLDG   D  G L+GG
Sbjct: 660 LNAITLDGDRADKRGVLTGG 679

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 102/202 (50%), Gaps = 18/202 (8%)

Query: 1239 YKKRKLDLNQAVLKRDE----VRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGN 1294
            + ++K++LN+   + D+    ++   E+LK++++      F  +S     +++ +   G 
Sbjct: 1001 FNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGT 1060

Query: 1295 AELEL------------VDSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALV 1340
            A+L +             +S +    G+  SV     K    ++  LSGG+KT+ ++AL+
Sbjct: 1061 AKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALI 1120

Query: 1341 FALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1400
             A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A +   
Sbjct: 1121 LAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFR 1180

Query: 1401 IYKNNNMTRSTTLQNIDILNGV 1422
            +   N ++    ++  + +N +
Sbjct: 1181 VKYENKISTVVEVERQEAINFI 1202

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 15/146 (10%)

Query: 683 GFHGRLGDLGTIDDMYD-VAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILD 741
              G LG+L  + + Y   A       L ++VVD  E     +  L   K G   F+ L+
Sbjct: 534 AVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPLN 593

Query: 742 KLR---KFNLSPIQTPETVPRL----FDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRV 794
           ++         P +     P +    +D+      ++  A   +   T+VV DL + +++
Sbjct: 594 RIHVDNNITYPPNEQASCTPLIKKIKYDV------RYEKAVKHIFGRTIVVKDLLEGSKI 647

Query: 795 AYGKRRFRVVTLDGKLIDTSGTLSGG 820
           A  K +   VTLDG   D  G L+GG
Sbjct: 648 A-KKLKLNAVTLDGDRADKMGVLTGG 672

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 1303 LDPFSEGVLFSV-MPPKKSWR-NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA 1360
            L+    GV  SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1361 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI-YKN 1404
            LD +  + VAN IK+ +KNAQFI  + R +M  +A +   + Y+N
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRFYRVKYEN 1199

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 90/195 (46%), Gaps = 17/195 (8%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    II  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHF----RYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
              LIH+     ++ S SV+I F      ++  S    R +DE    V  R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILSSGVIPRPNDE----VFVRRTVGLKKDD 114

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y I+ +    +++ ++L   G  +     ++ QG + +++  K K ER      L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDK-ER------LLLLED 167

Query: 326 IIGTAKYKAGIEAGL 340
           +IG   ++  + A L
Sbjct: 168 VIGAKSFETKLRASL 182

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 1309 GVLFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1366
            GV  SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1367 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMT 1408
            + VA  IK  + NAQFI  + R +M ++A +   +   N ++
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRVKYENKIS 1200

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 94/195 (48%), Gaps = 17/195 (8%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    +I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHF----RYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
              LIH+     ++ S SV+I F      ++  S    RS+DE    V+ R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILPSGVAPRSNDE----VLVRRTVGLKKDD 114

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y ++ +     +V ++L   G  +++   ++ QG + +++  K K ER      L+ LED
Sbjct: 115 YQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDK-ER------LQLLED 167

Query: 326 IIGTAKYKAGIEAGL 340
           ++G   ++  + A L
Sbjct: 168 VVGAKSFEVKLRASL 182

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 65/124 (52%), Gaps = 2/124 (1%)

Query: 1301 DSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEID 1358
            D+ D    GV   V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1359 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDI 1418
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   +   N ++    +   D 
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRVKYENKISTVVEVTRTDA 1212

Query: 1419 LNGV 1422
            L+ V
Sbjct: 1213 LHFV 1216

 Score = 57.4 bits (137), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 90/196 (45%), Gaps = 12/196 (6%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I K+ +  FK+Y     I  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYID 269
              LI+  +   ++ S  V+I F    D  + T     +    +  R+       +Y I+
Sbjct: 61  RRSLIY--QGTSSVMSGYVEIVFH---DAENRTLLGIPDSNGAIRIRRTVGLKKDEYMIN 115

Query: 270 GKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGT 329
            K S+ ++V +LL   G    +   ++ QG + S++  K + ER      L+ LE+++G 
Sbjct: 116 NKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAKDR-ER------LQLLEEVVGA 168

Query: 330 AKYKAGIEAGLVEIDT 345
             ++  ++  L  +D 
Sbjct: 169 KSFERKLKESLQRMDA 184

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 54/83 (65%), Gaps = 1/83 (1%)

Query: 1323 NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1382
            ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQF
Sbjct: 1108 HVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYRTAVADVIKSLSSNAQF 1167

Query: 1383 IVISLRNNMFELAQQLVGI-YKN 1404
            I  + R +M ++A +   + Y+N
Sbjct: 1168 ICTTFRTDMLQVADKFFRVKYEN 1190

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 67/145 (46%), Gaps = 19/145 (13%)

Query: 686 GRLGDLGTIDDMYD-VAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLR 744
           G LG+L  + + Y   A       L +IVVD  E     ++ L + K G   F+ L+++R
Sbjct: 537 GTLGELIKVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRIR 596

Query: 745 ---KFNLSPIQTPETVPRL----FDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYG 797
               F   P       P +    FD+      ++  A   V   T+VV DL + +++A  
Sbjct: 597 MDSNFTYPPNDQASCTPLIKKIKFDV------RYEKAVMHVFGKTIVVKDLGEGSKLA-- 648

Query: 798 KRRFRV--VTLDGKLIDTSGTLSGG 820
            +RF++  +TLDG   D  G L+GG
Sbjct: 649 -KRFKMNAITLDGDRADKRGELTGG 672

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 116/231 (50%), Gaps = 29/231 (12%)

Query: 1199 QLQSIQIEDVELQIDELNHYVDNA-HVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVR 1257
            + +++  ED+ L+++E N  +    +++    E Y +    + +++ +L +   + D+ +
Sbjct: 967  KFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKK----FNEKQSELRERATELDDSK 1022

Query: 1258 KNCEEL----KKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELV--------DSLDP 1305
            ++ ++L    K+++L+   + F  +S     +++ I   G A L +         D+ + 
Sbjct: 1023 QSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNSEL 1082

Query: 1306 FS---------EGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYRPTPLYVM 1354
            F+         EGV  SV    K      +  LSGG+KT+ ++AL+ A+    P P Y+ 
Sbjct: 1083 FTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLF 1142

Query: 1355 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI-YKN 1404
            DEIDAALD +    VA  I + + NAQFI  + R++M + A +   + Y+N
Sbjct: 1143 DEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYEN 1193

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 95/200 (47%), Gaps = 17/200 (8%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    IIG F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHFR-----YVVDESDGTTRSDDEKPPMVITRKAFRNNSS 264
              LIH+  A  ++ S SV+I F       +      +  S DE    V  R+       
Sbjct: 61  RQGLIHQG-AGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDE----VRIRRTVGLKKD 115

Query: 265 KYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLE 324
            Y ++ +     ++ ++L   G  + +   ++ QG + S++  K K ER      L+ LE
Sbjct: 116 DYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDK-ER------LQLLE 168

Query: 325 DIIGTAKYKAGIEAGLVEID 344
           +++G   ++  ++A + ++D
Sbjct: 169 EVVGAKSFEVKLKASMKQMD 188

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 54/83 (65%), Gaps = 1/83 (1%)

Query: 1323 NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1382
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQF 1181

Query: 1383 IVISLRNNMFELAQQLVGI-YKN 1404
            I  + R +M ++A +   + Y+N
Sbjct: 1182 ICTTFRTDMLQVADKFFRVKYEN 1204

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 95/195 (48%), Gaps = 16/195 (8%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    II  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHF----RYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
              LIH+     ++ S SV+I F      ++  S   +R DDE    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y ++ +     ++ ++L   G  +++   ++ QG++ +++  K K ER      L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK-ER------LQLLED 168

Query: 326 IIGTAKYKAGIEAGL 340
           ++G   ++  ++A L
Sbjct: 169 VVGAKSFEVKLKASL 183

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 81/149 (54%), Gaps = 4/149 (2%)

Query: 1263 LKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKS-- 1320
            LK+++++     F+ +S    ++++ +   G  EL +      +S GV   V    K+  
Sbjct: 955  LKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDE 1013

Query: 1321 WRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1380
               I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++N 
Sbjct: 1014 QLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNG 1073

Query: 1381 -QFIVISLRNNMFELAQQLVGIYKNNNMT 1408
             QFI+ + R++M E+A  +  +  +N ++
Sbjct: 1074 TQFILTTFRSDMIEIADMIYMVKYHNKVS 1102

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (47%), Gaps = 5/146 (3%)

Query: 682 AGFHGRLGDLGTIDDMYDVAIST-ACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIIL 740
              +G LG+L  + + Y   +   A   L +I+VD  E   Q +  L + + G   FI L
Sbjct: 459 TSIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPL 518

Query: 741 DKLRK-FNLS-PIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGK 798
           +++    N++ P         L   ++  + KF     +V   T+VV DL+  NR+   +
Sbjct: 519 NRIENGVNINYPSNEESNCTALIKKIKY-DKKFEKVIRNVFGKTIVVKDLQLGNRLC-KE 576

Query: 799 RRFRVVTLDGKLIDTSGTLSGGGTHV 824
            + + +TLDG  ID+ G +SGG  ++
Sbjct: 577 FKLQAITLDGDRIDSKGVVSGGYFNI 602

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 1323 NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1382
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + NAQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATMIKELSTNAQF 1181

Query: 1383 IVISLRNNMFELAQQLVGI-YKN 1404
            I  + R +M ++A +   + Y+N
Sbjct: 1182 ICTTFRTDMLQVADKFFRVKYEN 1204

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 95/195 (48%), Gaps = 16/195 (8%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    II  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHF----RYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
              LIH+     ++ S SV+I F      ++  S   +R DDE    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y ++ +     ++ ++L   G  +++   ++ QG++ +++  K K ER      L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK-ER------LQLLED 168

Query: 326 IIGTAKYKAGIEAGL 340
           ++G   ++  ++A L
Sbjct: 169 VVGAKSFEVKLKASL 183

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 57/100 (57%)

Query: 1323 NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1382
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181

Query: 1383 IVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILNGV 1422
            I  + R +M  +A +   +   N ++    +   + LN V
Sbjct: 1182 ICTTFRGDMIAVADRFYRVNFENKISTVVEVTKAEALNFV 1221

 Score = 56.2 bits (134), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 94/201 (46%), Gaps = 23/201 (11%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I K+ +  FK+Y     I  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHF-----RYVVDESDGTTRSDDEKPPMVITRKAFRNNSS 264
              LI+  +   ++ S  V+I F     R ++   DG          ++  R+       
Sbjct: 61  RRSLIY--QGTSSVMSGYVEIVFHGAENRTLLGAQDG---------GVIHIRRTVGLKKD 109

Query: 265 KYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLE 324
           +Y I+ K ++ ++V +LL   G    +   ++ QG + S++  + + ER      L+ LE
Sbjct: 110 EYMINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNR-ER------LQLLE 162

Query: 325 DIIGTAKYKAGIEAGLVEIDT 345
           ++IG   ++  ++  L +++T
Sbjct: 163 EVIGAKSFERKLKESLQKMET 183

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 1323 NISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1382
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + +AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSNDAQF 1181

Query: 1383 IVISLRNNMFELAQQLVGI-YKN 1404
            I  + R +M ++A +   + Y+N
Sbjct: 1182 ICTTFRTDMLQVADKFFRVKYEN 1204

 Score = 65.9 bits (159), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 94/195 (48%), Gaps = 16/195 (8%)

Query: 150 LCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           + I ++ +  FK+Y    II  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 210 LSDLIHKSEAYPNLESCSVDIHF----RYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
              LIH+     ++ S SV+I F      ++  S   +R DDE    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y ++ +     ++ ++L   G  + +   ++ QG++ +++  K K ER      L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDK-ER------LQLLED 168

Query: 326 IIGTAKYKAGIEAGL 340
           ++G   ++  ++A L
Sbjct: 169 VVGAKSFEVKLKASL 183

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (54%)

Query: 1324 ISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1383
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1384 VISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420
              + R +M  +A     +   N ++  T +   D +N
Sbjct: 1177 CTTFRTDMINVADTFFRVKFENKVSTVTEVSRQDAVN 1213

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 81/189 (42%), Gaps = 12/189 (6%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS 211
           I  + +  FK+Y    ++  F    + VVG NGSGKSN   ++ FV     + +++    
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 212 DLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGK 271
             I++      + S  V+I F    +      R+D      V  R+       +Y I+ K
Sbjct: 64  GFIYQGAG--QVMSAFVEIIFDDPENLMLAPLRND---TGEVRIRRTVGLKKDEYMINDK 118

Query: 272 ESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAK 331
            S   +V ++L + G    +   ++ QG + S++  K       D   L  LED++G   
Sbjct: 119 NSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLEDVVGAKS 171

Query: 332 YKAGIEAGL 340
           ++  ++  L
Sbjct: 172 FENKLKESL 180

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 83/161 (51%), Gaps = 20/161 (12%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS 211
           + +L LHNF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + K S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 212 DLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNN--SSKYYID 269
           D   K+ A    +S  +D+   ++  E  GTT        + ++R   RN+  +S YY+D
Sbjct: 115 DSFIKNGA----DSARIDV---WLAGEDPGTT--------LKVSRVLTRNHKKASLYYVD 159

Query: 270 GKESNYTEVTQLLRDQ-GIDLDHKRFLILQGEVESISQMKP 309
           G E++   V QL+  Q  I LD+    + Q  V+  ++++P
Sbjct: 160 GVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 83/186 (44%), Gaps = 46/186 (24%)

Query: 1204 QIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKR------KLDLNQAVLK--RDE 1255
            Q+E +E +I  +NH  D +   I +L+E  R+LA+ K R      KLD   A +   + E
Sbjct: 885  QVERLESEIRMINH--DES--SIAILQEVERKLADVKARLPAMVRKLDAATASMSTMQAE 940

Query: 1256 VRKNCEELKKKRLDKFMEGFS------IISMTLKEMYQ------MITMGGNAELELVDSL 1303
            +    + + +K  ++F   F+       I ++   +YQ      M+    NA L+ +DS 
Sbjct: 941  LEPRLDTIVEKISERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDS- 999

Query: 1304 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDF 1363
                                    SGGE+ +S++  + AL ++   P  V+DEI+  +D 
Sbjct: 1000 ---------------------HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQ 1038

Query: 1364 RNVSIV 1369
            RN  IV
Sbjct: 1039 RNERIV 1044

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 57.4 bits (137), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 88/187 (47%), Gaps = 27/187 (14%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 208
           I  L L NF +YA T+    FH S   + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYALTE----FHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 209 KLSDLIHKSEAYPNLESC---SVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNN-SS 264
           K+ D I   E    +E       +   RYV   SDGTT+         +TR   RN  +S
Sbjct: 103 KIEDYIKNGEDRSVIEVTLKRDPEAEDRYVA--SDGTTK---------VTRVLHRNRKAS 151

Query: 265 KYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP-----KAERESDDGL 319
           +Y+++G+    + V +L+ +  I LD+    + Q  VE  +++K      +  R  D  +
Sbjct: 152 EYFLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLKSDKLLVETARSVDVNM 211

Query: 320 LEYLEDI 326
           +  LED+
Sbjct: 212 VADLEDL 218

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1385 IS 1386
            ++
Sbjct: 1049 VT 1050

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 83/183 (45%), Gaps = 27/183 (14%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 209
           I KL L N  +Y+ T+  + P   S + +VGPNGSGKS  + ++      +   + R  K
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 210 LSDLIHKSEAYPNLESCSVDIHFR-YVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYI 268
           + + I   E      +  +D   R ++ +E    TR        ++TR       S+YYI
Sbjct: 94  IDNFIKNGE-----NTAQIDTFLRGHMPNEVIKITR--------IMTRNK---KKSEYYI 137

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP-----KAERESDDGLLEYL 323
           D   S  T V +L  +  I LD+    + Q  VE  +++K      +  R  +  LLE L
Sbjct: 138 DDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLETL 197

Query: 324 EDI 326
           ED+
Sbjct: 198 EDL 200

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1385 IS 1386
            I+
Sbjct: 1035 IT 1036

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 87/185 (47%), Gaps = 17/185 (9%)

Query: 148 HRLCIDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 206
           H   I K+ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   ++
Sbjct: 32  HPGAIVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIK 88

Query: 207 QGK-LSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNS-S 264
           + K + D I   E     +  S++I  +    + +G    D E   + ITR+  ++ S S
Sbjct: 89  RSKRVEDFIKNGE-----DRGSIEITLKN-SPKVEGMPGVDSEADTIKITRELIKSKSKS 142

Query: 265 KYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMK-----PKAERESDDGL 319
           +Y I+ +  +  +V  L+    I LD+    + Q  VE  +++K      +  R  D  L
Sbjct: 143 RYMINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKL 202

Query: 320 LEYLE 324
           L+ LE
Sbjct: 203 LDVLE 207

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENTSQYFL 1040

Query: 1385 IS 1386
            I+
Sbjct: 1041 IT 1042

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 3/85 (3%)

Query: 1305 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFR 1364
            P  + +++++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1365 NVSIVANYIKERTKN---AQFIVIS 1386
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

 Score = 36.2 bits (82), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 208
           I K+SL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A+   +G
Sbjct: 74  IKKVSLRNFMCHENFELALGP---RLNFIVGNNGSGKSAILTAITIGLGAKASDTNRG 128

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 82/188 (43%), Gaps = 23/188 (12%)

Query: 151 CIDKLSLHNFKSYAGTQIIGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQ 207
            + KL L NF +YA T+    FH   S + ++GPNGSGKS  + ++      +   + R 
Sbjct: 59  AVVKLKLTNFVTYALTE----FHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRS 114

Query: 208 GKLSDLIHKSE----AYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNS 263
            K+ + I            L++ S  +H       SD    + D+    V    +     
Sbjct: 115 KKVEEYIKNGTDEGVIEITLKNSSALLH-------SDFNMINTDDDVVHVKRVLSMEKKK 167

Query: 264 SKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP-----KAERESDDG 318
           SKYYI+ K      V  ++R   I LD+    + Q  VE  +++KP     +  R  + G
Sbjct: 168 SKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRSIEAG 227

Query: 319 LLEYLEDI 326
           LLE L ++
Sbjct: 228 LLEKLSEL 235

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 93/216 (43%), Gaps = 37/216 (17%)

Query: 1197 EAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKR------KLDLN-QA 1249
            E Q  SI IE +  ++      ++N    ID+L++    ++  +K       KL  N Q 
Sbjct: 885  ENQFSSIHIESIINRLSSELSMINNDTSVIDILKKTNEDISILEKTLPHLRAKLASNAQT 944

Query: 1250 VLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1309
            +L   E+R + E     RLD  ++    IS     ++  +   G  EL+  DS + +   
Sbjct: 945  IL---EIRNSLE----PRLDDIVKQ---ISKKFSHLFAYVGSAGQVELKKPDSFNDW--- 991

Query: 1310 VLFSVMPPKKSWRNISNL--------SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAAL 1361
                 +  K  +R+ S L        SGGE+ +S++  + AL ++  +P  V+DEI+  +
Sbjct: 992  ----CIEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGM 1047

Query: 1362 DFRNVSIVA-----NYIKERTKNAQFIVISLRNNMF 1392
            D  N  IV      N   E T     I   L  N+F
Sbjct: 1048 DQTNERIVHRIMVENACAENTSQYFLITPKLLTNLF 1083

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (44%), Gaps = 24/181 (13%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 208
           I K+ L NF +YA T+    FH   S + ++GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYALTE----FHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 209 KLSDLIHKSEAYPNLESCSVDIHFR--YVVDESDGTTRSDDEKPPMVITRKAFRN-NSSK 265
           ++ D I   E     + C ++I  +    +        SDD    + ITR   R+   S 
Sbjct: 104 RVEDFIKNGE-----DECEIEITLKNNSKIQGIANVLSSDD---VIKITRVLIRHRKKSD 155

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLED 325
           Y+I+ + ++   V  ++    I LD+    + Q  VE  +++K      SD  L E +  
Sbjct: 156 YFINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK------SDKLLFETIRS 209

Query: 326 I 326
           I
Sbjct: 210 I 210

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1385 ISLRNNMFELAQQLVGIYKNNNM 1407
            I+         + L G+Y +  M
Sbjct: 1054 IT--------PKLLTGLYYHEKM 1068

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
            YOL034W - Protein required for cell viability [contig 47]
            FULL
          Length = 1117

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 1268 LDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL 1327
            +D  +EG   IS+    ++Q +  GG+  LE  +    +   ++          +  S +
Sbjct: 954  VDGIVEG---ISINFSRLFQNVGSGGSVVLEKNELFSNWKINIMVRFRDSALMKKLDSQI 1010

Query: 1328 -SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFI 1383
             SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I
Sbjct: 1011 QSGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYI 1070

Query: 1384 VIS 1386
            +++
Sbjct: 1071 LVT 1073

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 23/179 (12%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 209
           I KL L NF +Y+ T+    FH   S + ++GPNGSGKS  + ++      +   + +GK
Sbjct: 69  IVKLRLENFVTYSLTE----FHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 210 LSDLIHKSEAYPNLESCSV--DIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYY 267
             D   K+     L   ++  D          DGTT+         ++R  +    S+YY
Sbjct: 125 RVDSFIKNGENRGLIEVTLKRDPGRTGSFVAVDGTTK---------VSRVLWVGKKSEYY 175

Query: 268 IDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDI 326
           ++ +  +   V  L+ +  I LD+    + Q  VE  +++K      SD  L+E +  +
Sbjct: 176 LNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK------SDKLLMETVRSV 228

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1311 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1370
            +F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 996  IFILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGT 1055

Query: 1371 NYIKERTKN---AQFIVIS 1386
              I  + K+    Q I+I+
Sbjct: 1056 KLILNKLKDIARTQTIIIT 1074

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 209
           I K+ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G RA    +G  
Sbjct: 75  IKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGNS 131

Query: 210 LSDLI 214
           L DLI
Sbjct: 132 LKDLI 136

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 151 CIDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 208
           CI K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 41  CITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 209 KLSDLIHKSEAYPNLESC---SVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK 265
           K+ D I   +    +E     S  +H    ++  D T      K   +ITR   R   S 
Sbjct: 98  KVEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETI-----KITRIITRSKRR---SD 149

Query: 266 YYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMK 308
           Y I+  + +   V  L+    I LD+    + Q  VE  +++K
Sbjct: 150 YLINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1385 ISLRNNMFELAQQLVGIYKNNNM 1407
            I+         + L G+Y +  M
Sbjct: 1047 IT--------PKLLTGLYYHEKM 1061

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 85/189 (44%), Gaps = 27/189 (14%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 209
           I K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  K
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 210 LSDLIHKSEAYPNLE-----SCSV-DIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNS 263
           + D I   +    +E     S  + DI F    DE+   TR        +ITR   R   
Sbjct: 99  VEDFIKNGQDTSRIEITLKNSPKIHDIEFINTHDETIKVTR--------IITRSKRR--- 147

Query: 264 SKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP-----KAERESDDG 318
           S Y I+ ++ +   V  L+    I LD+    + Q  VE  +++K      +  R  D  
Sbjct: 148 SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDAS 207

Query: 319 LLEYLEDII 327
           LL+ L++++
Sbjct: 208 LLDVLDELM 216

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 97/216 (44%), Gaps = 31/216 (14%)

Query: 1182 DEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKK 1241
            +EYE E +  LP   +       I+ +E +I  +NH  D + + I  L++    L E ++
Sbjct: 853  EEYEKERNFNLPFIQDV------IDKLESEIAMVNH--DESAITI--LDQVVTELRELEQ 902

Query: 1242 ------RKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNA 1295
                  + L++ +A LK D        + + +LD+ +   S IS     ++  +   G  
Sbjct: 903  IVPQQTKDLEITKAKLKEDHA------ILEPKLDEIV---SKISTRFARLFNNVGSAGAV 953

Query: 1296 ELELVDSLDPFSEGVL--FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYV 1353
             LE       +   V+  F    P K   + +  SGGE+ +S++  + AL ++   P  V
Sbjct: 954  HLEKPKDYAEWKIEVMVKFRDNAPLKKLDSHTQ-SGGERAVSTVLYMIALQEFTSAPFRV 1012

Query: 1354 MDEIDAALDFRNVSIVANYIKERT---KNAQFIVIS 1386
            +DEI+  +D RN  IV   + E       +Q+ +I+
Sbjct: 1013 VDEINQGMDSRNERIVHKAMVENACAENTSQYFLIT 1048

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 107/235 (45%), Gaps = 33/235 (14%)

Query: 151 CIDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 208
            I K+ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 37  SIVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAK 93

Query: 209 KLSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDE-----KPPMVITRKAFRNNS 263
           ++ D I   E     ++  ++I  +   D ++  +  + +     K  + +TR   R+ +
Sbjct: 94  RVDDFIKNGE-----DTSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGN 148

Query: 264 ---SKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP-----KAERES 315
              S Y+I+ K      +  L++   I LD+    + Q  VE  +++K      +  R  
Sbjct: 149 KCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSI 208

Query: 316 DDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESG 370
           D  LL+ L+D+  +   +  +E         N+V + K+ RF  +E ++N LE+ 
Sbjct: 209 DAQLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETDRNKLEAS 253

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1385 IS 1386
            I+
Sbjct: 1050 IT 1051

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar
           to uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 14/80 (17%)

Query: 146 CVHRLC---------IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSML 195
           C HR           I KL+LHNF  +    + +GP     + +VG NGSGKS ++ ++ 
Sbjct: 65  CAHRDIGLISPPPGYIKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAIT 121

Query: 196 FVFGFRANKMRQG-KLSDLI 214
              G +A++  +G  L DLI
Sbjct: 122 IGLGAKASETNRGSSLKDLI 141

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1311 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1370
            +  + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +
Sbjct: 1004 ILILTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGS 1063

Query: 1371 NYIKERTK---NAQFIVIS 1386
              I ++ K   N Q I+I+
Sbjct: 1064 KLIVKKLKDIPNTQTIIIT 1082

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 108/219 (49%), Gaps = 37/219 (16%)

Query: 1182 DEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKK 1241
            ++YE+E+S  L       L++I   + E+QI  +NH  D + + I       + L++ K 
Sbjct: 858  NKYEDESSFTLTTV----LETIAKLETEIQI--INH--DESAIKI-----LKQTLSDIKY 904

Query: 1242 RKLDLNQAVLKRDEVRKNCEELKKK---RLDKFMEGFSIISMTLKEMYQMITMGGNAELE 1298
             +  L   V +   +R+    ++ +   RLD+ +E    IS   ++++  + +G   E+ 
Sbjct: 905  LQEKLPGQVKRLSSIRRKMWSIRSELEPRLDEIVEN---ISTRFRKLF--LNVGSAGEVC 959

Query: 1299 LVDSLDPFSEGVLFSVMPPKKSWRNISNL--------SGGEKTLSSLALVFALHKYRPTP 1350
            LV   D +SE  +      K  +R+++ L        SGGE+ +S++  + +L ++   P
Sbjct: 960  LVKP-DLYSEWKI----EIKVKFRDVAELKKLDSHIQSGGERAVSTVLYMISLQEFTNAP 1014

Query: 1351 LYVMDEIDAALDFRNVSIVANYIKER--TKN-AQFIVIS 1386
              V+DEI+  +D RN  IV   + E    KN +Q+ +I+
Sbjct: 1015 FRVVDEINQGMDARNERIVHKAMVENACAKNTSQYFLIT 1053

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 69/161 (42%), Gaps = 12/161 (7%)

Query: 151 CIDKLSLHNFKSYAGTQIIGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQ 207
            I KL L NF +Y+ T+    FH S   + ++GPNGSGKS+ + ++      +   + R 
Sbjct: 45  AIIKLRLVNFVTYSLTE----FHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRA 100

Query: 208 GKLSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYY 267
            K+ D I        +E   + +     V        SD+      +  KA       YY
Sbjct: 101 KKVEDFIKNGTEESVIE---LTVKNSKAVSGYSMIGGSDEVINIKTVIMKA--KKKCIYY 155

Query: 268 IDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMK 308
           I+G+     +V  L+    I LD+    + Q  VE  +++K
Sbjct: 156 INGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK 196

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 78/184 (42%), Gaps = 17/184 (9%)

Query: 151 CIDKLSLHNFKSYAGTQIIGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQ 207
            I  + L NF +Y+    +  FH S   + ++GPNGSGKS  + ++      +   + R 
Sbjct: 45  AIVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRA 100

Query: 208 GKLSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYY 267
            ++ D I    A       +++I  R   + S     S +++   V T          YY
Sbjct: 101 KRVEDFIKNGTA-----ESTIEIQLRNSRNVSGLPMISAEDEAINVRTVLMKARRKCAYY 155

Query: 268 IDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP-----KAERESDDGLLEY 322
           I+G+  +  ++  L+    I LD+    + Q  VE  +++K      +  R  D  LL  
Sbjct: 156 INGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLLGL 215

Query: 323 LEDI 326
           LE +
Sbjct: 216 LEQL 219

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 63/131 (48%), Gaps = 21/131 (16%)

Query: 1267 RLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1326
            RLD+ +E    IS   ++++    +G   E+ L+   D +SE  +      +  +R+++ 
Sbjct: 933  RLDELVEN---ISQRFRKLFS--NVGSAGEICLLKP-DLYSEWKI----EIRVKFRDVAE 982

Query: 1327 L--------SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT- 1377
            L        SGGE+ +S++  + AL  +   P  V+DEI+  +D R   IV   + E   
Sbjct: 983  LKKLDSHTQSGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENAC 1042

Query: 1378 --KNAQFIVIS 1386
                +Q+ +I+
Sbjct: 1043 AENTSQYFLIT 1053

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 82/188 (43%), Gaps = 27/188 (14%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 209
           I K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  K
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 210 LSDLIHKSEAYPNLESC------SVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNS 263
           + D I   +    +E          DI +    DE+   TR        +ITR   R   
Sbjct: 99  VEDFIKNGQDVSKIEITLKNSPNVTDIEYIDARDETIKITR--------IITRSKRR--- 147

Query: 264 SKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP-----KAERESDDG 318
           S Y I+  + + + V  L+    I LD+    + Q  VE  +++K      +  R  D  
Sbjct: 148 SDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDAS 207

Query: 319 LLEYLEDI 326
           LL+ L+++
Sbjct: 208 LLDVLDEL 215

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1385 IS 1386
            I+
Sbjct: 1047 IT 1048

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1311 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1370
            +F +    +  RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 981  MFVLTANDEKPRNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGT 1040

Query: 1371 NYIKERTKN---AQFIVIS 1386
              + ++ K+    Q I+I+
Sbjct: 1041 TLVVKKLKDLARTQTIIIT 1059

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 209
           I K+SL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A+   +G  
Sbjct: 64  IKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTAITIALGAKASDTNRGNS 120

Query: 210 LSDLI 214
           L +LI
Sbjct: 121 LKELI 125

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 99/467 (21%), Positives = 180/467 (38%), Gaps = 83/467 (17%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 209
           + +++L NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG +A+   +G  
Sbjct: 62  MKRITLKNFMCHEHFELEFGP---RLNFIVGSNGSGKSAILTAITVVFGAKASDTNRGVS 118

Query: 210 LSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYID 269
           L  LI         E C        + ++  G          + I R   R+  S ++  
Sbjct: 119 LKSLIR--------EGCGTARIAIVLANQGLGAFEQGVYGSEITIERTLKRDGQSSHF-S 169

Query: 270 GKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGT 329
            K  N  EV+   RD    +D+           SI  + P     S D    +L      
Sbjct: 170 IKSENGREVSNKKRDLQRIVDYF----------SIPVLNPMCFL-SQDAARSFLTASTPQ 218

Query: 330 AKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXXXX 389
            K++  +   L+E   +N    E     E++   K++L+   +                 
Sbjct: 219 DKFRHFMRGTLLEEIDMNLAKAE-----EILRSSKSNLDYHGENMKALREDYEHAKRLFK 273

Query: 390 XXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLD 449
                H W +++K  +  GK+  LN         Y + +R + + ++R  +  +++V  D
Sbjct: 274 EIYSTHDWNERKKTLQ--GKLCWLN---------YKENERRLRKFKKRQEEISQKIVACD 322

Query: 450 KEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQK 509
           ++   +T +   ++R K   +     +D+K             S+ D + K EE      
Sbjct: 323 EK---ITERNLKIERYKADQDSTHEEVDQKM-----------TSLQDHQIKFEEAEQELG 368

Query: 510 QYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMK 569
           Q++EK    +E L EER K+                     ER++      L+  + Q+K
Sbjct: 369 QFREK----HEVLKEERRKV---------------------EREIASLEVSLKAHRQQVK 403

Query: 570 LTESQIA-ILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQC 615
             E ++A  L  SKE+ V    Q+  EI+    K N+  +     QC
Sbjct: 404 QLEQELAEALGGSKEQMVTEKRQVDEEIKTL--KGNLPSLEDKFQQC 448

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa]
           {ON} Anc_7.101 YOL034W
          Length = 1117

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 72/160 (45%), Gaps = 12/160 (7%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 209
           I K+ LHNF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R   
Sbjct: 66  IIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRN 122

Query: 210 LSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRN-NSSKYYI 268
           + D I   E +  +E   + +     + + +G     D    + ITR   R+   S+Y I
Sbjct: 123 VDDYIKNDEEHGEIE---ITLKNSEAIHDVEGVLEGSD---TITITRILTRSKKKSEYKI 176

Query: 269 DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMK 308
           +        V +L+    I LD+    + Q  VE  +++K
Sbjct: 177 NDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

 Score = 40.8 bits (94), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1385 IS 1386
            I+
Sbjct: 1072 IT 1073

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 1267 RLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1326
            ++D  ++G   IS    +++  +   G  +LE  ++   +   +L       +S R +++
Sbjct: 936  KIDNLIKG---ISNKYSQLFTSVGSAGEIKLEKPNNFSNWQVKILVK-FRDNESVRELTS 991

Query: 1327 LS--GGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQ 1381
             S  GGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q
Sbjct: 992  QSQSGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQ 1051

Query: 1382 FIVIS 1386
            +I+++
Sbjct: 1052 YILVT 1056

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1379
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1380 -AQFIVIS 1386
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 36.2 bits (82), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 210
           I K+ L NF  +   ++   F    + +VG NGSGKS V+ ++    G +A+   +G  L
Sbjct: 85  IKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNSL 142

Query: 211 SDLI 214
            DLI
Sbjct: 143 KDLI 146

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1379
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1380 -AQFIVIS 1386
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1379
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1380 -AQFIVISLRN--NMFELAQQLVGIYKNNNMTRSTTLQNID 1417
              Q I+I+ ++   + E+    V I+K  +  R     N D
Sbjct: 1074 RTQTIIITPQDIGKITEIDSTGVKIHKMKDPQRQNNSNNTD 1114

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1379
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1380 -AQFIVIS 1386
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 102/223 (45%), Gaps = 25/223 (11%)

Query: 1180 DIDEYENETSNGLPKFSEA-----QLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYAR 1234
            DID Y  ET   L   +E      +   I +E +  +++      ++    + +LE+   
Sbjct: 848  DIDAYNQETKQVLNDLAEKYRDEDKFNLIYVEQIVNKLESKIQLSNHDRSAVALLEQTKA 907

Query: 1235 RLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGF-SIISMTLKEMYQMITMGG 1293
            ++A+ + +   L   V K + +RK   + K+K L+  +E   S I     E+++ +   G
Sbjct: 908  KIADLEDK---LPTQVRKCNTIRKEMSD-KQKVLEPRLESIVSGIGRKFSELFKDVGTAG 963

Query: 1294 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL-----SGGEKTLSSLALVFALHKYRP 1348
               L     L  FS+  L  +M   +    +S L     SGGE+ +S++  + AL K+  
Sbjct: 964  GVTLNRKSKL--FSDWKL-EIMVQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQKFTQ 1020

Query: 1349 TPLYVMDEIDAALD-----FRNVSIVANYIKERTKNAQFIVIS 1386
             P  V+DEI+  +D       + ++V N  +E T  +Q+ +I+
Sbjct: 1021 APFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQYFLIT 1061

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 94/454 (20%), Positives = 194/454 (42%), Gaps = 68/454 (14%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 209
           I K+ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 210 LSDLIHKSEAYPNLESC-----SVDIHFRYVVDESDGTTRSD-DEKPPMVITR------K 257
           + D I   +    +E       ++DI F   +  S    R++ + K  + ITR      K
Sbjct: 95  VEDFIKNGQDTSKIEIVLKDDPNIDIEF---LGSSFHRIRNNGNYKGLLTITRNLEKRTK 151

Query: 258 AFRN----NSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAER 313
             RN     + +Y I+G  +  + V  L+    I LD+    + Q  VE  ++++P  E+
Sbjct: 152 IGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP--EK 209

Query: 314 ESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDE 373
             D+ +     +++   +    ++  L EI+  N++    ++  +L   E+N        
Sbjct: 210 LLDETIRAIDSELLSMFEVLKKLQ--LQEIEMSNEIQTNTDSLKKLKTDEEN-------- 259

Query: 374 AXXXXXXXXXXXXXXXXXAQYHIWQDQRKLSETLGKISELNEHLG--QEKAKYDQFQREV 431
                              +  +  + ++  +TL K  +L  +L     + K   ++R+V
Sbjct: 260 ----------------FQQEVQLLNEYQETLDTLDKHKKLLPYLKIQDHREKLLTYKRQV 303

Query: 432 AQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTE 491
              +++  +F+K+     +    L      ++ EK ++EEK+ +  +K       L+ T 
Sbjct: 304 EGAKKQLQEFQKEREPYMQVLASLNESDAQLNIEKENIEEKKVSTKRK-------LEKTV 356

Query: 492 NSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHE 551
           + +   + ++E+ N   + YK +  +L   +  ++  +D IK  + D  +   +E+   E
Sbjct: 357 SKLNALREEIEKKNLQIEYYKGRSNKLKIKIETKKEDIDNIKRKISDIETPEESEVTELE 416

Query: 552 R---DL----EPWNAQLQEKKSQMKLTESQIAIL 578
           R   DL       N+++ E  +QM      +AIL
Sbjct: 417 RKRNDLIERESQVNSEIDEVDTQMSTQNHNLAIL 450

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1379
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1380 -AQFIVIS 1386
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1379
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1380 -AQFIVIS 1386
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK- 209
           I K+ L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A+   +G  
Sbjct: 76  IKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNA 132

Query: 210 LSDLI 214
           + DLI
Sbjct: 133 MKDLI 137

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1379
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1380 -AQFIVIS 1386
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 15/85 (17%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1382
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1383 IVISLRNNMFELAQQLVGIYKNNNM 1407
             +I+         + L G+Y +  M
Sbjct: 1056 FLIT--------PKLLTGLYYHEKM 1072

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 69/160 (43%), Gaps = 14/160 (8%)

Query: 154 KLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLS 211
           KL + NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  KL 
Sbjct: 48  KLRMENFVTYKVAEFDLSP---SLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKLE 104

Query: 212 DLIHKSEAYPNLESCSVDIHFRYVVD-ESDGTTRSDDEKPPMVITRKAFRN-NSSKYYID 269
           D I   E     E   V++  +   + E     +S D+   + ITR   R+   S Y I+
Sbjct: 105 DFIKNGE-----EKGLVEVTLKKPAEVEHSPIVKSHDQ--VIKITRHLSRSKRDSDYQIN 157

Query: 270 GKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP 309
             E   + V  ++    I LD+    + Q  V S +   P
Sbjct: 158 DIEVPESLVKSIISQLNIQLDNLCQFLSQERVASFAGQSP 197

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1385 IS 1386
            I+
Sbjct: 1074 IT 1075

 Score = 36.2 bits (82), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 80/194 (41%), Gaps = 22/194 (11%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 209
           I K+ L NF +Y  T+  + P   S + ++GPNGSGKS  + +       +   + R  +
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 210 LSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMV-----------ITRKA 258
           + D I   E    +E    ++     +   +     ++     V            TR  
Sbjct: 109 VDDYIKNGEDRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDLIKFTRII 168

Query: 259 FRN-NSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP-----KAE 312
            R+   S YYI+ K  +   V  L++   I LD+    + Q  VE  +++K      +  
Sbjct: 169 HRDKKKSDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLKSDKLLVETV 228

Query: 313 RESDDGLLEYLEDI 326
           R  D  LL+ LE++
Sbjct: 229 RSIDPNLLDILEEL 242

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1385 IS 1386
            I+
Sbjct: 1047 IT 1048

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 81/185 (43%), Gaps = 27/185 (14%)

Query: 155 LSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLSD 212
           + L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  ++ D
Sbjct: 45  VRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVED 101

Query: 213 LIHKSEAYPNLE-----SCSV-DIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKY 266
            I   +    +E     S  V DI      DE+   TR        +ITR   R   S Y
Sbjct: 102 FIKNGQDVSRIEITLKNSPKVNDIENVNAHDETIKITR--------IITRSKRR---SDY 150

Query: 267 YIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKP-----KAERESDDGLLE 321
            I+  E + + V  L+    I LD+    + Q  VE  +++K      +  R  D  LL+
Sbjct: 151 LINDCEVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDSSLLD 210

Query: 322 YLEDI 326
            L+++
Sbjct: 211 VLDEL 215

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 73/166 (43%), Gaps = 18/166 (10%)

Query: 1226 IDVLEEYARRLAEYKKRKLDLNQAVLKRDE-VRKNCEELKKKRLDKFMEGFSIISMTLKE 1284
            + + E    +  + +K+  D+++A+++ +E +RK  + L   + D  +          KE
Sbjct: 914  VALFENAKTKYRDAEKKYADVDRAIIQLNESLRKRLQSLNYAKTDTCVTA----DTDFKE 969

Query: 1285 MYQMITMGGNAELELVDSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFA 1342
              +     G    +       FS+G L  ++  P     RN+  LSGGEK+ S  +L+ A
Sbjct: 970  SLRFRNFSGGLNFD-------FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLA 1022

Query: 1343 LHKYRPTPLYVMDEIDAALDFRNVSI----VANYIKERTKNAQFIV 1384
              +   + +  +DE D  +D  N  I    + N + + T+    I+
Sbjct: 1023 TWRPMRSRIIALDEFDVFMDQVNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 82/208 (39%), Gaps = 27/208 (12%)

Query: 143 GNQCVHRL-CIDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGF 200
           GN+  H    I K+ L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G 
Sbjct: 60  GNETTHPPGFIKKVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGA 116

Query: 201 RANKMRQG-KLSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAF 259
           +A    +G  L DLI         E C        + +E  G          + I R   
Sbjct: 117 KATDTNRGSSLKDLIR--------EGCQSSKISIVLNNEGFGGYDQGTYGSEIRIERTIK 168

Query: 260 RNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGL 319
           RN  + + +  K  N  EV+   RD  + +D+           ++  M P     S D  
Sbjct: 169 RNGPATFSL--KSENGKEVSNKKRDLQVIVDYF----------AVPVMNPMCFL-SQDAA 215

Query: 320 LEYLEDIIGTAKYKAGIEAGLVEIDTLN 347
             +L     T KYK  +   L+E   +N
Sbjct: 216 RSFLTASTPTDKYKHFMRGTLLEDTEMN 243

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1376
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1377 TKNAQFIVIS 1386
              + Q I+I+
Sbjct: 1057 KSDTQTIIIT 1066

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1089

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1328 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1384
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1385 IS 1386
            I+
Sbjct: 1044 IT 1045

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 89/445 (20%), Positives = 175/445 (39%), Gaps = 54/445 (12%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 209
           I K+ L NF +Y+  +  + P   S + ++GPNGSGKS  + ++      +   + R  K
Sbjct: 44  IIKIKLWNFVTYSLAEFTLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSK 100

Query: 210 LSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSK--YY 267
           L D I   E     +   V++  + V  ESD  T +       ++ +        K  Y 
Sbjct: 101 LEDYIKNGE-----DQSVVEVTLKNV-PESDFNTDT-------ILIKTTINRGKKKPEYA 147

Query: 268 IDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDII 327
           I+G     T +   ++   I LD+    + Q  VE  +++K      SD  L E +  I 
Sbjct: 148 INGSTVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLK------SDKLLEETIRSI- 200

Query: 328 GTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEAXXXXXXXXXXXXX 387
                 + +   L ++ TL    +  +   +L  K+   L + +++              
Sbjct: 201 -----DSSMLTSLEKLKTLQTTEISLQKDVDLKNKKLQELTAQREKLEGAVKALKEYEHL 255

Query: 388 XXXXAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVK 447
                 + +     K+ +   K+        + K K   F ++     +  N  +K+  K
Sbjct: 256 KKEIEIHQLLLPYVKIKDHKSKVQSYIRDFREAKQKLKSFLQDKKPFIKAKNSLEKKQAK 315

Query: 448 -----------LDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKL---LKSTENS 493
                      L  E K L S    + + K  + ++++ ++    + +KL   ++STE  
Sbjct: 316 YQALKQDTNSSLINERKKLNSILNDLGKGKEEIIKRKKQIEYYENRTKKLQESIRSTEKE 375

Query: 494 MADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERD 553
             D    LE L    +Q  +++     +L+E+ S       ++  K   I + +A    +
Sbjct: 376 KEDKIASLETLQLPDQQTLDEITNERNTLIEKES-------NITTKIRSIDSRVATINHE 428

Query: 554 LEPWNAQLQEKKSQMKLTESQIAIL 578
           +   + Q QE+K ++  T+ +I IL
Sbjct: 429 MMTLDRQQQERKKKLT-TKDKIGIL 452

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 208
           I +++L NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG +A+   +G
Sbjct: 62  IKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKASDTNRG 116

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1379
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1380 -AQFIVIS 1386
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 39.7 bits (91), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1319 KSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1378
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1379 N---AQFIVIS 1386
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 209
           I K+ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +AN   +G  
Sbjct: 71  IKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGNS 127

Query: 210 LSDLI 214
           L DLI
Sbjct: 128 LKDLI 132

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 39.3 bits (90), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 13/123 (10%)

Query: 152 IDKLSLHNFKSYAGTQI-IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 209
           + K+ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 210 LSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYID 269
           L DLI +        S S  I   Y+ +   G+ +SD     ++I R   R+    + + 
Sbjct: 129 LKDLIREG-------SYSAKITL-YLDNSRIGSYKSDVYGDTIIIERTLKRDGPPSFSLK 180

Query: 270 GKE 272
            KE
Sbjct: 181 TKE 183

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1379
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1380 -AQFIVIS 1386
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)
           [2388 nt, 796 aa]
          Length = 795

 Score = 38.9 bits (89), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 105/217 (48%), Gaps = 25/217 (11%)

Query: 400 QRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKR 459
           ++KLSET  +I  LN++    + KYD    EV + R +  + + +M K + E  +  SK 
Sbjct: 354 KKKLSETKDEIQMLNQNQRILQDKYDGMANEVDEWRNKYEEVQGKMAKQENEANNSASKL 413

Query: 460 RLMDRE----KTSMEEKQRN-----LDKKRL-----KAEKLLKSTENSMADSKHKLEELN 505
           +L++ E    K  ++E + +     LD K L     K E+ L S  N +   +  L E+ 
Sbjct: 414 QLLEDELEILKNKLDEYEASETKLKLDYKELDELFQKREEELFSKANEVNTLQQSLNEIM 473

Query: 506 NSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEP----WNAQL 561
           NSQK   E L++  E L   +S+L E+KL      S+IS + +  +  LE         L
Sbjct: 474 NSQKSASEDLVKQIEELSTSKSQL-EVKL------SQISVDHSKEKHYLEDKINGMEKDL 526

Query: 562 QEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEA 598
            E   ++++   +I+ L+     ++QN+  LK E E 
Sbjct: 527 SENVGKLEIANQKISDLQIKLNGEIQNLANLKKEYEV 563

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 39.3 bits (90), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 113/224 (50%), Gaps = 56/224 (25%)

Query: 399  DQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVK----------- 447
            D+ +L E+   I  LNE L + +A+ +  +R+V  L  + N  K ++ K           
Sbjct: 1018 DKNELEES---IMHLNEQLNEIEAEKEINERKVNDLEGQLNSVKSELTKNMDEITLLKTK 1074

Query: 448  LDKEHKDLT-SKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNN 506
            LD  ++DLT SK++L++ E           +K+ L   KLL++++N+M DS +KLEE   
Sbjct: 1075 LDTVNEDLTTSKQKLIESEN----------EKRELS--KLLENSKNAMIDSNNKLEE--- 1119

Query: 507  SQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKS 566
            S  +Y        ++LL++   L++                 N + + + ++ Q+ E K 
Sbjct: 1120 STLKY--------DTLLKKYDSLEK-----------------NGQANEKSFHDQVDELKL 1154

Query: 567  QMKLTESQIAILKESKEKKVQNIIQLKTEIEAF-AEKNNVQEIA 609
            Q++  E Q   L+ S E+K +NI  ++T++E+  AEK  +Q IA
Sbjct: 1155 QLQEKELQYTTLETSIEEKEKNIQSIQTQLESLAAEKERIQGIA 1198

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%), Gaps = 5/63 (7%)

Query: 1325 SNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1384
            + LSGG+K   +LA  F L    PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLLE---PT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1385 ISL 1387
            IS+
Sbjct: 655  ISI 657

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSI 1368
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
            (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1322 RNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSI 1368
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 152 IDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 210
           I K+ L NF  +    +      + + +VG NGSGKS ++ +++   G +A++  +G  L
Sbjct: 73  IRKVILRNFMCHENFSV--ELTPNLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSSL 130

Query: 211 SDLIHK 216
            +LI K
Sbjct: 131 KELIRK 136

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 88/221 (39%), Gaps = 43/221 (19%)

Query: 1195 FSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYK-------------- 1240
            FSE +++  Q +  EL + ++N + D     I   E Y  R   +               
Sbjct: 834  FSEKKVEKYQQKRTEL-LQKINEFSDGIGTQISNAETYCTRAVAFAGDMPETREDTKAEI 892

Query: 1241 -----KRKLDLNQAVLKRDEVRKNCEELKKKRLD---KFM---EGFSIISMTLKEMYQMI 1289
                 + +L  N+  L +D++    E  K K  D   KF    +    ++ +LK  +Q +
Sbjct: 893  DRITHRIQLAENRVGLSQDQIMSLFESAKLKYKDAEQKFANVDKAVFQLNESLKRRWQSL 952

Query: 1290 TMGGN-----AELELVDSLD--PFSEGVLFSV----------MPPKKSWRNISNLSGGEK 1332
            T         A+ +  +SL    FS G+ F+            P  +  RN+   SGGEK
Sbjct: 953  TYAKTDTCVTADTDFKESLRFRNFSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEK 1012

Query: 1333 TLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373
            + S ++L+ A  +   + +  +DE D  +D  N  I    I
Sbjct: 1013 SFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRQIGTKLI 1053

>Skud_2.411 Chr2 complement(731701..733626) [1926 bp, 641 aa] {ON}
           YBR280C (REAL)
          Length = 641

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 47/106 (44%), Gaps = 20/106 (18%)

Query: 751 IQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQAN-----RVAYGKRRFRVVT 805
           + TP  VP      RS++G F+P+      D L  S +K+       +V  G   F+++T
Sbjct: 148 VNTPTEVPWFNSRTRSRSGNFIPS-----EDPL--SAIKKDGDEIIAQVCSGGFSFQILT 200

Query: 806 LDGKLIDTSGTLSGGGTHVMKGLMKSKQQPGAGYTP--EEVQNIEK 849
             G L  T  T SGG     KG   +  Q    Y P  E + N+E+
Sbjct: 201 ESGNLYSTGSTFSGG----FKGPGPTGSQ--HDYNPFREMIHNMER 240

>Suva_5.110 Chr5 complement(167540..167740,167806..168234) [630 bp,
           209 aa] {ON} YER018C (REAL)
          Length = 209

 Score = 36.2 bits (82), Expect = 0.40,   Method: Composition-based stats.
 Identities = 29/144 (20%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 417 LGQEKAKYDQFQREVAQLRERCND--------FKKQMVKLDKEHKDLTSKRRLMDREKTS 468
            G  + + D FQ++VA++  R  D        F+++M  L  +H+ L  + + +  ++T+
Sbjct: 7   FGNLEHRMDAFQQDVARVLSRQQDHARQQLQRFQEEMRHLHGQHQHLVDELQRLAAQRTA 66

Query: 469 MEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSK 528
           +E++ R        AE+   +T         +  EL+  Q     +  +L+  L +  ++
Sbjct: 67  LEQQIR-------AAEQATSTTREQWRGYHEREGELSRRQLTLAAQSRELDSLLQQRGAE 119

Query: 529 LDEIKLSLRDKTSEISAEIANHER 552
             E++     +    + E+A +ER
Sbjct: 120 CAELRARWAAQVGNDATEVALYER 143

>KNAG0F03650 Chr6 (681394..685188) [3795 bp, 1264 aa] {ON} Anc_7.488
           YBL047C
          Length = 1264

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 80/183 (43%), Gaps = 47/183 (25%)

Query: 408 GKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKT 467
           G+I++LN  L Q        Q E   L+ER N+F  Q   L                 +T
Sbjct: 635 GQINDLNGQLTQA-------QTENQTLKERINNFNAQAAAL-----------------QT 670

Query: 468 SMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNN-SQKQYKEKLLQLNE---SLL 523
            +EEKQ+ + ++R            S+ D   K  ELN+ +   +  ++  L+E   S +
Sbjct: 671 QLEEKQQQVKQER------------SVVDVNSKQIELNDITVANFTNEITGLDEKLASFV 718

Query: 524 EERSKLDEIKLSLRDKTSEISA---EIANHERDLEPWNAQLQEKKSQM----KLTESQIA 576
            + S+LD  + +L +K +++     E++N E DL      L E+  Q+    KL   Q+ 
Sbjct: 719 SKHSELDNYQKTLEEKHAQLQQKYEELSNTETDLTERQTALDERNQQIEEQEKLYHEQVT 778

Query: 577 ILK 579
            L+
Sbjct: 779 RLQ 781

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1350 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1400
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1401 IYKNNNMTRST 1411
              K  +  +S 
Sbjct: 999  FIKKVDSCKSC 1009

>Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 100/201 (49%), Gaps = 38/201 (18%)

Query: 443  KQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLE 502
            ++++ L+KE  +L     L++R K+S E  Q+  D   L+  ++          SK KL+
Sbjct: 902  QELLSLEKE--NLKKNESLLNRVKSSSETLQKQFDDTVLEKNEI----------SKQKLQ 949

Query: 503  ELNNSQKQYKEKLLQ-LNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQL 561
             + N +K   E+++Q L ES+ E  + L     +LR K  E+  +I+N   D+       
Sbjct: 950  IMQNLEK--AEQIIQDLQESIKERETALG----NLRSKNDELIKQISNLNYDIS------ 997

Query: 562  QEKKSQMKLTESQIAILKESKEKKVQNIIQLK-TEIEAFAEKNNVQEIAIHKLQCEQANI 620
            +E+ SQ  + ES++ +  ES+ K+++ +I LK  EI +F +          KL   + ++
Sbjct: 998  KEQNSQSLIKESKLKL--ESEIKRLKGVINLKENEINSFDK----------KLSSSEEDL 1045

Query: 621  LKRIDIGEKECGSASSKLGEM 641
              ++   EK C  A S+L  +
Sbjct: 1046 DIKLVTLEKNCNIAMSRLQSL 1066

>Kpol_1043.51 s1043 complement(99063..101669) [2607 bp, 868 aa] {ON}
            complement(99063..101669) [2607 nt, 869 aa]
          Length = 868

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 31/46 (67%), Gaps = 3/46 (6%)

Query: 1220 DNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNCEELKK 1265
            DN ++D  ++E +  RLAE  +RKLDL++ +   D +R+ C E++K
Sbjct: 501  DNPYLD-QIIESFWSRLAE--ERKLDLSEEIKLVDLLRECCNEIRK 543

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1306 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRN 1365
            F EGV   V P        + LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1366 VSIVANYIKERT 1377
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>Suva_13.234 Chr13 (374150..375856,375905..376240) [2043 bp, 680 aa]
           {ON} YMR061W (REAL)
          Length = 680

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 56/126 (44%), Gaps = 33/126 (26%)

Query: 572 ESQIAILKESKEKKVQNIIQLKTEIE-------AFAEKNNVQ----------------EI 608
           +SQI  L E+  +KVQ++IQLK   +        F   NNV                 E 
Sbjct: 502 DSQIKTLFETSVEKVQDLIQLKAIYKKMISYESKFGNLNNVYSLEKRFFERFPQENLIEA 561

Query: 609 AIHKLQCEQANILKRIDI----GEKE-----CGSASSKLGEMKNVLISHRQRAMEARSTL 659
             ++ Q   +N+LK++++     EKE      G+ +S  G   N+ +S R+R+ME     
Sbjct: 562 FTNRYQIXNSNLLKKLELTYMYNEKEDSYLSSGNQNSDYGS-SNMNLSERKRSMEESGNN 620

Query: 660 SNVENK 665
            N  NK
Sbjct: 621 GNFSNK 626

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] {ON}
            some similarities with uniprot|P38853 Saccharomyces
            cerevisiae YHR158c KEL1 involved in cell fusion and
            morphology
          Length = 1136

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 83/175 (47%), Gaps = 13/175 (7%)

Query: 433  QLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTEN 492
            +L+E+ N+  K +V       +L    R+  ++ TS          +  K   ++    N
Sbjct: 942  KLKEKDNNLDKSIVMFSGTVDELLKNWRMTSKKDTSSASPVAATQSQSTKNRNIISKMNN 1001

Query: 493  SMADSKHKLEELNNSQKQYKEKLLQL---NESLLEERSKLDEIKLSLRDKTSEISAEIAN 549
             + D   K +EL  S++Q   +  QL   NES+   +S+     +S+++  S+I+  +  
Sbjct: 1002 RLDDLLVKSKELTESEEQIDSEYEQLEIKNESI---QSQARHSSISVKETASDIANAMNE 1058

Query: 550  HERDLEPWNAQ---LQEK----KSQMKLTESQIAILKESKEKKVQNIIQLKTEIE 597
             +R +E + A    LQ +    K ++  T+ +I++ K+S+EK  + I ++  E E
Sbjct: 1059 SKRKIEDYKAHTEKLQNEIDGLKGKVNHTDGEISLDKQSEEKLREEIEKITAEKE 1113

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 33.5 bits (75), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 132/267 (49%), Gaps = 46/267 (17%)

Query: 421  KAKYDQFQREVAQLRERCNDFK----KQMVKLDKEHKDL-----TSKRRLMDREKTSMEE 471
            K K  + ++++++L+E CN  K    +++ KL+ E K+L     T K++  D+  TS+++
Sbjct: 1427 KNKAGEQEKKISRLKEECNKLKNSYEEKIEKLEVESKNLSLGHDTEKKQFEDK-ITSLKQ 1485

Query: 472  KQRNLDKKRLKAEKLLKSTENSMADSKHKLEEL----NNSQKQYKEKLLQLNESLLEERS 527
            +  +++K + + EK+LK+ +N++   + +LEEL     NS+ +Y +KL      +   R 
Sbjct: 1486 EIISIEKSKKQDEKVLKNQKNTL---QKELEELKDQFTNSENEYIKKLDNFQNEINSVRK 1542

Query: 528  KLDEIKLSLRDKTSEISAEIANHE---------------------RDLEPWNAQL----Q 562
            +  +I+  L  K   + A+++  E                     + LE  N +L     
Sbjct: 1543 EKLDIEAVLNSKIETLKADLSKSEEKSLILEKSNKEHLIKMEVIQKSLEKQNKELDILGN 1602

Query: 563  EKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIH--KLQCEQANI 620
            EK +      ++I  LKE    KV  I  LKTE+   +E  N+++I +   +L+ E++ I
Sbjct: 1603 EKDTLTMNLNNEIKGLKEEINSKVDQIGNLKTELNTVSE--NMEDIQVRYDQLKEEKSEI 1660

Query: 621  LKRIDIGEKECGSASSKLGEMKNVLIS 647
              ++   E++     S + ++ + +IS
Sbjct: 1661 SDKLIESEEKLKENFSSISDLNSSVIS 1687

>TPHA0B04360 Chr2 complement(1017141..1018247) [1107 bp, 368 aa]
           {ON} Anc_1.96 YHR156C
          Length = 368

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 11/95 (11%)

Query: 463 DREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQY--------KEK 514
           DR+K  +EE+ + +D  +   EK  K  +  M  SK K+ E+N  +K+Y         + 
Sbjct: 170 DRKKDELEEQDKWIDDFK-NPEKTAKIKQEQMQRSKMKVAEMNKDKKRYLLGDALQKLQY 228

Query: 515 LLQLNESLLEERSKLDEIKLSLRDKTSEISAEIAN 549
            L  +++LLE  S L+  K  ++ KT EI   I N
Sbjct: 229 FLTKDDTLLETLSNLNSFK--MKHKTEEIEKYIVN 261

>Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047C
           (EDE1) - EH domain protein involved in endocytosis
           [contig 159] FULL
          Length = 825

 Score = 33.1 bits (74), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 67/141 (47%), Gaps = 11/141 (7%)

Query: 395 HIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKL----DK 450
           H   +   LS  +G ++     + + KA+    Q+E+ ++ +  +  + +MV L      
Sbjct: 592 HATTELANLSNQVGSLTNQATLVNERKARA---QQELKRINDLKSSIETKMVSLRGSYQS 648

Query: 451 EHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQ 510
           E K       L+ + +  +EE +R L      AE    + + S+A+++H+LEE   +  Q
Sbjct: 649 ELKQTEEIEALLSQSRQQVEELKREL----AIAEANYHAVQGSLAETQHQLEESEQTNSQ 704

Query: 511 YKEKLLQLNESLLEERSKLDE 531
            KEK+  LN      +++L+E
Sbjct: 705 LKEKIGNLNAMTASLQNELNE 725

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 1325 SNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1384
            + LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +      
Sbjct: 588  AQLSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG-LTT 642

Query: 1385 ISLRNNMFELAQ 1396
            IS+ + +  +A 
Sbjct: 643  ISIAHRISTIAH 654

>KLLA0D18645g Chr4 complement(1571106..1573694) [2589 bp, 862 aa] {ON}
            similar to uniprot|P22543 Saccharomyces cerevisiae
            YLR240W VPS34 Phosphatidylinositol 3-kinase responsible
            for the synthesis of phosphatidylinositol 3-phosphate;
            forms membrane-associated signal transduction complex
            with Vps15p to regulate protein sorting; similar to p110
            subunit of mammalian PI 3-kinase
          Length = 862

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 2/42 (4%)

Query: 1226 IDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKR 1267
            + +LE +  RL E+ K+ +D    +L  D +RK CEE+K+ +
Sbjct: 500  VHILESFKSRLPEHSKKTID--DQILLVDMLRKFCEEIKQSK 539

>Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {ON}
           YLR309C (REAL)
          Length = 913

 Score = 32.7 bits (73), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 128/256 (50%), Gaps = 36/256 (14%)

Query: 397 WQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLT 456
           +++  K+ E L  + E  E     K KY++ +RE+   +E  N    Q+ K  KE ++L 
Sbjct: 321 FEEYEKIKEDLQALQEKYEDCEDWKQKYEEIEREIKNAKELENS---QLEKSAKELENLN 377

Query: 457 SKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKE-KL 515
            K   +   K S++EK   L++ R     +L+   N + D+K +++E  N  KQ++E K 
Sbjct: 378 VK---LTETKKSLKEKNSELEEVR----DMLRVVGNELVDAKDQIKESTN--KQFEEVKA 428

Query: 516 LQL--------NESLLEE--------RSKLDEI-KLSLRDKTSEISAEIANHERDLEPWN 558
           ++L        N S++E         ++K+D + K +   KTS  SAE       L+   
Sbjct: 429 VKLELDNLRHKNASMIEAYETKIIELKNKIDSLNKEAEHLKTS--SAEKEEEHAVLQKKV 486

Query: 559 AQLQEKKSQMKLTES----QIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQ 614
           A+L E+ SQ+    S    ++  L+ S ++K + +  L+ +++ F+E+ +  E +  +LQ
Sbjct: 487 AKLNEEISQLTCERSNLTKELTSLRISYKQKDKTVGYLEEQVKQFSEQKDAAEKSTEQLQ 546

Query: 615 CEQANILKRIDIGEKE 630
            E   +  ++D+ +KE
Sbjct: 547 KENVKMSNKLDLLKKE 562

>CAGL0B00924g Chr2 complement(81492..82808) [1317 bp, 438 aa] {ON}
           similar to uniprot|P11709 Saccharomyces cerevisiae
           YCL029c BIK1 nuclear fusion protein
          Length = 438

 Score = 32.7 bits (73), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 79/152 (51%), Gaps = 9/152 (5%)

Query: 446 VKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELN 505
           ++++K+ +++   R+L++ ++  +EE Q  +D+     E+ L+S    +     K  E  
Sbjct: 182 LRIEKQEREILQYRKLLEDQRIVLEEIQPTIDEYE-NNERRLRSRVQELETELDKQREKF 240

Query: 506 NSQKQY----KEKLL----QLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPW 557
            SQK++     E+LL    QL  ++ E   K    K SLR+ T+EI+  I +   + E  
Sbjct: 241 KSQKEFFEAEHEQLLAVVSQLQVAIEENEQKAISRKESLREDTTEITKTIQDLTDEHERA 300

Query: 558 NAQLQEKKSQMKLTESQIAILKESKEKKVQNI 589
            A+ +++K Q+K+    ++   +S  K++ N+
Sbjct: 301 RAKWEKEKMQLKMHNDSLSQEYQSLNKELMNM 332

>ZYRO0F16236g Chr6 (1332793..1333941) [1149 bp, 382 aa] {ON} similar
           to uniprot|P54857 Saccharomyces cerevisiae YDR058C TGL2
           Triglyceride Lipase
          Length = 382

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 54/102 (52%), Gaps = 14/102 (13%)

Query: 578 LKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKR-------IDIGEKE 630
           +KE  EKK   +  L T++ +F      + +++H    ++  IL+R        ++G+ +
Sbjct: 117 VKEKLEKKGCTV--LVTKVPSFGSIEE-RALSLHAFLEKETQILRRTATKNEIYNVGQDD 173

Query: 631 CGSASSK-LGEMKNVLISHRQRAMEARSTLSNVENKN-KVLS 670
             SAS K  G +K  LI+H    ++ R  +S ++NKN KVLS
Sbjct: 174 --SASQKEPGPIKLNLIAHSMGGLDCRFLISKIQNKNYKVLS 213

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,632,026
Number of extensions: 6270994
Number of successful extensions: 41781
Number of sequences better than 10.0: 1884
Number of HSP's gapped: 37978
Number of HSP's successfully gapped: 3788
Length of query: 1422
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1300
Effective length of database: 39,492,147
Effective search space: 51339791100
Effective search space used: 51339791100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)