Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17072g8.260ON29972997154630.0
KLTH0G13728g8.260ON2966302664770.0
Kwal_YGOB_56.238088.260ON2941301061950.0
Kwal_56.23810singletonOFF2763280259350.0
Suva_10.1718.260ON2958304357490.0
YLR087C (CSF1)8.260ON2958303657490.0
Smik_12.1468.260ON2958305057180.0
Skud_12.1558.260ON2959304956970.0
NCAS0B050108.260ON2952303656850.0
NDAI0B019808.260ON2959302856140.0
CAGL0L12210g8.260ON2981301055080.0
KAFR0B027208.260ON2982306554950.0
TDEL0F038708.260ON2942304654640.0
Ecym_43108.260ON2943302853840.0
KNAG0G020308.260ON2998307253400.0
ZYRO0C01694g8.260ON3006309552770.0
Kpol_392.78.260ON2995306351160.0
AGR088W8.260ON2887301844280.0
TPHA0J007308.260ON3046282443770.0
TBLA0E044208.260ON3148261643750.0
KLLA0F19096g8.260ON2923111122700.0
Kwal_56.23808singletonOFF6260940.001
CAGL0C00473g3.401ON2379128812.3
CAGL0J02464g7.197ON91685802.6
Ecym_82072.155ON856112793.6
Kpol_479.118.615ON48795776.2
TPHA0C038702.481ON57179768.6
Smik_10.1671.295ON1229158768.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17072g
         (2997 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  5960   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  2499   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  2390   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  2290   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  2219   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  2219   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  2207   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  2199   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  2194   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  2167   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  2126   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  2121   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  2109   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...  2078   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  2061   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2037   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  1975   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...  1710   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  1690   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  1689   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   879   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    41   0.001
CAGL0C00473g Chr3 complement(45221..52360) [7140 bp, 2379 aa] {O...    36   2.3  
CAGL0J02464g Chr10 (238695..241445) [2751 bp, 916 aa] {ON} simil...    35   2.6  
Ecym_8207 Chr8 complement(424366..426936) [2571 bp, 856 aa] {ON}...    35   3.6  
Kpol_479.11 s479 complement(21571..23034) [1464 bp, 487 aa] {ON}...    34   6.2  
TPHA0C03870 Chr3 complement(833740..835455) [1716 bp, 571 aa] {O...    34   8.6  
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    34   8.9  

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 5960 bits (15463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2897/2997 (96%), Positives = 2897/2997 (96%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            MDAGSQFKAIPISKENN                     YFGRALAYCITILMKWVLWRRY
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSR           
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSG 120

Query: 121  XXXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXXSLHS 180
               DQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVA                SLHS
Sbjct: 121  EEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFEGGEDSLHS 180

Query: 181  SEEKLEDETLAXXXXXXXXXXXXXRNFQEQDSRSMLLQFLPIHLKVNRGAVLLGNTTTPS 240
            SEEKLEDETLA             RNFQEQDSRSMLLQFLPIHLKVNRGAVLLGNTTTPS
Sbjct: 181  SEEKLEDETLASDSSVSNVDSTNDRNFQEQDSRSMLLQFLPIHLKVNRGAVLLGNTTTPS 240

Query: 241  VMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVHSR 300
            VMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVHSR
Sbjct: 241  VMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVHSR 300

Query: 301  MSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSVGX 360
            MSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSVG 
Sbjct: 301  MSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSVGD 360

Query: 361  XXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDVGN 420
                   NMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDVGN
Sbjct: 361  EEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDVGN 420

Query: 421  SGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYTRF 480
            SGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYTRF
Sbjct: 421  SGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYTRF 480

Query: 481  NLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGMCP 540
            NLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGMCP
Sbjct: 481  NLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGMCP 540

Query: 541  TITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSKQV 600
            TITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSKQV
Sbjct: 541  TITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSKQV 600

Query: 601  HTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINNPL 660
            HTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINNPL
Sbjct: 601  HTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINNPL 660

Query: 661  DFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFMKN 720
            DFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFMKN
Sbjct: 661  DFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFMKN 720

Query: 721  KEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYFGD 780
            KEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYFGD
Sbjct: 721  KEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYFGD 780

Query: 781  FIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYDLHEFNED 840
            FIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYDLHEFNED
Sbjct: 781  FIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYDLHEFNED 840

Query: 841  PKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNYYMD 900
            PKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNYYMD
Sbjct: 841  PKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNYYMD 900

Query: 901  LQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGLPIIEETYF 960
            LQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGLPIIEETYF
Sbjct: 901  LQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGLPIIEETYF 960

Query: 961  CKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVTDSI 1020
            CKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVTDSI
Sbjct: 961  CKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVTDSI 1020

Query: 1021 SFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKNEVQGLF 1080
            SFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKNEVQGLF
Sbjct: 1021 SFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKNEVQGLF 1080

Query: 1081 ETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAITPG 1140
            ETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAITPG
Sbjct: 1081 ETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAITPG 1140

Query: 1141 VSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSSFIQGSGSTSA 1200
            VSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSSFIQGSGSTSA
Sbjct: 1141 VSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSSFIQGSGSTSA 1200

Query: 1201 LKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFCVGSXXXXX 1260
            LKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFCVGS     
Sbjct: 1201 LKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFCVGSIDDII 1260

Query: 1261 XXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLD 1320
                   VEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLD
Sbjct: 1261 DANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLD 1320

Query: 1321 LCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLLKARPVFSIVFXXXXX 1380
            LCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLLKARPVFSIVF     
Sbjct: 1321 LCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLLKARPVFSIVFEELEF 1380

Query: 1381 XXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKE 1440
                       LNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKE
Sbjct: 1381 WSDSSESSKNSLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKE 1440

Query: 1441 LIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYK 1500
            LIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYK
Sbjct: 1441 LIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYK 1500

Query: 1501 RTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGAD 1560
            RTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGAD
Sbjct: 1501 RTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGAD 1560

Query: 1561 FKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMIIS 1620
            FKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMIIS
Sbjct: 1561 FKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMIIS 1620

Query: 1621 CNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSVKHDVKPKLIQGVLLVDRTDTNIH 1680
            CNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSVKHDVKPKLIQGVLLVDRTDTNIH
Sbjct: 1621 CNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSVKHDVKPKLIQGVLLVDRTDTNIH 1680

Query: 1681 LDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGAL 1740
            LDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGAL
Sbjct: 1681 LDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGAL 1740

Query: 1741 NFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNN 1800
            NFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNN
Sbjct: 1741 NFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNN 1800

Query: 1801 TTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADIT 1860
            TTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADIT
Sbjct: 1801 TTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADIT 1860

Query: 1861 IRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFI 1920
            IRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFI
Sbjct: 1861 IRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFI 1920

Query: 1921 YSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSA 1980
            YSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSA
Sbjct: 1921 YSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSA 1980

Query: 1981 GYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAV 2040
            GYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAV
Sbjct: 1981 GYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAV 2040

Query: 2041 NLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSSLLQHKKT 2100
            NLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSSLLQHKKT
Sbjct: 2041 NLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSSLLQHKKT 2100

Query: 2101 APTDISELSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLD 2160
            APTDISELSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLD
Sbjct: 2101 APTDISELSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLD 2160

Query: 2161 AYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNF 2220
            AYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNF
Sbjct: 2161 AYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNF 2220

Query: 2221 LSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEKPVNSEAAPLDPILSKIRAFNCIV 2280
            LSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEKPVNSEAAPLDPILSKIRAFNCIV
Sbjct: 2221 LSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEKPVNSEAAPLDPILSKIRAFNCIV 2280

Query: 2281 KYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNT 2340
            KYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNT
Sbjct: 2281 KYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNT 2340

Query: 2341 LFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQ 2400
            LFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQ
Sbjct: 2341 LFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQ 2400

Query: 2401 GISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTS 2460
            GISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTS
Sbjct: 2401 GISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTS 2460

Query: 2461 FQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKG 2520
            FQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKG
Sbjct: 2461 FQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKG 2520

Query: 2521 GNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSW 2580
            GNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSW
Sbjct: 2521 GNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSW 2580

Query: 2581 AISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLS 2640
            AISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLS
Sbjct: 2581 AISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLS 2640

Query: 2641 LELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALA 2700
            LELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALA
Sbjct: 2641 LELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALA 2700

Query: 2701 SANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDL 2760
            SANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDL
Sbjct: 2701 SANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDL 2760

Query: 2761 FYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEE 2820
            FYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEE
Sbjct: 2761 FYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEE 2820

Query: 2821 IVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWN 2880
            IVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWN
Sbjct: 2821 IVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWN 2880

Query: 2881 LGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEP 2940
            LGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEP
Sbjct: 2881 LGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEP 2940

Query: 2941 RIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGNV 2997
            RIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGNV
Sbjct: 2941 RIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGNV 2997

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 2499 bits (6477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1301/3026 (42%), Positives = 1857/3026 (61%), Gaps = 97/3026 (3%)

Query: 4    GSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRYKVK 63
             SQFK + +S   +                     YFGR   Y +T L++W+ W+RYKVK
Sbjct: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61

Query: 64   INIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXXXXX 123
            I+IQSLKISFLGGR+FFKNLTV+T++QT SFLQGS TWRYWLLNSR              
Sbjct: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENI--- 118

Query: 124  DQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXXSLHSSEE 183
            D+    L CRF +E  G E FIYN+T A+D IL S+                 S  +++E
Sbjct: 119  DKSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDN--SDKNTDE 176

Query: 184  KLEDETLAXXXXXXXXXXXXX---------RNFQEQDSRSMLLQFLPIHLKVNRGAVLLG 234
               DE  A                      R+FQ  DS    L+ LP+   V +GAV++G
Sbjct: 177  CSVDEDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIG 236

Query: 235  NTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKS 294
            N T+ SVM++ YE  +GV+D C  + K+DLYKI+   +F    + +KPN+S   ENP+KS
Sbjct: 237  NKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKS 296

Query: 295  YIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALY-SEYNVTT 353
            ++  S++S++W +  ++FF+  S    +  N      ++    ++WRGL LY  E +   
Sbjct: 297  FVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP--LKRWRGLGLYWKEEDAAW 354

Query: 354  SDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQR 413
             D                D+  HEYA+YT+++K   + + YA+D PG+VPHGAL T +  
Sbjct: 355  DDR------------FQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTV 402

Query: 414  DGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGS 473
            DGPDVGNSG PP++S+D ++ GA++ YGPW+H +I  LQ++  P+VSRD+ P+++LTPGS
Sbjct: 403  DGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGS 462

Query: 474  RRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLF 533
            +RIYTR  LS+L++ +++WRIPTRE+SKD +FLK++RE++++ RPFGWL++ L++ +++ 
Sbjct: 463  KRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVR 522

Query: 534  MTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVF 593
              + MCPT TGF+N L  H VKPEIR+SVNHDI   A   ++ A +GYPLGWN +A+WVF
Sbjct: 523  FNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVF 582

Query: 594  QFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDA 653
               S Q   F L+DHI LL DI  DFGSG PTPYELFRPF Y F W+   YSIYLNVNDA
Sbjct: 583  DSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDA 642

Query: 654  NIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWST 713
            NI+NNP++FNENCYLS HGD L+++F V  + I GNST +NY + TP F L ++TPSW+T
Sbjct: 643  NIVNNPVNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNT 702

Query: 714  LHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNI 773
            LHEFMK+KEVGRS +F ++GSY FHS +DV N+DTI+IEC SK TTL+C G+V+RY + +
Sbjct: 703  LHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGV 762

Query: 774  NMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYD 833
             MNYFGDF+HFKTTEEY  EL      R    +     D  +++        D+++++ +
Sbjct: 763  KMNYFGDFVHFKTTEEYMEEL------RGTNAVTKTTHDSETEIQEAP-KQMDEDSSQRE 815

Query: 834  LHEFNEDP-KVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDL 892
             H   +DP   K+  LKR  NEKDVWFTF VEDGC + PEN+YDC SC  L FDSLD+DL
Sbjct: 816  QHI--KDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDL 873

Query: 893  RYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVV-RA-CEGLVDGHQGFLSELNIHAHRMF 950
            R++NYYMD+QA+LSP  I+R  D     +F+   RA C  LV G    LS L+IH HRMF
Sbjct: 874  RHINYYMDMQAALSPLRIRRLIDCGCEEVFEQKGRALCGELVAGR---LSRLHIHTHRMF 930

Query: 951  GLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDM 1010
            GLP  EETYFCKWDF +G+LD+ SD+ F  G I A+ K+GFG++DYEN++ Y++   +DM
Sbjct: 931  GLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDM 990

Query: 1011 TSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEK 1070
            TS+TL  D+I F          + L+   ISA   D EN  YS+++   + N+   + +K
Sbjct: 991  TSVTLAIDAIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDK 1050

Query: 1071 SSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLY 1130
            +  N+    F TS+ ++ F Q +D   H   Q+ HI  +D+P+HRC FL+P+  Q +  Y
Sbjct: 1051 NKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDY 1110

Query: 1131 NKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSS 1190
              LFG I PGVSIP L  P+    + ++F+  L       +      +     +  +NSS
Sbjct: 1111 KGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVD--RWFPVNEVKNKNSS 1168

Query: 1191 FIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINP--------SSEK 1242
             ++       L+ +   + +  S   +P FE+++ ++NL  + ++I+P        + E+
Sbjct: 1169 SLKDF--KGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQ 1226

Query: 1243 CLLSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKF 1302
            C   +  QF                V  F K    +    N+RVL P +   F +   + 
Sbjct: 1227 CHKKLIEQFI--------DNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKEN 1278

Query: 1303 EVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFI-NQQQLKP 1361
                   + V  N  SLD   KK      S      E+ TS LK  S++  + N+   K 
Sbjct: 1279 TYDVEGQVKVTANQVSLDWSLKKGLKLPGSDN--DPEDTTSLLKIESLDLEVFNKLDKKT 1336

Query: 1362 K-TLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILCA 1420
            K   +     F                    L  ++++  V   +  WL D++R     +
Sbjct: 1337 KFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDS 1396

Query: 1421 TKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRS 1480
             +L    S      +  ++E  +R + AS EY I HD PVITKPAYITRL   H+RE+RS
Sbjct: 1397 KQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRS 1456

Query: 1481 WRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCY 1540
            W+I+TRLRHILNYLP +        LK  E+     A + FL+IFSNW +W++SDV+KCY
Sbjct: 1457 WKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCY 1516

Query: 1541 IYKRVFLSRSMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESS 1600
            +Y+RVF + ++       +  K+       +   S +   D +++KNLK+  + E  +  
Sbjct: 1517 MYRRVF-TNTLDDTVAHESSTKIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDE 1575

Query: 1601 LPPSAKNTEDSASTEKMIISCNIKSIRGDLGDN-IVKLVRMYDGLSNLSDTNLKTTSVKH 1659
                  N  ++    +  +SC I   +  L D  ++KL+ + +    L     +  +VK 
Sbjct: 1576 AAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRE----LFTFEAEHAAVKE 1631

Query: 1660 DVK-PKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCAS 1718
            + K P   Q   LVDR D  +     R  L+SF N  +   E   +KSE   + +   A 
Sbjct: 1632 NEKLPAFQQYTALVDRCDIQLLCGANRANLKSFGNTLTIVRE---NKSEDADAFSTAFAW 1688

Query: 1719 S--EAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHF 1776
            S  E  +RH + +LL++  +  A+  +     ++   K+ LR+    +   + ++ Y  F
Sbjct: 1689 SWFEFGIRHRNTILLDAFSRSSAVG-AHGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTF 1747

Query: 1777 IWSIKASVDGIRKELA---SAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPL 1833
            I S++ S + +R  L      + K ++       P+         L+  +S  + +I  L
Sbjct: 1748 IDSLEESWNNLRLALGPNTGFLEKPHSAATEKVAPQ-------FALNIDISDLTTDISLL 1800

Query: 1834 TPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTP 1893
            +   I ++   + +  E+       +    +DI++ STR+ Q+YLK SQS ++  +    
Sbjct: 1801 SSLAITKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPK 1860

Query: 1894 EQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSK 1953
            + NA    V + S I+KL + DPR+    L +D   A    A LKS   K  +KN +   
Sbjct: 1861 KNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIM 1920

Query: 1954 QRKQTNI----IWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHG 2009
             +  T       W+  V + Y+G+++ LGS  Y+ ELN +   ++ +    K  E     
Sbjct: 1921 SQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGA 1980

Query: 2010 IVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPM 2069
            + GD S  ++  LI+   L   LS++VD AV++K+++E  + ++++QIES +FR+AL P 
Sbjct: 1981 LRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPF 2040

Query: 2070 SLTKVLWAINEFTRVSEAYKTRSSLLQHKKTAPTDISELSNKFRSIQILSYNFCIGWIFD 2129
            SL ++L+ +NE +R+SE  K ++     +     +       FRS+Q+LSYNFC+GWIFD
Sbjct: 2041 SLVRILFLVNELSRLSELQKRQTVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFD 2100

Query: 2130 AGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYL 2189
                 +PGLIWGY+RLFAA++KPYGKLTLLDAYFSIA G++SD F+++    +  NRS+L
Sbjct: 2101 VNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFL 2160

Query: 2190 PSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPF 2249
            PSMQI YW   +G T  LF+RI GERLDV FLS SI +A G +KS+  F ELKK  VDPF
Sbjct: 2161 PSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPF 2220

Query: 2250 ATNKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPS 2309
             +    ++P  +      P LS I+  +C V+YAGGVF+L+S +D+QN + PSF++ESPS
Sbjct: 2221 KSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPS 2280

Query: 2310 VEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKP 2369
            VE+  DY+ +     SH +R  + V  S+NT+FPTCVP+L+ M +D+R +LK FN  P+ 
Sbjct: 2281 VEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQE 2340

Query: 2370 DRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNN 2429
              + ++S   ++Y+  LR  DI+FL++IGKQ IS SCEPKAKVQAD+GFEKLAVK+FTN+
Sbjct: 2341 ASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTND 2400

Query: 2430 LDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDV 2489
            LD SEPLSLSIDI  + A SRHIFSREVSTS +ID +  +F+LTHP+ I TYG   + ++
Sbjct: 2401 LDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNI 2460

Query: 2490 QIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFP 2549
             +YFN+KQLQDLN+F++IWKPDS +   P+  +  +R+L+S +K  V+KF+K + T +FP
Sbjct: 2461 DVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFP 2520

Query: 2550 WNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLG 2609
            WN+ LI S IKGDIDLG SLGVLS+  +R WAI+DH+ DW Q+LS+ +E ILLSSDGRLG
Sbjct: 2521 WNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLG 2580

Query: 2610 GFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKL 2669
            G L +    W S I WPV+ G +E+PL++L + L    LK SFDYH+ LIA+VE L LKL
Sbjct: 2581 GTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKL 2640

Query: 2670 YNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDS 2729
            +N+RD  GI ++LL+V+++     LFLTALA AN +D+YNTI+RMR+DN+ SY ETL DS
Sbjct: 2641 FNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDS 2700

Query: 2730 NTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQT 2789
            NT+ T+S   ++++L SLS LRT+L V +   ++Q++PS LFDMEVL  KA+D    +Q 
Sbjct: 2701 NTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQI 2760

Query: 2790 QGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAIL 2849
            +GD K+KT L WQ+H  K++LS FKNQ +E+  SQI VKEYI+HA K  GGTIL  PAIL
Sbjct: 2761 EGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAIL 2820

Query: 2850 VDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDK 2909
            + MTTW +V++N +ELLY++SFGGK+ ++WNLG INF+REMWATHVRA+ALRR H+   +
Sbjct: 2821 IGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHN--GQ 2878

Query: 2910 NKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPG 2969
             + FFEDEH+EEK++DVDLG++Y Y+PLEEP IE+PQ KDLG+ATPPVEWFGVNR++FPG
Sbjct: 2879 PRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPG 2938

Query: 2970 LTHQSVVVPLQKLAHMAEEEYARVLG 2995
            LTHQ+++VPLQKLAH+AE E+AR+LG
Sbjct: 2939 LTHQAMIVPLQKLAHIAETEWARILG 2964

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 2390 bits (6195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1268/3010 (42%), Positives = 1839/3010 (61%), Gaps = 92/3010 (3%)

Query: 5    SQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRYKVKI 64
            S+F+ +PIS   +                     YFGR L Y IT +++++ W+RY VK+
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   NIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXXXXXD 124
                       GRVFFKNLTVIT+DQT S L GS TWRYWLL+SR               
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQS------- 104

Query: 125  QKSRMLQCRFFLESDGFELFIYNRTVAYDGILRS--------VAXXXXXXXXXXXXXXXX 176
            +K+  L CRF +E  G E FIYNRT A+D IL S        V                 
Sbjct: 105  EKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETST 164

Query: 177  SLHSSEEKLEDETLAXXXXXXXXXXXXXRNFQEQDSRSMLLQFLPIHLKVNRGAVLLGNT 236
               S+ +K   ET +             R +Q  +S    L+ LP+   V +GA+++GN 
Sbjct: 165  ENDSAAQKSHLET-SMSSPSASTESLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNK 223

Query: 237  TTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYI 296
             T SVM+  +E  +G +D C  + K+DLYKI+   D     + ++PN+ + ++ P+K+  
Sbjct: 224  KTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLP 283

Query: 297  VHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDH 356
              +R+ ++  K+ + F      YL+     +      +   E+WRGL LY + N    D 
Sbjct: 284  KANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDD 343

Query: 357  SVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGP 416
                           ++  HEYA+Y++++K   + + Y++D PG+VPHGA  T+E  DGP
Sbjct: 344  VFHF-----------ELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGP 392

Query: 417  DVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRI 476
            DVGN GAPP+FSLD +++GA I YGPWAH +I  +Q++  P+VSRD+ P ++L+ GS R+
Sbjct: 393  DVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRV 452

Query: 477  YTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTV 536
            +TR  +S+++M D++WRIPTRE SKD DFLK+Y+E+++  RPFGWL++ L + +++ + +
Sbjct: 453  FTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNI 512

Query: 537  GMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFN 596
             MCPT TGF+NKL  H +KPEIR+SVNHDI   A+   I A +GYPLGWN++A+W F   
Sbjct: 513  AMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLK 572

Query: 597  SKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANII 656
            S Q   F L+DHI LL DI  DFG+G PTPY+LFRPF+Y F W +  YS+YLNVNDANI+
Sbjct: 573  SHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIV 632

Query: 657  NNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHE 716
            NNP+DFNENCYLS HGD L+I F V   +I GNSTT++Y++ TP F L ++TPSW+TLHE
Sbjct: 633  NNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHE 692

Query: 717  FMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMN 776
            FMK+KEVGR+ DF + GSY FHS +DV N+DTI+IEC+S+ TTL+C G+V+R+L+ + MN
Sbjct: 693  FMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMN 752

Query: 777  YFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYDLHE 836
            YFGDF+HFKTTEEY  EL      R+A V     S++S+  + T+     ++      + 
Sbjct: 753  YFGDFVHFKTTEEYMEEL------RDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNH 806

Query: 837  FNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLN 896
              +    K+  LKR  NEKDVWFTF VEDGCL+ P+N+YDC +C    FDSLD+DLRY+N
Sbjct: 807  TTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYIN 866

Query: 897  YYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGF--LSELNIHAHRMFGLPI 954
            YYMDLQA+LSP  ++  SD +P ++F      EG       F  +S+L+IHAHRMFGLP 
Sbjct: 867  YYMDLQAALSPVIVRNLSDCDPAHLFS---GSEGRCPSRANFGSISDLHIHAHRMFGLPP 923

Query: 955  IEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLT 1014
             EETYFCKWDF +G LDI SD+        A+SK+ F +KDYEN++ Y+I+  +DMTS+ 
Sbjct: 924  DEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSII 983

Query: 1015 LVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKN 1074
                 I  K+ D   +  + ++++ ++A  +DFENERYS++    I +I + V E     
Sbjct: 984  FHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDG 1043

Query: 1075 EVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKLF 1134
             + G F +SL +  F Q ++F  H   Q++HI  +D+P+HRC+FLLP+  Q++  Y KL 
Sbjct: 1044 SLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLL 1103

Query: 1135 GAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSSFIQG 1194
            G+I PGVSIP + +P+ P  +  I +  L       +  ++   SK+    E+  +F   
Sbjct: 1104 GSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKE---EDGYAFNFA 1160

Query: 1195 SGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFCVG 1254
            SG       L S ++N      +   E +S ++ L K   +I+    K   S   Q    
Sbjct: 1161 SG-------LMSSTEN------DSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSN 1207

Query: 1255 SXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYVEV 1314
                         V  F +  +++    N++V +P    T  +          D + + +
Sbjct: 1208 FVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVI 1267

Query: 1315 NHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFI-NQQQLKPKTLLKARPVFSI 1373
               S+D+  ++     NSS+    +++T+ +K  S+   + N  +  P   +    + S 
Sbjct: 1268 KEISVDISMREE-PSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCST 1326

Query: 1374 VFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSKTL 1433
                               NA ++D +V+  + E    +L+        +    S  K  
Sbjct: 1327 SIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKER 1386

Query: 1434 IQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHILNY 1493
            +Q  Q++  +R + AS EY IIHD PVITKPAYITRL   H+REN+SW+IITRLRHILNY
Sbjct: 1387 LQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNY 1446

Query: 1494 LPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSMKK 1553
            LP S       +LK   F+ P +A + FL IFS WRSWE SDV++CY+Y++ F S+   +
Sbjct: 1447 LPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQ--YE 1504

Query: 1554 NRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAKNTEDSAS 1613
             +    + +V ++  S ++S STH++ D M+      ++   +++S +  S    +D  +
Sbjct: 1505 GQAGPLNLRVEVDSCSATVSDSTHKEGD-MIAVKGLKLLKKFILKSEMVGSILAIDDGTA 1563

Query: 1614 TEKMIISCNIKSIRGDLGDNIVKLVRMYDGL-SNLSDTNLKTTSVKHDVKP-KLIQGVLL 1671
            T+   +SC++K+++  + +  +KL+   +   S  S   L  T V    K  KL++  LL
Sbjct: 1564 TDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALL 1623

Query: 1672 VDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVLL 1731
            +DR +  I LD K   L+SF N  S  +    S  +T  S+A   +  E  VRH +A+++
Sbjct: 1624 IDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIV 1683

Query: 1732 ESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKEL 1791
            ++  + G+L    S      + +V L S  L +   +ST+ Y +FI S+  S   +  +L
Sbjct: 1684 DAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKL 1743

Query: 1792 ASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEK 1851
                  K NT      PE  +  + V  +A +  F+  I  L+P  I +    + V  EK
Sbjct: 1744 ------KFNTRSKDLSPEMKN-FSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEK 1796

Query: 1852 HHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKL 1911
                +  + + + D++LLS  + Q+YLK SQS V L      +   +   + + S ++K 
Sbjct: 1797 EANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKF 1856

Query: 1912 TVSDPREFIYSLVEDETLAIKNFAQLK----SLAEKFPSKN-QEKSKQRKQTNIIWLLHV 1966
             + DPRE I +L +D   A +N  QLK    +L   F + +  E+          WL  +
Sbjct: 1857 KLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQL 1916

Query: 1967 NVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHAN 2026
            +++Y+G++V LG+  Y+ E+N + +SLS + +A    E     + G+ S+  +  LI+  
Sbjct: 1917 DMKYVGLLVPLGTTSYISEINELSSSLSCDEAA----EFSFPLVHGELSVAGISFLINDK 1972

Query: 2027 RLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSE 2086
             L  +LSK+++ A  +K+++   + ++++QIES+HFR+ALCP SL ++L    E T +S 
Sbjct: 1973 ELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSG 2032

Query: 2087 AYKTRSSLLQHKKTAPTDISELSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLF 2146
                + +          D   +S  F SIQILSY+FC+GWIF+    ++ GL WGY+RLF
Sbjct: 2033 LQALKDNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLF 2092

Query: 2147 AAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSN 2206
            AA++KPYGKLTLLDAYF IA G++S+ F+    E D+ NRS LPSMQI YWF   G    
Sbjct: 2093 AAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDE 2152

Query: 2207 LFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEK-PVNSEAAP 2265
            LFVRI GERLDV+FLS SIGIA G  +S+  FQELK+  +DPF   +  ++ P  S  + 
Sbjct: 2153 LFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSK 2212

Query: 2266 LDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKS 2325
            L PILS I   NC V+YAGGVFKL+S +DI+  + PSF++ESPSV+V  +Y  +    + 
Sbjct: 2213 L-PILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRK 2271

Query: 2326 HWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKL 2385
            H +R L++VD S+NTLFPTCVPI+S M  D+R +LK  N        ++    G+NY+ L
Sbjct: 2272 HLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSL 2331

Query: 2386 LRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHL 2445
            L+  DI+F++NI KQ ISLSCEPKAKVQADVGFEK A+K+FTN+ D  EPLSLS+DI ++
Sbjct: 2332 LQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNI 2391

Query: 2446 RATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFL 2505
             ATSRHIFSREVSTS  I+ +  VF+LTHP+ I TYG   +  + +YFN+KQLQDLN+F+
Sbjct: 2392 TATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFI 2451

Query: 2506 DIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDL 2565
            +IWK DS+IL  P+  N      ++ +K   SK++K    ++FPWN+ +I S I+G+IDL
Sbjct: 2452 NIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDL 2511

Query: 2566 GPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISW 2625
            G SLGVLS+   + WA++DH+ DW Q LS+ L+ + LSSDGRLGG   ++   W S+I W
Sbjct: 2512 GISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKW 2571

Query: 2626 PVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAV 2685
            P+  G +E+PL+ L++ L   A+K +FDYH+ LIA+VE L L L+N+RD  G++++LL+V
Sbjct: 2572 PLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSV 2631

Query: 2686 SVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLE 2745
            S++     +FLTALA AN  D+YNTI+RMR+DN+ SY+ETL DSNT+ TK    +  +L 
Sbjct: 2632 SLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILS 2691

Query: 2746 SLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHN 2805
            SLS LRT+LSV +   ++QV+PSTLFDMEV+  KA D S  +QT+G  K+KT+L  ++HN
Sbjct: 2692 SLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHN 2751

Query: 2806 FKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIEL 2865
             K++LS +K+Q +E + SQI VKEYI+HA+KV GGTIL+ PAIL+ MTTW +V++N +EL
Sbjct: 2752 VKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVEL 2811

Query: 2866 LYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKD 2925
            LY++SFGGK+ V+WNLG INF+REMWATH RA+ALRR H+   ++KSFFEDEH+ +K+KD
Sbjct: 2812 LYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHN--GQSKSFFEDEHLGDKLKD 2869

Query: 2926 VDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHM 2985
            VDLG++Y YIPLEEP IE+PQ KDLG+ATPPVEWFGVNR++FPGLTHQ V+VPLQKLAH+
Sbjct: 2870 VDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHL 2929

Query: 2986 AEEEYARVLG 2995
            AE E+AR+LG
Sbjct: 2930 AESEWARILG 2939

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 2290 bits (5935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1198/2802 (42%), Positives = 1749/2802 (62%), Gaps = 65/2802 (2%)

Query: 205  RNFQEQDSRSMLLQFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDL 264
            R +Q  +S    L+ LP+   V +GA+++GN  T SVM+  +E  +G +D C  + K+DL
Sbjct: 14   RTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDL 73

Query: 265  YKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSD 324
            YKI+   D     + ++PN+ + ++ P+K+    +R+ ++  K+ + F      YL+   
Sbjct: 74   YKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSRGS 133

Query: 325  NQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQI 384
              +      +   E+WRGL LY + N    D                ++  HEYA+Y+++
Sbjct: 134  KTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHF-----------ELPKHEYARYSKV 182

Query: 385  LKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWA 444
            +K   + + Y++D PG+VPHGA  T+E  DGPDVGN GAPP+FSLD +++GA I YGPWA
Sbjct: 183  MKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWA 242

Query: 445  HRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQD 504
            H +I  +Q++  P+VSRD+ P ++L+ GS R++TR  +S+++M D++WRIPTRE SKD D
Sbjct: 243  HHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLD 302

Query: 505  FLKQYRESKNKERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNH 564
            FLK+Y+E+++  RPFGWL++ L + +++ + + MCPT TGF+NKL  H +KPEIR+SVNH
Sbjct: 303  FLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNH 362

Query: 565  DIFFKADAQTISADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIP 624
            DI   A+   I A +GYPLGWN++A+W F   S Q   F L+DHI LL DI  DFG+G P
Sbjct: 363  DILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDP 422

Query: 625  TPYELFRPFVYRFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLK 684
            TPY+LFRPF+Y F W +  YS+YLNVNDANI+NNP+DFNENCYLS HGD L+I F V   
Sbjct: 423  TPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQD 482

Query: 685  TITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVG 744
            +I GNSTT++Y++ TP F L ++TPSW+TLHEFMK+KEVGR+ DF + GSY FHS +DV 
Sbjct: 483  SIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVE 542

Query: 745  NMDTILIECQSKYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAE 804
            N+DTI+IEC+S+ TTL+C G+V+R+L+ + MNYFGDF+HFKTTEEY  EL      R+A 
Sbjct: 543  NIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEEL------RDAY 596

Query: 805  VIADNVSDESSQMSSTSFVTNDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVE 864
            V     S++S+  + T+     ++      +   +    K+  LKR  NEKDVWFTF VE
Sbjct: 597  VEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVE 656

Query: 865  DGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDV 924
            DGCL+ P+N+YDC +C    FDSLD+DLRY+NYYMDLQA+LSP  ++  SD +P ++F  
Sbjct: 657  DGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFS- 715

Query: 925  VRACEGLVDGHQGF--LSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGL 982
                EG       F  +S+L+IHAHRMFGLP  EETYFCKWDF +G LDI SD+      
Sbjct: 716  --GSEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSF 773

Query: 983  IGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISA 1042
              A+SK+ F +KDYEN++ Y+I+  +DMTS+      I  K+ D   +  + ++++ ++A
Sbjct: 774  GDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTA 833

Query: 1043 SMIDFENERYSNKMSAKIPNIKLLVSEKSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQ 1102
              +DFENERYS++    I +I + V E      + G F +SL +  F Q ++F  H   Q
Sbjct: 834  RGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQ 893

Query: 1103 RNHITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESL 1162
            ++HI  +D+P+HRC+FLLP+  Q++  Y KL G+I PGVSIP + +P+ P  +  I +  
Sbjct: 894  KSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEF 953

Query: 1163 LGKHYQDYECCSDANYSKETAITEENSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEY 1222
            L       +  ++   SK+    E+  +F   SG       L S ++N      +   E 
Sbjct: 954  LKGEKNSLQMGNEHFCSKKE---EDGYAFNFASG-------LMSSTEN------DSNVES 997

Query: 1223 DSFIINLGKTIIAINPSSEKCLLSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVT 1282
            +S ++ L K   +I+    K   S   Q                 V  F +  +++    
Sbjct: 998  ESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCK 1057

Query: 1283 NLRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVT 1342
            N++V +P    T  +          D + + +   S+D+  ++     NSS+    +++T
Sbjct: 1058 NVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREE-PSPNSSEKSTVQDIT 1116

Query: 1343 SSLKASSINFFI-NQQQLKPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFV 1401
            + +K  S+   + N  +  P   +    + S                    NA ++D +V
Sbjct: 1117 ALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWV 1176

Query: 1402 NHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVI 1461
            +  + E    +L+        +    S  K  +Q  Q++  +R + AS EY IIHD PVI
Sbjct: 1177 HSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVI 1236

Query: 1462 TKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQF 1521
            TKPAYITRL   H+REN+SW+IITRLRHILNYLP S       +LK   F+ P +A + F
Sbjct: 1237 TKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIF 1296

Query: 1522 LKIFSNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGADFKVNLERISFSLSSSTHEDED 1581
            L IFS WRSWE SDV++CY+Y++ F S+   + +    + +V ++  S ++S STH++ D
Sbjct: 1297 LNIFSKWRSWESSDVEQCYMYRKAFYSQ--YEGQAGPLNLRVEVDSCSATVSDSTHKEGD 1354

Query: 1582 FMVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMY 1641
             M+      ++   +++S +  S    +D  +T+   +SC++K+++  + +  +KL+   
Sbjct: 1355 -MIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKLLAFR 1413

Query: 1642 DGL-SNLSDTNLKTTSVKHDVKP-KLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFM 1699
            +   S  S   L  T V    K  KL++  LL+DR +  I LD K   L+SF N  S  +
Sbjct: 1414 ELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSISFAL 1473

Query: 1700 ERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRS 1759
                S  +T  S+A   +  E  VRH +A+++++  + G+L    S      + +V L S
Sbjct: 1474 VDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGS 1533

Query: 1760 GGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTL 1819
              L +   +ST+ Y +FI S+  S   +  +L      K NT      PE  +  + V  
Sbjct: 1534 QKLRLKVPSSTKDYCNFINSLSESWSSLAPKL------KFNTRSKDLSPEMKN-FSKVAF 1586

Query: 1820 DATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLK 1879
            +A +  F+  I  L+P  I +    + V  EK    +  + + + D++LLS  + Q+YLK
Sbjct: 1587 EAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLK 1646

Query: 1880 FSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLK- 1938
             SQS V L      +   +   + + S ++K  + DPRE I +L +D   A +N  QLK 
Sbjct: 1647 VSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKI 1706

Query: 1939 ---SLAEKFPSKN-QEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLS 1994
               +L   F + +  E+          WL  ++++Y+G++V LG+  Y+ E+N + +SLS
Sbjct: 1707 HLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLS 1766

Query: 1995 NNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQN 2054
             + +A    E     + G+ S+  +  LI+   L  +LSK+++ A  +K+++   + +++
Sbjct: 1767 CDEAA----EFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKS 1822

Query: 2055 IQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSSLLQHKKTAPTDISELSNKFRS 2114
            +QIES+HFR+ALCP SL ++L    E T +S     + +          D   +S  F S
Sbjct: 1823 LQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFFNISQTFHS 1882

Query: 2115 IQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTF 2174
            IQILSY+FC+GWIF+    ++ GL WGY+RLFAA++KPYGKLTLLDAYF IA G++S+ F
Sbjct: 1883 IQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDF 1942

Query: 2175 FSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKS 2234
            +    E D+ NRS LPSMQI YWF   G    LFVRI GERLDV+FLS SIGIA G  +S
Sbjct: 1943 YIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARS 2002

Query: 2235 IQTFQELKKTMVDPFATNKTTEK-PVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEE 2293
            +  FQELK+  +DPF   +  ++ P  S  + L PILS I   NC V+YAGGVFKL+S +
Sbjct: 2003 LHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKL-PILSSISHVNCKVRYAGGVFKLYSLD 2061

Query: 2294 DIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMT 2353
            DI+  + PSF++ESPSV+V  +Y  +    + H +R L++VD S+NTLFPTCVPI+S M 
Sbjct: 2062 DIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMA 2121

Query: 2354 KDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQ 2413
             D+R +LK  N        ++    G+NY+ LL+  DI+F++NI KQ ISLSCEPKAKVQ
Sbjct: 2122 LDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQ 2181

Query: 2414 ADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLT 2473
            ADVGFEK A+K+FTN+ D  EPLSLS+DI ++ ATSRHIFSREVSTS  I+ +  VF+LT
Sbjct: 2182 ADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLT 2241

Query: 2474 HPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDK 2533
            HP+ I TYG   +  + +YFN+KQLQDLN+F++IWK DS+IL  P+  N      ++ +K
Sbjct: 2242 HPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEK 2301

Query: 2534 LPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRL 2593
               SK++K    ++FPWN+ +I S I+G+IDLG SLGVLS+   + WA++DH+ DW Q L
Sbjct: 2302 PLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTL 2361

Query: 2594 SVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFD 2653
            S+ L+ + LSSDGRLGG   ++   W S+I WP+  G +E+PL+ L++ L   A+K +FD
Sbjct: 2362 SLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFD 2421

Query: 2654 YHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIR 2713
            YH+ LIA+VE L L L+N+RD  G++++LL+VS++     +FLTALA AN  D+YNTI+R
Sbjct: 2422 YHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILR 2481

Query: 2714 MRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDM 2773
            MR+DN+ SY+ETL DSNT+ TK    +  +L SLS LRT+LSV +   ++QV+PSTLFDM
Sbjct: 2482 MRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDM 2541

Query: 2774 EVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKH 2833
            EV+  KA D S  +QT+G  K+KT+L  ++HN K++LS +K+Q +E + SQI VKEYI+H
Sbjct: 2542 EVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEH 2601

Query: 2834 ATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWAT 2893
            A+KV GGTIL+ PAIL+ MTTW +V++N +ELLY++SFGGK+ V+WNLG INF+REMWAT
Sbjct: 2602 ASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWAT 2661

Query: 2894 HVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDA 2953
            H RA+ALRR H+   ++KSFFEDEH+ +K+KDVDLG++Y YIPLEEP IE+PQ KDLG+A
Sbjct: 2662 HARAMALRRSHN--GQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEA 2719

Query: 2954 TPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLG 2995
            TPPVEWFGVNR++FPGLTHQ V+VPLQKLAH+AE E+AR+LG
Sbjct: 2720 TPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILG 2761

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2219 bits (5749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1208/3043 (39%), Positives = 1775/3043 (58%), Gaps = 134/3043 (4%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            M+A SQ + +P++ + +                     Y GR  AY ++ +++W+LW+R 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            K+KIN+++L+IS LGGR++FK+L+VI KD TIS L+GS TW+YWLLN R           
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120

Query: 121  XXXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXX---- 176
                 K+  L C+F LE +G E FIYNRT+AYD ++  ++                    
Sbjct: 121  SG---KNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPF 177

Query: 177  SLHSSEEKL-EDETLAXXXXXXXXXXXXXRNFQEQD--SRSMLLQFLPIHLKVNRGAVLL 233
            S  SS +KL ED + +             R++QE +       L F PI LK+NRG++LL
Sbjct: 178  SDGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLL 237

Query: 234  GNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIK 293
            GN  TPSVMI+ YE+ EG++DV    E+LDLY+ +  L+  N ++ IK NI + D   +K
Sbjct: 238  GNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLK 297

Query: 294  SYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTT 353
              +   ++S++WK F ++   R+          K        FF+KW+GL+LY       
Sbjct: 298  FKLDTGKVSKLWKTFVRVL--RVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYKA----- 350

Query: 354  SDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQR 413
               S G        ++  D  +HEYAK+T ILK  KV ++Y  D+PG+VPHGA  T+   
Sbjct: 351  ---SAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDI 407

Query: 414  DGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGS 473
            DGPDVGN+GAPP+F+LD +++G +ICYGPWA RQ+ +LQR+L P+VSR A P+KKL PGS
Sbjct: 408  DGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGS 467

Query: 474  RRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLF 533
            RR+YT F +++L+MED  WRIPTRESSKD +FL+ Y+++  + RPFGW+D++  K+T   
Sbjct: 468  RRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYAN 527

Query: 534  MTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVF 593
              + +CPT+ GF+N    H V+ EIRSSVNHDI  K+    +  D+GYPLGWNS   W+ 
Sbjct: 528  FNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWII 587

Query: 594  QFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDA 653
               S+Q+  F LR+HI L++D   DF +G PTPYELFRPFVY+  W +D YSIYLNVND 
Sbjct: 588  NMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDH 647

Query: 654  NIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWST 713
            NI+NNPLDFNENCYLSLHGD L ID +V  ++I G  T ++Y I TP F + L+TP W+T
Sbjct: 648  NIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNT 707

Query: 714  LHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNI 773
            L+EFMK+KEVGRSYDF + G Y  +S++D+ N+D++ I C S  T L C GFV+RYL+N+
Sbjct: 708  LNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINV 767

Query: 774  NMNYFGDFIHFKTTEEYTREL--QEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTE 831
             MNYFG+F +F T+EEYT  L  +E  E      + D  S   S+  + S + ND E   
Sbjct: 768  KMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGS-MKNDAE--- 823

Query: 832  YDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVD 891
                   ++  +KR+DLKR  NE D+WFTF V +G L+ PE IY    CI LHF  L VD
Sbjct: 824  -------DNGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVD 876

Query: 892  LRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFG 951
             R  NYYMD+ A L+ T IKRH       +FD +R   G  +   G LS+L IH HRM+G
Sbjct: 877  FRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYG 936

Query: 952  LPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMT 1011
            LP  E TYFC+WD  +G L+I+SDI+F KG   +F K+GFGY D EN+L+Y+     DMT
Sbjct: 937  LPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMT 996

Query: 1012 SLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVS--E 1069
            SLT+  + I+  + D        + ++ +  ++IDFENERYS ++  K+P + + +S   
Sbjct: 997  SLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVM 1056

Query: 1070 KSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVL 1129
                N     FET L    FGQ +D D  R+ QR +I ++DSPYHRC FLLP+ YQ +  
Sbjct: 1057 GDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDT 1116

Query: 1130 YNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSD-ANYSKETAITEE- 1187
            Y KL+GAI P  SIP L  P +P+TID I E ++G++    E  +   +   ET  T E 
Sbjct: 1117 YQKLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVEP 1176

Query: 1188 -NSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLS 1246
              +SF +     +A            ++  E   E D+++I++   ++ I+P       S
Sbjct: 1177 LRASFTEDDDEEAA----DPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKS 1232

Query: 1247 IYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSD 1306
            +  QF                V++ S       +++N+ +                 V+ 
Sbjct: 1233 LLEQFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDI----------------HVAY 1276

Query: 1307 YDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTE-----EVTSSLKASSINFFINQQQLKP 1361
             + ++ E      +L   +I  Q +   LE        EV    K  ++   +NQ++  P
Sbjct: 1277 LNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKK-NP 1335

Query: 1362 KTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILCAT 1421
            +      P  S+                  LN  + D  ++ SQ+EWL +Y         
Sbjct: 1336 ELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQ 1395

Query: 1422 KLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSW 1481
            ++F S +  +    + + ELI +   AS  Y I HD  VITKPA+I RLSK H+RENRSW
Sbjct: 1396 EVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSW 1455

Query: 1482 RIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYI 1541
            +IITRLRHIL YLP  W    ++ LK+ ++    DA++ F+ +FS WR+WEFSDV + YI
Sbjct: 1456 KIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYI 1515

Query: 1542 YKRVFLSRSMK-KNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESS 1600
            Y ++FL+   K K        K  +     ++    +E E   VV +     +N +++ +
Sbjct: 1516 YGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVAD-----ANLVVDLT 1570

Query: 1601 LPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSVKHD 1660
             P ++ ++    + E   I+  + S++G   D ++KL  +   +  +++ +      K D
Sbjct: 1571 PPVTSLSSNREETIE---ITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDD------KSD 1621

Query: 1661 VKPKL-----IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAAT 1715
             K +L     +  VLLVD+++  + +D  +++ R+   R S   E +   +    SL   
Sbjct: 1622 PKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVIF 1681

Query: 1716 CASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIH 1775
               SE W++HGS +L E+ L D ++  +   +       V  +   L   AM++TEQ ++
Sbjct: 1682 SQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQMVN 1741

Query: 1776 FIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTP 1835
             I  IK SV  +++++      KN +          SR+NTV L    S  S  I PL+P
Sbjct: 1742 AITEIKESVLKVKEQIKFKPKSKNKSQF------VGSRINTV-LSCYFSNVSSEIMPLSP 1794

Query: 1836 FGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQ 1895
            F I      ++++  K       ++I D D  + S ++K++YL+FS   + +    + E 
Sbjct: 1795 FYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEA 1854

Query: 1896 NAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQR 1955
             ++ +NV ++  + KLT S+PR  + S ++DE LA +    L SL   F + +   +K+ 
Sbjct: 1855 YSL-INVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLNSLFLTTDPMNAKKE 1913

Query: 1956 KQTNII-WLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDF 2014
                +I W L  N+ Y GI+V + S  +V EL+ +L SL+N  +    L      + G  
Sbjct: 1914 TPAKMINWTLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNG---LLPEQTRLTGQL 1970

Query: 2015 SIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKV 2074
            SIEN+L LI    L   LSKL+D ++ +   Q   D  Q+ Q+ESSHFRV L P SL ++
Sbjct: 1971 SIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRL 2030

Query: 2075 LWAINEFTRVSEAYKTRSS-------LLQHKKTAPTDISELSNKFRSIQILSYNFCIGWI 2127
            +W   +   + + Y  R +       +   K   P    E+   FRSI ILSY FCIGW+
Sbjct: 2031 IWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKP---KEIPINFRSIHILSYKFCIGWL 2087

Query: 2128 FDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRS 2187
            F  G+  DPGL++GY RLF+AY+K +GK T++DA+FS+++G +S TFFS G EK+++NRS
Sbjct: 2088 FQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRS 2147

Query: 2188 YLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVD 2247
            +LP+MQI YWF + G+  + F R  GE LDVNFL S + + +  ++SI+ FQELKK ++D
Sbjct: 2148 FLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILD 2207

Query: 2248 -PFATNKTTEKPVNSEAAP--------LDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNN 2298
             P  +N     P   +AAP        L P L  IR+ NC  KY GGVF++++ +DI+  
Sbjct: 2208 MPHESNMENSSP---DAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAK 2264

Query: 2299 SKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRN 2358
            S+PSFE++SP V +   YKH     K H IR L+TVDP++NTL+  C P+L   ++ ++N
Sbjct: 2265 SEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQN 2324

Query: 2359 MLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGF 2418
            M+K  ++  K    +  S+  ++YK+LL  FD+A  +   KQ +SLSCEPKAKVQADVGF
Sbjct: 2325 MIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGF 2384

Query: 2419 EKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEII 2478
            E     M TN  D+ +PL  S+ +E  +A+ +HIFSREVSTSF++  +D   + THP++I
Sbjct: 2385 ESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVI 2444

Query: 2479 QTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQI----LEMPKGGNTRTRSLSSHDKL 2534
              YGT+LVSDV ++FN+KQLQ+L LFLDIW+  S +     + P        +LSS+  +
Sbjct: 2445 SMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNV 2504

Query: 2535 PVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLS 2594
             V       GT   PW +TLIF+N+ GD+DLGPSLGV+S+R+ R+W  +DH+ + RQ L 
Sbjct: 2505 DV-------GTE-IPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLH 2556

Query: 2595 VFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDY 2654
             F + I L+S+GRL G   +    W SE+ WP++      PL+S SL +  +A+K +FDY
Sbjct: 2557 AFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDY 2616

Query: 2655 HMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRM 2714
            HMFLI  + ++   L+NE+D  GIL DLL VS +  +I L  TAL +AN +DIYNTI+RM
Sbjct: 2617 HMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRM 2676

Query: 2715 RQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDME 2774
            RQDNK SY+ETL+DSN   +K     +++L SL LLRTDLSV I    +Q+ P +LFD+E
Sbjct: 2677 RQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVE 2736

Query: 2775 VLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHA 2834
            VLV++ + +S  ++T    K+KT L  Q+ +   +LS  K + +EEI + I + +Y+ +A
Sbjct: 2737 VLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYA 2796

Query: 2835 TKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATH 2894
            +K+ GGTI+  P + V MTT QE  +N +E L+  SF  K+ V+WNLGPINFI+EMW TH
Sbjct: 2797 SKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTH 2856

Query: 2895 VRALALRRVHDMRDKNKSFFE-DEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDA 2953
            V+ALA+RR    +  N SF + +E +EE IK  +  +K+ YI LEEP+IE+PQI+DLG+A
Sbjct: 2857 VKALAVRR---SQTANISFGQTEEELEESIKREENASKFNYIALEEPQIEVPQIRDLGEA 2913

Query: 2954 TPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996
            TPP+EWFGVNR+R P  THQ+ V+P+QKL ++AE++Y ++L +
Sbjct: 2914 TPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKILDD 2956

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 2219 bits (5749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1216/3036 (40%), Positives = 1775/3036 (58%), Gaps = 120/3036 (3%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            M+A SQ + +P++ + +                     Y GR  AY ++ +++W+LW+R 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            K+KIN+++L++S LGGR+ FKNL+VI KD TIS L+GS TW+YWLLN R           
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120

Query: 121  XXXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXX---- 176
                 K   L C+  +E +G E+FIYNRTVAYD ++  ++                    
Sbjct: 121  SGKKAK---LPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPF 177

Query: 177  SLHSSEEKL-EDETLAXXXXXXXXXXXXXRNFQEQD--SRSMLLQFLPIHLKVNRGAVLL 233
            S  SS +KL ED + +             R++QE D      LL FLPI LK +RG++LL
Sbjct: 178  SDGSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLL 237

Query: 234  GNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIK 293
            GN  TPSVMI+ YES +G++DV    E+LDLY+ +  ++F N ++ IK NI + D   +K
Sbjct: 238  GNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297

Query: 294  SYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTT 353
              I   ++S++WK F ++F + ++  +     +K        F+ KW+GL+LY       
Sbjct: 298  FKIDRGKVSKLWKTFVRVF-QIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKA----- 351

Query: 354  SDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQR 413
               S G        ++  D+ NHEYAK+T ILK  KV + Y  D+PG+VPHGA  T+   
Sbjct: 352  ---SAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDI 408

Query: 414  DGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGS 473
            DGPDVGN+GAPP+F+LD +++G +ICYGPWA RQ+ +LQR+L P+VSR A P+KKL PGS
Sbjct: 409  DGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGS 468

Query: 474  RRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLF 533
            RRIYT F +++ +MED  WRIPTRESSKD +FLK Y+E+  + RPFGW+D++  K+T   
Sbjct: 469  RRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYAN 528

Query: 534  MTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVF 593
              + +CPT+ GF+N    H ++ EIRSSVNHDI  K+    I  D+GYPLGWNS+A W+ 
Sbjct: 529  FNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWII 588

Query: 594  QFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDA 653
               S+Q+  F LR+HI L++D   DF +G PTPYELFRPFVY+  W ++ YSIYLNVND 
Sbjct: 589  NMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDH 648

Query: 654  NIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWST 713
            NI+NNPLDFNENCYLSLHGD L ID +V  ++I G  T ++Y I TP F + L+TP W+T
Sbjct: 649  NIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNT 708

Query: 714  LHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNI 773
            L+EFMK+KEVGR+YDF + GSY  +S++D+ N+DT++IEC SK T L C GFV+RYL N+
Sbjct: 709  LNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNV 768

Query: 774  NMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYD 833
             MNYFG+F +F T+EEYT  L        A  + D V+ +SS     S V +  + +   
Sbjct: 769  KMNYFGEFFNFVTSEEYTGVLG-------AREVGD-VTTKSSVADLASTVDSGYQNSSLK 820

Query: 834  LHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLR 893
                ++ P +KR+DLKR  NE D+WFTF V DG L+ PE IY    CI LHF  L VD R
Sbjct: 821  NESEDKGP-MKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFR 879

Query: 894  YLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGLP 953
              NYYMD+ A L+ T IKRH       +FD +R   G  +   G LS+L IH HRM+GLP
Sbjct: 880  SCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLP 939

Query: 954  IIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSL 1013
              E TYFC+WD  +G L IDSDI+F KG   +F KIGFGY D EN+L+Y+     DMTSL
Sbjct: 940  PTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSL 999

Query: 1014 TLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSK 1073
            T+  + I   + D        +  + I  ++IDFENE+YS ++  KIP + +      S 
Sbjct: 1000 TVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTI------SL 1053

Query: 1074 NEVQG--------LFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQ 1125
            N V G         FET L    F Q +D D  R+ QR +IT+HDSPYHRC FLLP+ YQ
Sbjct: 1054 NCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQ 1113

Query: 1126 KTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSD-ANYSKETAI 1184
             +  Y  L+GAI P  SIP L  P +P+TID I E ++G++    E  +   N   ET  
Sbjct: 1114 DSDTYQNLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFAETPS 1173

Query: 1185 TEENSSFIQGSGSTSALKELSSYSQNCP-SYKLEPKFEYDSFIINLGKTIIAINPSSEKC 1243
            T E S   + S S     E +  S   P ++  +   E D++++++   ++ ++P     
Sbjct: 1174 TMEPS---RASFSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIF 1230

Query: 1244 LLSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFE 1303
              S+  Q    +            V++ S      ++++N+ +                 
Sbjct: 1231 AKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDI----------------H 1274

Query: 1304 VSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTE-----EVTSSLKASSINFFINQQQ 1358
            ++  + ++ E      +L   +I  Q +   LE        EV +  K  ++   +NQ++
Sbjct: 1275 IAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKK 1334

Query: 1359 LKPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVIL 1418
              P       P  S+                  LN  + D  ++ SQ+EWL +Y      
Sbjct: 1335 -NPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGN 1393

Query: 1419 CATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIREN 1478
               ++  SF+  +      + ELI +   AS  Y I HD  VITKPA+I RLSK H+REN
Sbjct: 1394 LIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVREN 1453

Query: 1479 RSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQK 1538
            RSW+IITRLRHIL YLP  W    +E LK++++    DA++ F+ +FS WR+WEFSDV +
Sbjct: 1454 RSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVAR 1513

Query: 1539 CYIYKRVFLSRSMK-KNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELI 1597
             YIY ++F + + K K  +     K  +     ++    +E E   VV +   V+     
Sbjct: 1514 SYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPP 1573

Query: 1598 ESSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSV 1657
             +SLP        S   E + I+  + S++G   D ++KL  +   ++ + + + K+   
Sbjct: 1574 VTSLP--------SNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDD-KSDPK 1624

Query: 1658 KHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCA 1717
            K   K   +  VLLVD+++  + +D  +L+ R+   R S   E +   +    SL     
Sbjct: 1625 KELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQ 1684

Query: 1718 SSEAWVRHGSAVLLESSLKD-GALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHF 1776
             SE W++H S +L E+ L+D   L  +++  H+  I  +  +   L   AM+STEQ +  
Sbjct: 1685 KSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTIL-INNQCADLHFRAMSSTEQLVTA 1743

Query: 1777 IWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPF 1836
            I  I+ S+  I++ +      K  +           ++NTV L    S  S  + PL+PF
Sbjct: 1744 ITEIRESLMMIKERIKFKPKSKKKSQF------VDQKINTV-LSCYFSNVSSEVMPLSPF 1796

Query: 1837 GIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQN 1896
             I      ++++  K       ++I D D  + S ++K++YL+FS   +  +      + 
Sbjct: 1797 YIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIE-IKGGISREG 1855

Query: 1897 AMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKN-QEKSKQR 1955
               +NV ++  + KLT S+PR  + S ++DE LA +    L SL   F S N  +K KQ 
Sbjct: 1856 YSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQA 1915

Query: 1956 KQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFS 2015
                I W L  ++ Y G++V + S  +V EL+ +L SL+N  +     E     + G FS
Sbjct: 1916 PSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETK---VTGQFS 1972

Query: 2016 IENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVL 2075
            IEN+L LI    L   LSKL+D ++ +   Q   D  Q+ Q+ESSHFRV L P SL +++
Sbjct: 1973 IENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLM 2032

Query: 2076 WAINEFTRVSEAYKTRSS--LLQHKK-TAPTDIS-ELSNKFRSIQILSYNFCIGWIFDAG 2131
            W  ++   +S  Y  R +  +   K  T  +D S E+   FRSI ILSY FCIGWIF  G
Sbjct: 2033 WGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYG 2092

Query: 2132 SETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPS 2191
            + ++PGL+ GY RLF+AY+K +GK T++DA+FS+A+G +S TFFS G EKD++NRS+LP+
Sbjct: 2093 AGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPN 2152

Query: 2192 MQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFAT 2251
            MQI YWF + G+  + F R  GE LDVNF+ S + +    ++S++ FQELKK ++D   +
Sbjct: 2153 MQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSES 2212

Query: 2252 ------NKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEV 2305
                  N      V S ++ L P L  IR+ N   KY GGVF++++ EDI+  S+PSFE+
Sbjct: 2213 LRAENDNSYASTSVESASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEI 2272

Query: 2306 ESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNS 2365
            +SP V +   YKH  D +K H  R L+TVDP++NTL+  C P+L   ++ ++ M+K  ++
Sbjct: 2273 KSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHST 2332

Query: 2366 KPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKM 2425
              KP+     SS  ++YK+LL  FD+A  +   KQ +SLSCEPKAKVQADVGFE     M
Sbjct: 2333 DEKPNFTKP-SSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSM 2391

Query: 2426 FTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTL 2485
             TN  D+ +PL  S+ +EH +A+ +HIFSREVSTSF++  +D   + THP++I  YGT L
Sbjct: 2392 ATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGL 2451

Query: 2486 VSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKP--- 2542
            VSD+ ++FN+KQLQ+L LFLDIW+  S +       +TR    + + ++ +S        
Sbjct: 2452 VSDLSVFFNVKQLQNLYLFLDIWRFSSIL-------HTRPVQRTVNKEIEMSSLTSTNYA 2504

Query: 2543 -AGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENIL 2601
             AGT   PW +TLIF+N+ GD+DLGPSLG++S+R  R+W  +DH+ + RQ L  F + I 
Sbjct: 2505 DAGTE-IPWCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGIS 2563

Query: 2602 LSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIAN 2661
            L+S+GRL G   +    W SE+ WP +      PL+S SL +  +A+K +FDYHMFLI  
Sbjct: 2564 LTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGT 2623

Query: 2662 VEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNS 2721
            + ++   L+NE+D  G+L DLL VS +  +I L  TAL  AN +DIYNTI+RMRQDNK S
Sbjct: 2624 ISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKIS 2683

Query: 2722 YIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAE 2781
            Y+ETL+DSN   ++     +++L SL LLRTDLSV I    +Q+ P +LFD+EVLV++ +
Sbjct: 2684 YMETLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRID 2743

Query: 2782 DMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGT 2841
             +S  ++T    K+KT L  Q+ +   +LS  K + +EE+ + I + +Y+ +A+K+ GGT
Sbjct: 2744 KVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGT 2803

Query: 2842 ILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALR 2901
            I+  P + V MTT QE  +N +E L+  SF  K+ V+WNLGP++FI+EMW THV+ALA+R
Sbjct: 2804 IIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVR 2863

Query: 2902 RVHDMRDKNKSFFE-DEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWF 2960
            R    +  N SF + +E +EE IK  +  +K+ YI LEEP+IE+PQI+DLGDATPP+EWF
Sbjct: 2864 R---SQVANISFGQTEEELEESIKKEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWF 2920

Query: 2961 GVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996
            GVNR++FP  THQ+ V+P+QKL ++AE++Y ++L +
Sbjct: 2921 GVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKILDD 2956

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2207 bits (5718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1195/3050 (39%), Positives = 1772/3050 (58%), Gaps = 148/3050 (4%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            M+A SQ + +P++ + +                     Y GR  AY ++ +++W+LW+R 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            KVKIN+++L++S LGGR+ FK+L+VI KD TIS L+GS TW+YWLLN R           
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120

Query: 121  XXXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXX---- 176
               + K   L C+F LE +G E+FIYNRTVAYD ++  ++                    
Sbjct: 121  SKNNVK---LPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPF 177

Query: 177  SLHSSEEKL-EDETLAXXXXXXXXXXXXXRNFQEQD--SRSMLLQFLPIHLKVNRGAVLL 233
            S  SS +KL ED + +             R++QE D       L+FLPI L  +RG++LL
Sbjct: 178  SDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLL 237

Query: 234  GNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIK 293
            GN  TPSVMI+ YES EG+VDV    E++DLY+ +  ++F N ++ IK NI + D   +K
Sbjct: 238  GNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297

Query: 294  SYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTT 353
              +   ++S++WK F ++  + +S  +     +K     +  F++KW+GL+LY       
Sbjct: 298  FKLDTGKVSKLWKAFIRVL-QLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKA----- 351

Query: 354  SDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQR 413
               + G        ++  D+ NHEYAK+T ILK  KV ++Y  D+PG+VPHGA  T+   
Sbjct: 352  ---TSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDI 408

Query: 414  DGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGS 473
            DGPDVGN+GAPP+F+LD +++G +ICYGPWA RQ+ +LQR+L P+VSR A P+KKL PGS
Sbjct: 409  DGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGS 468

Query: 474  RRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLF 533
            RR+YT F +++ + ED  WRIPTRE+SKD +FL+ Y+E+  + RPFGW+D++  K+T   
Sbjct: 469  RRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYAN 528

Query: 534  MTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVF 593
              + +CPT+ GF+N    H V+ EIRSSVNHDI  K+    I  D+GYPLGWNS+A W+ 
Sbjct: 529  FNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWII 588

Query: 594  QFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDA 653
               S+Q+  F LR+HI L++D   DF +G PTPYELFRPFVY+  W ++ YSIYLNVND 
Sbjct: 589  NMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDH 648

Query: 654  NIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWST 713
            NI+NNPLDFNENCYLSLHGD L ID +V  ++I G  T ++Y I TP F + L+TP W+T
Sbjct: 649  NIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNT 708

Query: 714  LHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNI 773
            L+EFMK+KEVGR+YDF + G+Y  +S++D+ N+DT++IEC S  T L C GFV+RYL N+
Sbjct: 709  LNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNV 768

Query: 774  NMNYFGDFIHFKTTEEYTRELQEK----LETREAEVIADNVSDESSQMSSTSFVTNDKET 829
             MNYFG+F +F T+EEYT  L  +    + T+ + V   +  D   Q SS   V N+ E 
Sbjct: 769  KMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSS---VKNNSEA 825

Query: 830  TEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLD 889
                     + P +KR+DLKR  NE D+WFTF V +G L+ PE IY    CI LHF  L 
Sbjct: 826  ---------KGP-MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELV 875

Query: 890  VDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRM 949
            VD R  NYYMD+ A L  T IKRH       +FD +R   G  +   G LS+L IH HRM
Sbjct: 876  VDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRM 935

Query: 950  FGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPID 1009
            +GLP  E TYFC+WD  +G L IDSD++F KG   +F KIGFGY D EN+L+Y+     D
Sbjct: 936  YGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDD 995

Query: 1010 MTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSE 1069
            MTSLT+  + I   + D        +  + I  ++IDFENE YS ++  K+P +K+    
Sbjct: 996  MTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKI---- 1051

Query: 1070 KSSKNEVQG--------LFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLP 1121
              S N V G         FET L    F Q +D D  R+ QR +IT HDSPYHRC+FLLP
Sbjct: 1052 --SLNCVMGDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLP 1109

Query: 1122 MQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCS---DANY 1178
            + YQ +  Y KL+GAI P  SIP L  P +P+TID I E ++G++    E  +   D+  
Sbjct: 1110 LFYQDSDTYQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFA 1169

Query: 1179 SKETAITEENSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINP 1238
               + +    +SF +        +E SS      ++  +   E D++++++   ++ I+P
Sbjct: 1170 ETPSTVEPSKASFTEDDND----EEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDP 1225

Query: 1239 SSEKCLLSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSP 1298
                   S+  Q    +            V++ S      ++++N+ +            
Sbjct: 1226 LLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDI------------ 1273

Query: 1299 KGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTE-----EVTSSLKASSINFF 1353
                 ++  + ++ E      +L   +I  Q     LE        EV +  +  ++   
Sbjct: 1274 ----HIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVT 1329

Query: 1354 INQQQLKPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYL 1413
            +NQ++  P       P  S+                  LN  + D  ++ SQ+EWL  Y 
Sbjct: 1330 VNQKK-NPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYC 1388

Query: 1414 RAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKN 1473
                    ++  SF   +    + + ELI     AS  Y I HD  VITKPA+I RLSK 
Sbjct: 1389 SDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKG 1448

Query: 1474 HIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEF 1533
            H+RENRSW+IITRLRHIL YLP  W    ++ LK+ ++   +DA++ F+ +FS WR+WEF
Sbjct: 1449 HVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEF 1508

Query: 1534 SDVQKCYIYKRVFLSRSMK-KNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVI 1592
            SDV + YIY ++F + + K K  +     K  +     ++    +E E   VV +     
Sbjct: 1509 SDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVAD----- 1563

Query: 1593 SNELIESSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNL 1652
            +N +++ + P ++ +     + E   I+  I S++G   D ++KL  +   ++ + + + 
Sbjct: 1564 ANLVVDLTPPVTSLSLNREETIE---ITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDD- 1619

Query: 1653 KTTSVKHDVKPKL-----IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSE 1707
                 K D K +L     +  VLLVD+++  + +D  +L+ R+   R S   E +   + 
Sbjct: 1620 -----KSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTS 1674

Query: 1708 TKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAM 1767
               S+      SE W++H S +L E+ L+D ++  +   +       +  +   L   AM
Sbjct: 1675 QAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAM 1734

Query: 1768 ASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFS 1827
            +STEQ +  I  I+ S   I++ +      K  +           ++NTV L    S  S
Sbjct: 1735 SSTEQTVTAITEIRESALKIKERIKFKPKSKKKSQF------VGQKINTV-LTCYFSNVS 1787

Query: 1828 LNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNL 1887
              I PL+PF I      ++++  K       I+I D D  + S ++K++YL+FS   +  
Sbjct: 1788 SEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIE- 1846

Query: 1888 VISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSK 1947
            +     ++    +NV ++  + KLT S+PR  + S ++DE LA +    L SL   F S 
Sbjct: 1847 IKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLCSLKSLFFSS 1906

Query: 1948 N-QEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQG 2006
            N  +K KQ     I W L  ++ Y GI++ + S  +V EL+ +L SL+N  +     E  
Sbjct: 1907 NIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEET- 1965

Query: 2007 LHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVAL 2066
               + G FSIEN+L LI    L   LSK++D ++ +   Q   D  Q+ Q+ESSHFRV L
Sbjct: 1966 --KVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCL 2023

Query: 2067 CPMSLTKVLWAINEFTRVSEAYKTRSS-------LLQHKKTAPTDISELSNKFRSIQILS 2119
             P SL +++W  ++   +   Y    +       +   K   P    E+   FRSI ILS
Sbjct: 2024 SPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKP---KEIPLNFRSIHILS 2080

Query: 2120 YNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGK 2179
            Y FCIGW+F  G+ +DPGL+ GY RLF+AY++ +GK T++D++FS+A+G +S TFFS G 
Sbjct: 2081 YKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGN 2140

Query: 2180 EKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQ 2239
            EKD++NRS+LP+MQI YWF + G+  + F R  GE LDVNF+ S + + +  ++S++ FQ
Sbjct: 2141 EKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQ 2200

Query: 2240 ELKKTMVDPFATNKTTEKPVNS----EAAP--LDPILSKIRAFNCIVKYAGGVFKLFSEE 2293
            ELK+ ++D    + + +  + +    E AP  L P L+ IR+ N   KY GGVF++++ E
Sbjct: 2201 ELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYE 2260

Query: 2294 DIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMT 2353
            DI+  S+PSFE++SP V +   YKH  D ++ H IR L+TVDP++NTL+  C P+L   +
Sbjct: 2261 DIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFS 2320

Query: 2354 KDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQ 2413
            + ++ M+K  ++  KP+     S   ++YK+LL  FD+A  +   KQ +SLSCEPKAKVQ
Sbjct: 2321 ESLQKMIKKHSTDEKPNFTKP-SPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQ 2379

Query: 2414 ADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLT 2473
            ADVGFE     + TN  D+  PL  S+ +EH +A+ +HIFSREVSTSF++  +D   + T
Sbjct: 2380 ADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFT 2439

Query: 2474 HPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMP------KGGNTRTRS 2527
            HP++I  YG  LVSD+ ++FN+KQLQ+L LFLDIW+  S +   P      KG +  + +
Sbjct: 2440 HPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLT 2499

Query: 2528 LSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFV 2587
             +SH  L         GT   PW +TLIF+N+ GD+DLGPSLGV+S+R  R+W  +DH+ 
Sbjct: 2500 STSHVDL---------GTE-IPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYD 2549

Query: 2588 DWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLA 2647
            + RQ L  F + I L+S+GRL G   +    W SE+ W  + G    PL+S SL +  +A
Sbjct: 2550 EKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMA 2609

Query: 2648 LKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDI 2707
            +K +FDYHMFLI  + ++  +L+NE+D  G+L DLL VS +  +I L  TAL +AN +DI
Sbjct: 2610 IKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDI 2669

Query: 2708 YNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFP 2767
            YNTI+RMRQDNK SY+ETL+DSN   ++     +++L SL LLRTDLSV I    +Q+ P
Sbjct: 2670 YNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISP 2729

Query: 2768 STLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEV 2827
             +LFD+EVLV++ + +S  ++T    K+KT L  Q+ +   +LS  K + +EE+ + I +
Sbjct: 2730 ISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAI 2789

Query: 2828 KEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFI 2887
             +Y+ +A+K+ GGTI+  P + V MTT QE  +N +E L+  SF  K+ V+WNLGP+NFI
Sbjct: 2790 DDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFI 2849

Query: 2888 REMWATHVRALALRRVHDMRDKNKSFFE-DEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQ 2946
            +EMW THV+ALA+RR    +  N SF + +E +EE I   +  +K+ YI LEEP+IE+PQ
Sbjct: 2850 KEMWTTHVKALAVRR---SQIANISFGQTEEELEESINKEETASKFNYIALEEPQIEVPQ 2906

Query: 2947 IKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996
            I+DLGDATPP+EWFGVNR+RFP  THQ+ V+P+QKL ++AE++Y ++L +
Sbjct: 2907 IRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKILDD 2956

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 2199 bits (5697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1203/3049 (39%), Positives = 1768/3049 (57%), Gaps = 149/3049 (4%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            M+A SQ + +P++ + +                     Y GR  AY +T +++W+LW+R 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
             +KIN+++L++S LGGR+ FK+L+VI KD TIS L+GS TW+YWLLN R           
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120

Query: 121  XXXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXX----XXX 176
               + K   L C+F LE +G E+FIYNRTVAYD ++  ++                    
Sbjct: 121  LSKNVK---LPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESF 177

Query: 177  SLHSSEEKL-EDETLAXXXXXXXXXXXXXRNFQEQDSRSM--LLQFLPIHLKVNRGAVLL 233
            S  SS +KL ED + +             R++QE D   +   L+FLPI LK NRG++LL
Sbjct: 178  SDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLL 237

Query: 234  GNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIK 293
            GN  TPSVMI+ YE+ EGV+DV    E+LDLY+ +  ++F N ++ IK NI + D   +K
Sbjct: 238  GNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297

Query: 294  SYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTT 353
              +   ++S++WK F ++    ++  +    N+K        FF+KW+GL+LY       
Sbjct: 298  FKLDTGKVSKLWKTFVRVL-RIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKA----- 351

Query: 354  SDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQR 413
               + G        ++  D  NHEYAK+T ILK  K+ + Y  D+ G VPHGA  T+   
Sbjct: 352  ---APGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDI 408

Query: 414  DGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGS 473
            DGPDVGN+GAPP+F+LD +++G +ICYGPWA RQ+ +LQR+L P+VSR + P+KKL PGS
Sbjct: 409  DGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGS 468

Query: 474  RRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLF 533
            RRIYT F ++VL+MED  WRIPTRE+SKD +FL+ Y+E+  + RPFGW+D++  K+T   
Sbjct: 469  RRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYAN 528

Query: 534  MTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVF 593
              V +CPT+ GF+N    H V+ EIRSSVNHDI  K+    +  D+GYPLGWNS+A W+ 
Sbjct: 529  FNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWII 588

Query: 594  QFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDA 653
               S+Q+  F LR+HI L++D   DF +G PTPYELFRPFVY+  W ++ YSIYLNVND 
Sbjct: 589  NMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDH 648

Query: 654  NIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWST 713
            NI+NNPLDFNENCYLSLHGD L ID +V  ++I G  T ++Y I TP F + L+TP W+T
Sbjct: 649  NIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNT 708

Query: 714  LHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNI 773
            L+EFMK+KEVGR+YDF + GSY  +S++D+ N+DT++IEC S  T L C GFV+RYL N+
Sbjct: 709  LNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNV 768

Query: 774  NMNYFGDFIHFKTTEEYTRELQEKLETREAEVIA-DNVSDESSQMSSTSFVTNDKETTEY 832
             MNYFG+F +F T+EEYT  L  +      E+I   +V D +S + S    ++ K  +E 
Sbjct: 769  KMNYFGEFFNFVTSEEYTGVLGAR---EVGEIITKSSVLDLASTLDSGYQNSSLKNESE- 824

Query: 833  DLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDL 892
                 ++DP VKR+DLKR  NE D+WFTF V +G L+ PE IY    CI LHF  L VD 
Sbjct: 825  -----DKDP-VKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDF 878

Query: 893  RYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGL 952
            R  NYYMD+ A L+ T IKRH       +FD +R   G  +   G LS+L IH HRMFGL
Sbjct: 879  RSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGL 938

Query: 953  PIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTS 1012
            P  E TYFC+WD  +G L IDSDI+F KG   +F KIGFGY D EN+L+Y+     DMTS
Sbjct: 939  PPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTS 998

Query: 1013 LTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSS 1072
            LT+  + I     D        +  + +  ++IDFENERYS ++  KIP  KL++S    
Sbjct: 999  LTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIP--KLIISLSCV 1056

Query: 1073 KNEVQGL------FETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQK 1126
              +  G+      FET L    F Q +D D  R+ QR +IT HDSPYHRC FLLP+ YQ 
Sbjct: 1057 MGD--GVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQD 1114

Query: 1127 TVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSD-ANYSKETAIT 1185
            +  Y KL+GAI P  SIP L  P +P+TID I E ++G++    E  +   +   ET  T
Sbjct: 1115 SDTYQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFAETPST 1174

Query: 1186 EENSSFIQGSGSTSALKELSSYSQNCPSYKLEPK-FEYDSFIINLGKTIIAINPSSEKCL 1244
             E S   + S +     E +   +  P    E +  +  +++I++   ++ ++P      
Sbjct: 1175 VEPS---RASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFT 1231

Query: 1245 LSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEV 1304
             S+  +F                V++ S      ++++N+ V                 +
Sbjct: 1232 KSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDV----------------HI 1275

Query: 1305 SDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTE-----EVTSSLKASSINFFINQQQL 1359
            +  + ++ E      +L   +I  Q +   LE        EV +  +  ++   +NQ++ 
Sbjct: 1276 AYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKR- 1334

Query: 1360 KPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILC 1419
             P       P  S+                  LN  + D  ++ SQ+EWL +Y       
Sbjct: 1335 NPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNL 1394

Query: 1420 ATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENR 1479
              +   SF   ++   + + ELI +   AS  Y I HD  VITKPA+I RLSK H+RENR
Sbjct: 1395 IQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENR 1454

Query: 1480 SWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKC 1539
            SW+IITRLRHIL YLP  W    E+ LK+ ++    DA++ F+ +FS WR+WEFSDV + 
Sbjct: 1455 SWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARS 1514

Query: 1540 YIYKRVF-LSRSMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIE 1598
            YIY ++F +  +  K  +     K  +     ++    +E E   V+ +     +N +++
Sbjct: 1515 YIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFVIAD-----ANLVVD 1569

Query: 1599 SSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSVK 1658
             + P ++ +     + E   I+  + S++G   D ++KL  +   ++ +   +      K
Sbjct: 1570 LTPPVTSLSLNREETIE---ITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGD------K 1620

Query: 1659 HDVKPKL-----IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLA 1713
             D K +L     +  VLLVD+++  + +D  +L+ R+   R S   E +   +    SL 
Sbjct: 1621 SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680

Query: 1714 ATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQY 1773
                 SE W++H S +L E+ L+D ++  +   +       +  +   L   AM++TEQ 
Sbjct: 1681 IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSTTEQT 1740

Query: 1774 IHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPL 1833
            +  I  I+ SV  I+  +      K  +           ++N V L    S  S  I PL
Sbjct: 1741 VTVITEIRESVLKIKDRIKFKPKSKKRSQF------VGPKINIV-LSCYFSNVSSEIMPL 1793

Query: 1834 TPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTP 1893
            +PF I      ++++  K       ++I D D  + S ++K++YL+FS   +  +     
Sbjct: 1794 SPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIE-IKGGIS 1852

Query: 1894 EQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNF-----AQLKSLAEKFPSKN 1948
            +++   +NV ++  + KLT S+PR  + S ++DE LA +        +        P K 
Sbjct: 1853 KEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLKSLLFTSGLPKKK 1912

Query: 1949 QEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLH 2008
            ++K+  R    I W L  ++ Y GI+V + S  +V EL+ +L SL+N  +     E    
Sbjct: 1913 KKKAPARM---INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAK-- 1967

Query: 2009 GIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCP 2068
             + G FSIEN+L LI    L   LSKL+D ++ +   Q   D  Q+ Q+ESSHFRV L P
Sbjct: 1968 -VTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSP 2026

Query: 2069 MSLTKVLWAINEFTRVSEAYKTRSS-------LLQHKKTAPTDISELSNKFRSIQILSYN 2121
             SL +++W  ++   +   Y  R +       +   K   P    E+   FRSI ILSY 
Sbjct: 2027 DSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKP---KEIPINFRSIHILSYK 2083

Query: 2122 FCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEK 2181
            FCIGW+F  G+ +DPGL+ GY RLF+AY+K +GK T++DA+FS+A+G  S TFFS G EK
Sbjct: 2084 FCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEK 2143

Query: 2182 DQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQEL 2241
            D++NRS+LP+MQI YWF + G+  + F R  GE LDVNF+ S + + +  ++S++ FQEL
Sbjct: 2144 DKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQEL 2203

Query: 2242 KKTMVD-----------PFATNKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLF 2290
            KK ++D           P+AT+      + S +  L P L  IR+ N   KY GGVF+++
Sbjct: 2204 KKNILDVSEDSHMEDDNPYATSS-----MESASNSLAPFLDNIRSVNSNFKYDGGVFRVY 2258

Query: 2291 SEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILS 2350
            + +DI+  S+PSFE++SP V +   YKH  +  K H IR L+ VDP+ NTL+  C P+L 
Sbjct: 2259 TYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLM 2318

Query: 2351 GMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKA 2410
              ++ ++ M+K  ++  KP      SS  ++YK+LL  FD+A  +   KQ +SLSCEPKA
Sbjct: 2319 EFSESLQKMIKKHSTDDKPSFTKP-SSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKA 2377

Query: 2411 KVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVF 2470
            KVQADVGFE     M TN  D+ +PL  S+ ++  +A+ RHIFSREVSTSF++  +D   
Sbjct: 2378 KVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTL 2437

Query: 2471 VLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTR---- 2526
            + THP++I  YGT+LVSD+ ++FN+KQLQ+L LFLDIW+  S +   P  G+        
Sbjct: 2438 LFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMS 2497

Query: 2527 SLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHF 2586
            SL+S + + V            PW +TLIF+N+ GD+DLGPSLGV+S+R  R+W  +DH+
Sbjct: 2498 SLTSTNYVDVGA--------EIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHY 2549

Query: 2587 VDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSL 2646
             + RQ L  F + + L+S+GRL G   +    W SE+ W ++      PL+S SL +  +
Sbjct: 2550 SEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDV 2609

Query: 2647 ALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAID 2706
            A+K +FDYHMFLI  + ++  +L+NE+D  GIL DLL VS +  +I L  TAL +AN +D
Sbjct: 2610 AVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILD 2669

Query: 2707 IYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVF 2766
            IYNTI+RMRQDNK SY+ETL+DSN   +K     +++L SL LLRTDLS+ I    +Q+ 
Sbjct: 2670 IYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQIS 2729

Query: 2767 PSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIE 2826
            P +LFD+EVLV++ +++S  ++T    K+KT L  Q+ +   +LS  K + +EEI + I 
Sbjct: 2730 PISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIA 2789

Query: 2827 VKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINF 2886
            + +YI +A+K+ GGTI+  P + V MTT QE  +N IE L+  SF  K+ VKWNLGP+NF
Sbjct: 2790 IDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNF 2849

Query: 2887 IREMWATHVRALALRRVHDMRDKNKSFFE-DEHIEEKIKDVDLGNKYVYIPLEEPRIEMP 2945
            I+EMW THV+ALA+R+    +  N SF + +E +EE IK  +  +K+ YI LEEP+I++P
Sbjct: 2850 IKEMWTTHVKALAVRQ---SQIANVSFGQTEEELEESIKTKETTSKFNYIALEEPQIQVP 2906

Query: 2946 QIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVL 2994
            QI+DLGDATPP+EWFGVNR+RFP  THQ+ V+P+QKL ++AE++Y ++L
Sbjct: 2907 QIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 2194 bits (5685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1208/3036 (39%), Positives = 1772/3036 (58%), Gaps = 125/3036 (4%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            MDA SQF+ +P++++ N                     Y GR +AY IT +++W+LW+  
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            KVK+NIQSL+IS LGGR+FFKN+T+I KD TIS L+G+ TWRYWL N+R           
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 121  XXXDQ---KSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXXS 177
                    K+  L CRF +  +G E+F+YN+TVAYD I++  +                S
Sbjct: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILS 180

Query: 178  LHSSEEKLEDETL----AXXXXXXXXXXXXXRNFQEQDS-RSMLLQFLPIHLKVNRGAVL 232
              ++ + ++D       +             R FQE+++  S  L+FLPI   V RG+++
Sbjct: 181  DSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDTSSFLRFLPIQFLVTRGSLI 240

Query: 233  LGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPI 292
            LGN  TPS++I+  +SA+ ++D  Q  EKLDLYK +   +  N +  +K NI F ++  +
Sbjct: 241  LGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDVSM 300

Query: 293  KSYIVHSRMSRVWKKFKK---IFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEY 349
            K  +   ++S VW  F +   I ++ +     H    +       +F  KWRGLALY   
Sbjct: 301  KFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNE----HEDKFQAKWRGLALYKGT 356

Query: 350  NVTTSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHT 409
             +    + +         ++  D  NHEYAK++ ILKS KV  T  +D+PG+VPHGA  T
Sbjct: 357  GLGERRNDID--------DIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPT 408

Query: 410  MEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKL 469
            +   DGPDVGNSGAPP++SLD +++G ++C+GPWA RQ  +L ++L P+VSR A P+K+L
Sbjct: 409  ISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRL 468

Query: 470  TPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKE 529
            TPG RRIYT   + V +M+DA WRIPTRESSKD +FL+ YRE+  + RPFGW+D+K +KE
Sbjct: 469  TPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKE 528

Query: 530  TDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEA 589
            T +  T  +CPT+ GF+N +  HL + E RSSVNHDI  K        D  +PLGWN EA
Sbjct: 529  TTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEA 588

Query: 590  QWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLN 649
             W    NS Q+  F LR+HI L++D   DF SG PTPYELFRPF+Y   W ID YS+YLN
Sbjct: 589  TWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLN 648

Query: 650  VNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTP 709
            VND NI+NNPLDFNENCYLS HGD L +DF +   +IT   T ++Y+I+TP F L L+TP
Sbjct: 649  VNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTP 708

Query: 710  SWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRY 769
             W+TL+EFMK+KEVGRSYDF + GSY  +SD+D+ N+DTI+++C SK TTLQC GFV+RY
Sbjct: 709  PWNTLNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRY 768

Query: 770  LMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKET 829
            L+N+ MNYFGDF HF T+EEYT  ++   +  +    A    D+ S +SS   +  +   
Sbjct: 769  LINVKMNYFGDFFHFVTSEEYTGAIRANEDDMQ---YASESDDDRSSISSFDTMQGNDAP 825

Query: 830  TEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLD 889
                LH      +++R+DLKR  NE D+WFTF V +G L+ PE IY+C  C+GLHF  L 
Sbjct: 826  GRRRLH-----TELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELV 880

Query: 890  VDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRM 949
            +DLR  NYYMDL A+++   IKR+   +P  IF+ +    G      G LS L IH HRM
Sbjct: 881  IDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRM 940

Query: 950  FGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPID 1009
            +GLP +E TYFC+WDF +G+LDI SDI+F +G   +F++IGFGY D EN+L+YE     D
Sbjct: 941  YGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDD 1000

Query: 1010 MTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSE 1069
            MTS+T+  + +S  + +   N   + DL+ +  + IDFENE+YS ++   IP ++  +  
Sbjct: 1001 MTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFI 1060

Query: 1070 KSSKNEVQGLF--ETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKT 1127
            K      + LF  ET + +  F Q++DFD HR  QR +I LHD+PYHRC+F+LP +YQ  
Sbjct: 1061 KEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDA 1120

Query: 1128 VLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECC-------SDANYSK 1180
              Y +LFGAI P  S+PPL  P+IP+T D I E LLG+     E         SD +Y+ 
Sbjct: 1121 EQYQELFGAIAPSSSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYAT 1180

Query: 1181 ETAITEENSSFIQGSGSTSALKELSSYSQNCPSYKLE-PKFEYDSFIINLGKTIIAINPS 1239
            + +  E               +++     N PS  ++  K E DSFII++    I I P 
Sbjct: 1181 DVSDDETE-------------EDIDPLEFNTPSEAIQNDKCERDSFIIDVSFISIEICPD 1227

Query: 1240 SEKCLLSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPK 1299
                + +  + F   +            V + S        +TN+++    +   +GS  
Sbjct: 1228 ILDSIGTFLMLFSTENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRT 1287

Query: 1300 GKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQQQL 1359
                      + + ++     +C+K +      +K +   E+T   K  S+   +NQ   
Sbjct: 1288 DT-------GVGIYLDRIDFAMCEKTV----EENKEKKLIELTVLNKIRSVRGTVNQTAA 1336

Query: 1360 KPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILC 1419
              K   +  P  S+V                 LN  + D  V+ +QLEWL  Y     L 
Sbjct: 1337 NSKNEERP-PALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQ 1395

Query: 1420 ATKLFASFSKSKTLIQARQ----KELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHI 1475
               +     K+   IQ R+    KELI     AS  Y I HD  VITKPA+ITRLS+ H+
Sbjct: 1396 IQDMI----KTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHV 1451

Query: 1476 RENRSWRIITRLRHILNYLPKSWYKRTEESLKKEE-FKIPDDARDQFLKIFSNWRSWEFS 1534
            RENRSW+IITRLRHIL YLP+ W+     SL + +      DA+  F+ +FSNWR+WEFS
Sbjct: 1452 RENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFS 1511

Query: 1535 DVQKCYIYKRVFLSR-SMKKNRITGADFKVNLERISFSLSSSTHEDE-DFMVVKNLKSVI 1592
            D+ + YIY+++FL++ S ++   T     + +     ++ S+ +E E +F++ +      
Sbjct: 1512 DIARSYIYRKLFLNQHSNQEIHTTKKSITIKIASFFVTVYSAGYEVEHNFIITR------ 1565

Query: 1593 SNELIESSLPPSAKNTEDSASTEKMI--ISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDT 1650
            +N L+E++ P     T DS+ + + I  I+  + + +G L D I+ +  +   L  ++D 
Sbjct: 1566 TNLLLETNSP-----TSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNLLPSL-KITDG 1619

Query: 1651 NLKTTSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKV 1710
              K+      VK   +  ++L +R +  I +   RL+ R F  R S   E     +   V
Sbjct: 1620 G-KSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWESPKDLTSQAV 1678

Query: 1711 SLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMAST 1770
            SLA     +E  ++H +A L E  ++D +L  +   +       V  +   L + AM +T
Sbjct: 1679 SLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSDLHLMAMTAT 1738

Query: 1771 EQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNI 1830
            +  +  I  I  ++  I ++L +    +  T + +  P+   ++NT+ L    +  S  +
Sbjct: 1739 DILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPK--PKVNTI-LTCFFTNISFEL 1795

Query: 1831 QPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVIS 1890
             P++PF I      ++++  +       +++ D DI L S  +KQ+Y +FS    +L + 
Sbjct: 1796 MPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFG--DLQLK 1853

Query: 1891 NTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQE 1950
                 +   +N+ +++ I KLTVSD ++ I S ++DE +  ++     +L     SKNQ+
Sbjct: 1854 GNMVNDPYHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQK 1913

Query: 1951 KSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGI 2010
               ++      W +  N+ Y G++  +GSA ++ EL  +L SL+   S           I
Sbjct: 1914 SKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDIP----NQSDI 1969

Query: 2011 VGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMS 2070
             G FS+ENVL  I    L   LSKL+D ++ +   Q++ +     QIESSHFRV L P S
Sbjct: 1970 SGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPES 2029

Query: 2071 LTKVLWAINEFTRVSEAYKTR--------SSLLQHKKTAPTDISELSNKFRSIQILSYNF 2122
            L ++LWA N+ +   + YK           S L +   AP    +L     S  ILSYNF
Sbjct: 2030 LVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAP----DLPLNVPSFHILSYNF 2085

Query: 2123 CIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKD 2182
            C+GW+F   S+++PGLI GY RLF+AY+K  GKLTL+D +FSIA+G SSD FFS GKEKD
Sbjct: 2086 CVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKD 2145

Query: 2183 QFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELK 2242
            ++NRSYLP+MQI YWF   G   +LFVR  GE LDV FLSS + +   A+ S+QTFQELK
Sbjct: 2146 KYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELK 2205

Query: 2243 KTMVDPFATNKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPS 2302
            K ++      +        E   L P L+ IR+ +C  KY GGVFK+FS ED +  S+PS
Sbjct: 2206 KDLIPGLPKKQKVNDDKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPS 2265

Query: 2303 FEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKS 2362
            FEV SP+V + ++YKHL +  K HWIR L+ ++ ++N L+  C P+LS   + ++ M+K 
Sbjct: 2266 FEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVKK 2325

Query: 2363 FNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLA 2422
             +S  +    S  SS  ++YK+LL +FDIA  +   KQ +SLSCEPKAKVQAD+GF+   
Sbjct: 2326 HSSSEESTL-SKPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFI 2384

Query: 2423 VKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYG 2482
              + TN+LD +EPLS S+ +E   A+ +HIFSRE STS  +D +D   + THP++I  +G
Sbjct: 2385 FTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHG 2444

Query: 2483 TTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKP 2542
            T L+S++ ++FN+KQLQ+L LFLDIW+    +   P     + ++ SS   L +++   P
Sbjct: 2445 TALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSS---LSIAQLSDP 2501

Query: 2543 AGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILL 2602
               +  PW +TLIF+N+KGD+DLGPSLGV+SV+  R+W  +DH+ + R+ L  F +   L
Sbjct: 2502 E--SIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSL 2559

Query: 2603 SSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANV 2662
            SS GRL G   ++   W SE++WP        PL+S+++ +  ++ K +FDYHMFLI  +
Sbjct: 2560 SSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAI 2619

Query: 2663 EHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSY 2722
             +  + L++E+D  G++ DLL V+  C  I L  TAL +AN +DIYNT +RMRQDNK SY
Sbjct: 2620 NNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISY 2679

Query: 2723 IETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAED 2782
            IETL++SN   +K      ++L SL+LL+TD+SV I    +Q+ P TLFD+EVLV+  E 
Sbjct: 2680 IETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIES 2739

Query: 2783 MSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTI 2842
            +SA ++T    K+ T L  Q+++  VSLS  K + +E  VS+I VK Y+++A+K+ GGTI
Sbjct: 2740 ISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTI 2799

Query: 2843 LAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRR 2902
            +  P +LV MTT+QE  S+++E LYT  F  K+ V+WNLGPINFI+EMW TH+RA+A+RR
Sbjct: 2800 IEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRR 2859

Query: 2903 --VHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWF 2960
              V  + D       +E +E++IK+ +  +++ Y+ LE PRI+MPQI+DLGDATPP+EWF
Sbjct: 2860 SQVVGVLDGQS----EEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWF 2915

Query: 2961 GVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996
            GVNR+RFP  THQ+ V  +QKL + AE EYA +LG+
Sbjct: 2916 GVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILGS 2951

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 2167 bits (5614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1189/3028 (39%), Positives = 1781/3028 (58%), Gaps = 108/3028 (3%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            MDA SQF+ IP++K+ +                     Y  R LAY I+ +++W LW+R 
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
             VKINI+S++IS LGGRVFFKN+ +I +D TISFL+ + TWRYWLLN R           
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120

Query: 121  XXXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXX-----XXXXXXXXX 175
                  S  L CRFFLE +G E+F+YNR VAYD I+   +                    
Sbjct: 121  KA-SANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSK 179

Query: 176  XSLHSSEEKLEDETL-AXXXXXXXXXXXXXRNFQEQDS-RSMLLQFLPIHLKVNRGAVLL 233
              + +SE   E++T  +             R FQE+ S R   L FLPI  KV+ G++++
Sbjct: 180  AEVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLII 239

Query: 234  GNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIK 293
            GN  TPS+MI    S  G++DVCQ +EKLDLYK+R+ LDF    + IK NI F +E  +K
Sbjct: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299

Query: 294  SYIVHSRMSRVWKKFKKIFFERMSHY-LAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVT 352
              I  +R+S++W++F K+     SH  L+H  + K+   +   F+EKWRGL+LY      
Sbjct: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVS--EEDPFYEKWRGLSLYR----- 352

Query: 353  TSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQ 412
                ++         ++  D  NHEYAK++ I+++ +   T+  DIPG+VPHGA  T+  
Sbjct: 353  ---GTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTA 409

Query: 413  RDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPG 472
             DGPDVGNSGAPPEFSL+ ++ G +IC+GPWA RQ+  L R+L PI SR+A P K+LTPG
Sbjct: 410  TDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPG 469

Query: 473  SRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDL 532
              RIYT+F  ++   E+  WRIPTRESSKD +FL+ YRE+  + RPFGW+D+K +K+T +
Sbjct: 470  CTRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYI 529

Query: 533  FMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWV 592
              TV  CPT  GF+N L  HL   EIRSSVNHDI  K  +     D+G+PLGWN EA W 
Sbjct: 530  CSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWT 589

Query: 593  FQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVND 652
                S Q+  F LR+HI L++D   DF SG PTPYELFRPFVYR  W I+ YS+YLNVND
Sbjct: 590  IDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVND 649

Query: 653  ANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWS 712
             NI+NNPLDFNENCYLS HGD L+ID  V  + ++   T V+Y+I TP F L L+TP W+
Sbjct: 650  HNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWN 709

Query: 713  TLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMN 772
            TL+EFMKNKEVGRS+DF + GSY  +S++D+ N+DTI+IEC S+ T LQC GFVIRYL N
Sbjct: 710  TLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTN 769

Query: 773  INMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEY 832
            + MNYFGDF HF T+EEYT E++       A  + +  +D        S  + +   T  
Sbjct: 770  VKMNYFGDFFHFVTSEEYTGEIR-------ANEVQNQFTDRQLYEDKASLSSYESIETSS 822

Query: 833  DLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDL 892
               E   D K+KR+DLKR  NE D+WFTF V +G ++ PE IY+C  CIGLHF  L +D 
Sbjct: 823  VRKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDF 882

Query: 893  RYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGL 952
            R  NYYMDL AS++   ++R+       I++ VR   G  +   G LS++ IHAHRM+GL
Sbjct: 883  RSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGL 942

Query: 953  PIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTS 1012
            P +E TYFC+WDF +G+LD++ DI F +G I +F+KI FG  D EN+L+YE     DMTS
Sbjct: 943  PPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTS 1002

Query: 1013 LTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLV-SEKS 1071
            LT+    IS  + +   +  +    +++  S I+FENE+Y  ++  +IP   L + +   
Sbjct: 1003 LTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNG 1062

Query: 1072 SKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYN 1131
            +K E    FET ++L+ F +  D   H++ Q+ +ITLHD+PYHRCAF+LP   Q + +Y 
Sbjct: 1063 AKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQ 1122

Query: 1132 KLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSSF 1191
             LFG+I P  S+PPL  P++P TID I + LLG   +  E  +        A + +  + 
Sbjct: 1123 DLFGSIAPSSSLPPLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNP 1182

Query: 1192 IQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQF 1251
             +GS + S  +EL        +      F  D+F+I++    ++INP     L +    F
Sbjct: 1183 FEGSDTESD-EELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHF 1241

Query: 1252 CVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICF--TFGSPKGKFEVSDYDH 1309
            C               V   S     +  +   R +  +I +   F   +    +S Y  
Sbjct: 1242 CSQDIVQILDDIEIGIVNHLSDL---QEGIETARNIKLQILYLDLFWGDRQNAGISLY-- 1296

Query: 1310 LYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLLKARP 1369
                ++   L++CQ K+  + N +K+    EVT   K  S+   IN+     K   +  P
Sbjct: 1297 ----LDRIDLEMCQ-KMLEENNETKI---TEVTFLNKIRSVRATINEASSVGKADERP-P 1347

Query: 1370 VFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSK 1429
              S+V                 LN  + D  ++ +Q++WL  Y+   +  + ++ ++   
Sbjct: 1348 ALSLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQS 1407

Query: 1430 SKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRH 1489
             +      +K+L+ + A+AS  Y I HD  VITKPA+ITRLS+ H+RENRSW+IITRLRH
Sbjct: 1408 IQESRSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRH 1467

Query: 1490 ILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSR 1549
            IL YLP  W +  +E   +++     D  + F+ +FSNWR+WEFSD+ + YIY+ +F   
Sbjct: 1468 ILTYLPIDWLRVIDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEG 1527

Query: 1550 SMKKNRITGAD-FKVNLERISFSLSSSTHEDE-DFMVVKNLKSVISNELIESSLPPSAKN 1607
              KK   +  +  K+ L  + F++ S+ +E E +F++ +      +N ++E +LP  +  
Sbjct: 1528 HSKKQENSMENSIKLKLASLFFTVYSTGYEVEHNFILTR------TNVVVE-TLPAIS-- 1578

Query: 1608 TEDSASTEKMI-ISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSVKHDVKPKL- 1665
             + S   EK+I ++ ++ +I+G     ++ L ++           L   S+K ++KP   
Sbjct: 1579 -DSSIIQEKIINVTGSLGTIKGKTSHKLINLKKL-----------LPELSMKKNLKPSTP 1626

Query: 1666 ------IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASS 1719
                  +  +LL +R++    L   +++ R F  + S   E     +   +S+      S
Sbjct: 1627 FLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLASKAISMTVYAQRS 1686

Query: 1720 EAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHFIWS 1779
            E W++H + +L ES +++ ++  +   +       V L+   +   AM +T+     +  
Sbjct: 1687 EMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGE 1746

Query: 1780 IKASVDGIRKELASAIPKKNNTTIS--TTKPETSSRLNTVTLDATLSGFSLNIQPLTPFG 1837
            I  ++    KEL       +++ I   +  P    ++N V L    +  +L I PL+PF 
Sbjct: 1747 IIENI----KELEKLFYSDSDSGIQQISQYPVMEQKINMV-LTCYFTNVNLEIMPLSPFS 1801

Query: 1838 IHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQNA 1897
               +   ++++  +    +  +++ D D+ L+S  +K+ Y +FS   + L   N  E   
Sbjct: 1802 FRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLK-GNILENPN 1860

Query: 1898 MFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQ 1957
              +N+ V++ I KLT+ D R  I S ++DE + I++  Q  SL + F  K    S ++  
Sbjct: 1861 YTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSL-KLFQRKKPAPSTEKSG 1919

Query: 1958 TNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFSIE 2017
              + W L  N+ Y G++V + S  ++LEL+ +L SL N I     +    +G+ G FSI+
Sbjct: 1920 RTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL-NKIQG---ISSKYNGLSGQFSID 1975

Query: 2018 NVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVLWA 2077
            NV  L+    L  +LSK++D ++ +   Q+     ++ QIES HFRV L P SL  +LW 
Sbjct: 1976 NVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWR 2035

Query: 2078 INEFTRVSEAYKTRSSLLQHKKT---APTDISELSNKFRSIQILSYNFCIGWIFDAGSET 2134
             N+       YK  +S+   K        + +E+   F S  +LSYNFC+GW+F    + 
Sbjct: 2036 GNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDN 2095

Query: 2135 DPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQI 2194
            +PGLI GY RLF+AY+K +GKLTL+DAYFS+A+G +SDTFFS G EKD++NRSYLP+MQI
Sbjct: 2096 EPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQI 2155

Query: 2195 GYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFA---- 2250
             YW   EG   ++++R  GE LDVNFL+S I +   +++SIQ FQELK+ +V   +    
Sbjct: 2156 SYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKE 2215

Query: 2251 -TNKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPS 2309
             T  TT++P+      + P  + IR+ NC  +Y GGVFK+FS  +  N+ KPSFE++SP+
Sbjct: 2216 QTQSTTQEPI----GDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPN 2271

Query: 2310 VEVAIDYKHLPDVIKS-HWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPK 2368
            V + ++YK+     ++  WIR L+T++ ++NTLF  C P+++  ++ ++ M+K  +S  +
Sbjct: 2272 VIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDRE 2331

Query: 2369 PDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTN 2428
            P   + IS   ++YK++L +FD+A  V   KQ +SL CEP+AKVQAD+GF+     + TN
Sbjct: 2332 PS-GTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTN 2390

Query: 2429 NLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSD 2488
            + D  EPL  ++ +E   A+ +HIFSRE STSF +D ID   + THP  I   GT L+SD
Sbjct: 2391 DYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISD 2450

Query: 2489 VQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAF 2548
            V ++FN+KQLQ+L LFLDIWK  + +   P     ++R+    D   +S  Q     +  
Sbjct: 2451 VHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRT----DLKSLSSVQSKDTDSTI 2506

Query: 2549 PWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRL 2608
            PW +TLIFSNI GD+DLGP+LGVLS+   R+W  +DH+   R+ L  + + I L+S GRL
Sbjct: 2507 PWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRL 2566

Query: 2609 GGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLK 2668
             G L ++   W SE++WP+     + PL+S+SL +  +  K +FDYHMFL+  + ++ + 
Sbjct: 2567 SGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDVH 2626

Query: 2669 LYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKD 2728
            +++E+D  GI  DLL V+V C  I L  TAL +AN +DIYNT++R+RQDNK SYIETLK+
Sbjct: 2627 IHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLKE 2686

Query: 2729 SNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQ 2788
            SNT   +     +++L SL+L++TD+SV I    +Q+ P +LFD E+LV+  E++SA ++
Sbjct: 2687 SNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARSE 2746

Query: 2789 TQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAI 2848
            T   +K+KT L  Q+++  V+LS  K + +E+I++ I V++Y+ +A ++ GG I+ AP +
Sbjct: 2747 THAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRL 2806

Query: 2849 LVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRD 2908
            L+ MTT+Q+  S+++E LYT SFG K+ V+WNLGP+NFI+EMWATHVRA+A+RR     D
Sbjct: 2807 LIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRR--SQID 2864

Query: 2909 KNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFP 2968
                   +E + ++IK  +  +++ Y+PLEEPRI+MPQI+DLGDATPP+EWFG+NR+RFP
Sbjct: 2865 VTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFP 2924

Query: 2969 GLTHQSVVVPLQKLAHMAEEEYARVLGN 2996
              THQ+ V+ +QKL H AE+EY  +LG+
Sbjct: 2925 AFTHQTAVILVQKLVHTAEKEYGSILGH 2952

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 2126 bits (5508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1180/3010 (39%), Positives = 1760/3010 (58%), Gaps = 126/3010 (4%)

Query: 39   YFGRALAYCITILMKWVLWRRYKVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGS 98
            Y  RA AY +T +++W+LW++ KVK++I +L+IS L GRVFFKNLT+I KD+TI+ L+GS
Sbjct: 42   YLSRAFAYGVTFILEWLLWKQAKVKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGS 101

Query: 99   FTWRYWLLNSRXXXXXXXXXXXXXXD-----------------QKSRMLQCRFFLESDGF 141
             TWRYWL+ +R                                +K   L CRF  E +GF
Sbjct: 102  ITWRYWLIRTRKSEYRVAQMAHASAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGF 161

Query: 142  ELFIYNRTVAYDGILRSVAXXXXXXXXXXXXX----XXXSLHSSEEKLEDETLAXXXXXX 197
            E+FIYNRT AYD I+  ++                    S  SS++K+E ET +      
Sbjct: 162  EMFIYNRTYAYDNIVNVLSKVEREKFEKFMAENDFLDPSSDGSSDDKIE-ETSSATNSTD 220

Query: 198  XXXXXXXRNFQEQDSRSML---LQFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVD 254
                   R FQ  D+R  L   L+ LPI   +N+G++L+GN  TP V+I+ +ESA  + D
Sbjct: 221  EETIANDRTFQ-NDTRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQD 279

Query: 255  VCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFE 314
            V ++  KLDLY+++Y++   N+++ +K NI + +E          ++SR+W +F +IF  
Sbjct: 280  VGEAPSKLDLYRMKYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIF-- 337

Query: 315  RMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSVGXXXXXXXXNMMSDVG 374
            ++  +   S+ +K     H  F +KW+GL++Y        D            ++  D+ 
Sbjct: 338  KLVPFPFKSNRRKEQ--PHDNFMQKWKGLSMYRNDMFGEFDE---------FDDIEFDIS 386

Query: 375  NHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLY 434
            +HEYAK+T +LKS +V + + YD+PG VPHGA       DGPDVGN+ APP++  +  ++
Sbjct: 387  SHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIF 446

Query: 435  GATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRI 494
            G T+CYGPWA RQ  +LQ +L P VSR A P+KKL PGS+RIYT   L++  MED  WRI
Sbjct: 447  GGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRI 506

Query: 495  PTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLV 554
            PTRESSKD +FL  Y+E+ +  RPFGW+DIK+++++     + MCPT  GF+N +   LV
Sbjct: 507  PTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLV 566

Query: 555  KPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSD 614
              EIRSSVNHDIF K+ + + + D+GYPLGWN+EA W    +S Q+  F LR+H+ L++D
Sbjct: 567  DTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIAD 626

Query: 615  IFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDT 674
               DF SG P PYELFRPFVY  +W++  YS YLNVND NI+NNPLDFNENCYLS+HGD 
Sbjct: 627  TLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDD 686

Query: 675  LKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGS 734
            L ++  V  KTIT   T + Y I TP F L L+TP W+TL+EFM+NKEVGRS+DF + GS
Sbjct: 687  LTMNVMVPKKTITSRFTNMTYDIYTPMFRLLLNTPPWNTLNEFMRNKEVGRSHDFRLKGS 746

Query: 735  YQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTREL 794
            Y  +S++D+ N+DT+ +EC S+ T L   GFVIRYL+N+ MNYFG+F HF T+EEYT   
Sbjct: 747  YLIYSELDIDNVDTLTVECSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNT 806

Query: 795  QEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYDLHEFNEDPKVKRADLKRKENE 854
            +    T    +I+++  D+    SS   V+     +     +  +   +K++DLKR  NE
Sbjct: 807  R---PTDLENIISEDRRDD--DFSSYESVSRISSNSSDKNPKAKKKHSLKKSDLKRTSNE 861

Query: 855  KDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHS 914
             D+WFTF V DG L+ PE IY+   CI LHF  L VDLR  NYYMD+ A+     +KR+ 
Sbjct: 862  TDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDLRSCNYYMDILATACDINLKRYV 921

Query: 915  DFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDS 974
                  I++ V    G      G LS++ IH HRM+GLP  E TYFC+WD   G L+IDS
Sbjct: 922  GKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDS 981

Query: 975  DIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVA 1034
            ++ F +GL GAF KIGFGYKD EN+L+YE     DMTSLT+  ++I  ++ D +T     
Sbjct: 982  NMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHAD 1041

Query: 1035 LDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKNEVQGLFETSLDLAYFGQNRD 1094
            L L++   ++IDFENERYS +M  KIP+++  +      +     F+  ++   F QN+D
Sbjct: 1042 LKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFSNEDNDLSLLNFKVDMNFTNFVQNQD 1101

Query: 1095 FDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNT 1154
            F+ HR +QR++I L+D+PYHRCAFLLP  YQK+ +YN+LFGAI P  S+PPL  P+  +T
Sbjct: 1102 FNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNELFGAIAPSSSLPPLPIPLTADT 1161

Query: 1155 IDSIFESLLGKHYQDYECCSDANYS-KETAITEENSSFIQGSGSTSALKELSSYSQNCPS 1213
            I+ + E LL    +DY    + NY  KE+++     S I+ + + + +    ++S   P 
Sbjct: 1162 IEYVLEDLL----EDYMGLFEGNYDIKESSVENLELSAIEATRAITGIGAERTHSN--PI 1215

Query: 1214 YKLEPKFEYDSFIINLGKTIIAINPS----SEKCLLSIYLQFCVGSXXXXXXXXXXXXVE 1269
               +   E D++++ +   +I INP+     EK L  IY Q  V              V+
Sbjct: 1216 TLSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHIYDQDAV----QIIDGIEIGIVK 1271

Query: 1270 KFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQ 1329
            + S      + +TN++V        +G  +        D++ +  +     L +K +   
Sbjct: 1272 RLSSIHDGVTTMTNVKVQIKHFNLFWGEKES-------DNVSMFFDKMDFALTEKTLEQN 1324

Query: 1330 TNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLLKARPVFSIVFXXXXXXXXXXXXXX 1389
            +  + LE T  V + +KA  +   + Q  L P    +  P  ++                
Sbjct: 1325 SEKNLLEMT--VLAKIKAVRLT-VVQQPGLIPTQ--ERPPAITVGVEGFEFWSTAIEKQV 1379

Query: 1390 XXLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALAS 1449
              ++  + D  V+ +Q+EW   Y+         +  S+++ +      QKELI R   AS
Sbjct: 1380 NSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELISRLTAAS 1439

Query: 1450 VEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKE 1509
              Y I HD  VITKPA+I RLS+ H+REN+SW+IITRLRHIL YLPK WY    + L+  
Sbjct: 1440 EYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNVGQPLRDR 1499

Query: 1510 EFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLS-RSMKKNRITGADFKVNLERI 1568
            +F    DAR  F+ IFSNWRSWEFSDV + YIY ++FL+  + KK +     FK+N+   
Sbjct: 1500 KFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQSLQKLFKLNIGNF 1559

Query: 1569 SFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMI-ISCNIKSIR 1627
              ++ S+ ++ +  +VV N K ++  EL  SS  P     E+S   E++I IS  +  I+
Sbjct: 1560 FMTVYSTNYDVDHSIVVSNAKLLL--ELTPSSTEPK----ENSLQREELIDISGTVDVIK 1613

Query: 1628 GDLGDNIVKLVRMYDGLSNLSDTNLKTTSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLI 1687
            G L   ++KL ++   L+  S+            KP  +    +V+  D  + +D  +L 
Sbjct: 1614 GKLSTKLLKLQKLIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLN 1673

Query: 1688 LRSFRNRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLF 1747
            +     R S   E +   +    S+      +E  ++H ++VL E  + +    F+   +
Sbjct: 1674 MNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTW 1733

Query: 1748 HEHLITKVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTK 1807
             +     +  +S  +    MA TE+ +  I  IK  +D I ++L   + ++     +   
Sbjct: 1734 AQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQL--ELERRLTQHPTVYD 1791

Query: 1808 PETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIE 1867
            P  S+    V      S  S++I P++PF +  S   I+    K    +  I ++D D  
Sbjct: 1792 PNKSN----VIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFF 1847

Query: 1868 LLSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDE 1927
            L S ++K++Y++ S   + + + N        +++ +++ + KLT S+P+  +YS ++DE
Sbjct: 1848 LTSDQTKEQYMRLSMKKLQIRV-NVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDE 1906

Query: 1928 TLAIKNFAQLKSLAEKFP-SKNQEKSKQ--RKQTNIIWLLHVNVEYIGIIVLLGSAGYVL 1984
             +A ++   L++L   F  S ++E + Q  +++T  +W L  +++Y GI++ + S  YV+
Sbjct: 1907 RVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVM 1966

Query: 1985 ELNNVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKV 2044
            E ++ ++S+SN   A      G   I G  S+EN+L LI  + L   LSK++D+AVN+  
Sbjct: 1967 EFHSYVSSISNANGA----PSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVST 2022

Query: 2045 SQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAY-KTRSSLLQHKKTAPT 2103
             Q   D+ ++IQ+ESSH R+ L P SL ++LW  N+  ++SE Y K  S  L        
Sbjct: 2023 LQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSD 2082

Query: 2104 DISELSNKFR-----------SIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKP 2152
            D  + +N  +           SI  LSYN C+GW+F+       GLI GY RLF+AY+  
Sbjct: 2083 DKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENC 2142

Query: 2153 YGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWF-VKEGDTSNLFVRI 2211
             GKLT++D+YF+ A G +S TF+     K+ FNR YLP+MQI +W+ V EG   +++VR 
Sbjct: 2143 MGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEG-MKDVYVRF 2201

Query: 2212 TGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTT----EKPVNSEAAPLD 2267
            TGE LDV +LS  +      + SI+ FQ+LKK ++      +      +KPVNS     +
Sbjct: 2202 TGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPVNSS----N 2257

Query: 2268 PILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHW 2327
             IL  I++ NC  KY GG + +F+  D   N  P+ E++SP + V + YKH     K H 
Sbjct: 2258 NILKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHS 2317

Query: 2328 IRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLR 2387
            IR LV +DP++N L+ TC P++    +DVR++   + S+ K    +  S   ++Y+KLL 
Sbjct: 2318 IRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLE 2377

Query: 2388 AFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRA 2447
             +D+A  V   KQ +SLSCEPKAKVQADVGFE L V M TN  D  EPL+ S  I+  +A
Sbjct: 2378 DYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKA 2437

Query: 2448 TSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDI 2507
            + +H+FSRE STSF + ++D   + TH   I TYGT+L+SD+ +YFN+KQLQ+L LFLDI
Sbjct: 2438 SIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDI 2497

Query: 2508 WKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNA-FPWNYTLIFSNIKGDIDLG 2566
            W    Q+ E+     +    +   DK       KP    +  PW +TLIF+N+KGDIDLG
Sbjct: 2498 W----QLSELLNPVTSSQEQVIRKDK--KKSVDKPIHNESQLPWCFTLIFTNVKGDIDLG 2551

Query: 2567 PSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWP 2626
            PSLG++S+R +R+W  +DHF   RQ L  F++++LL S+GRL G + I+   W SE+ W 
Sbjct: 2552 PSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWL 2611

Query: 2627 VKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVS 2686
                    PL++LSL    + +K +FDYHMFLI  V ++L +L++ERD +G+  DLL VS
Sbjct: 2612 QDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVS 2671

Query: 2687 VTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLES 2746
             +C +I L  TAL +AN +DIYNTIIRMRQD K SYIETLKDSN ++ K     +++L+S
Sbjct: 2672 FSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKS 2731

Query: 2747 LSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNF 2806
            L LLRTDL+V I    LQ+ P +LFD+EV+V+    +SA ++T  + K+ T LN ++++ 
Sbjct: 2732 LQLLRTDLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDA 2791

Query: 2807 KVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELL 2866
             +SLS  K + +E+ +S+I V +Y+ +A+K+RGGTI+  P + V MTTWQE  S+++E L
Sbjct: 2792 TLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYL 2851

Query: 2867 YTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSF-FEDEHIEEKIKD 2925
            Y+  F  KV V+WNLGP+NF++EMW THV+A+A+RR   +     SF   ++ +E++IK+
Sbjct: 2852 YSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVL---TGSFNVSEKDVEKRIKE 2908

Query: 2926 VDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHM 2985
             +   K  Y+P+EEP+I+MPQIKDLGDATPPVEWFGVNR+RFP  THQ+ VVP+Q L ++
Sbjct: 2909 EENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYL 2968

Query: 2986 AEEEYARVLG 2995
            A+++YA+ LG
Sbjct: 2969 AQKQYAKTLG 2978

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 2121 bits (5495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1179/3065 (38%), Positives = 1763/3065 (57%), Gaps = 154/3065 (5%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            M + S+F+++PIS   N                     Y GRA+AY  +++++W+LW+R 
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
             +K+NI+SL+IS LGGR+FFKN+T+I KD TIS LQG+ TWRYWLL +R           
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 121  XXXD-QKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXXSLH 179
                 +K+  L CRF L  +G E+F+YNRT +YD I+   +                + H
Sbjct: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180

Query: 180  SS------------------EEKLEDETLAXX--XXXXXXXXXXXRNFQE--QDSRSMLL 217
            SS                  + KL DE                  R F +   D  S+ L
Sbjct: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240

Query: 218  QFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVD 277
            Q  P+ ++V+R ++  GN  TPS++II  E   G++D CQ  EKLDLYK++  ++ +N  
Sbjct: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300

Query: 278  LKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFF 337
            + +KPNI + +E  +K  I   ++SR+WK+F  I    ++  L  +  +K        F 
Sbjct: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPIT-GIITRPLGLTQRKKKRNEPPDLFI 359

Query: 338  EKWRGLALY--SEYNVTTSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYA 395
            +KW+GL+LY  + +  TT D            ++  D  NHEYAK++ ++K  K   TY 
Sbjct: 360  QKWQGLSLYKGTIFEPTTDD----------LDDIQFDFLNHEYAKFSSVVKCPKAIFTYE 409

Query: 396  YDIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRML 455
            YDIPG VPHGA  T  + DGPDVGN+GAPP  SLD +++G +ICYGPW  RQ+ ++  ML
Sbjct: 410  YDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSML 469

Query: 456  CPIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNK 515
             P VSR   P+K+  PGS RIYT   LS+ +M+D  WRI TRE SKD  FLK Y+E+ + 
Sbjct: 470  APAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDD 529

Query: 516  ERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTI 575
             RPFGW+D++ +KE+  + T  + PT  GF+N +  HL + EIRSSVNHDI  K      
Sbjct: 530  YRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDF 589

Query: 576  SADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVY 635
              D+ YPL WN  A W    NS Q+ TF LR+HI L++D   DF SG PTPYELFRP   
Sbjct: 590  DIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSET 649

Query: 636  RFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNY 695
               W +D Y IYLNVND NI+NNPLDFNENCYLSLHGD L I+ ++  + IT     + Y
Sbjct: 650  FINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITY 709

Query: 696  SIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQS 755
            +I TP F L L+TP W+TL+EFMK KEVGRSYDF   GSY  +S++DV N+DTI I C+S
Sbjct: 710  NITTPMFRLLLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICES 769

Query: 756  KYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESS 815
            + TTLQC GFVIRYL N+ MNYFGDF +F T+EEYT        TR+ E+  + +S   S
Sbjct: 770  RGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTG------ITRDEELEEELISSNLS 823

Query: 816  QMSSTSFVTNDKETTEYDL--HEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPEN 873
                   V +D E+   D    E  E   +KR+DL+R  NE D++ TF V DG ++ PE 
Sbjct: 824  DNEDNGDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPET 883

Query: 874  IYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVD 933
            IY+C +C  L F  L +DLR  NYYMDL ASL  T ++R+++ +P +IF  V        
Sbjct: 884  IYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESS 943

Query: 934  GHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGY 993
              QGFLS+L+IH HRMFGLP  E TYFCKWDF IG L+++S+ DF KG + +FS+IGFG+
Sbjct: 944  EAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGF 1003

Query: 994  KDYENMLIY--EIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENER 1051
            KD EN+L+Y  E+I   DMTSLT+    IS  + +  +   +AL    ++ + IDFE+  
Sbjct: 1004 KDLENILLYSKEVIN--DMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESAN 1061

Query: 1052 YSNKMSAKIPNIKLLVSEKSSKNEVQGLFE--TSLDLAYFGQNRDFDNHRNLQRNHITLH 1109
            YS+++   IP++K+ +       +   LF   T + L  F Q ++F  HR++QRN+ITL+
Sbjct: 1062 YSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLN 1121

Query: 1110 DSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQD 1169
            D+ +HR +FLLP  +QK  LYN+L+G+I P  S+P L  P++P T+D I E  LG++   
Sbjct: 1122 DAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEY--- 1178

Query: 1170 YECCSDANYSKETAITEENSSFIQGSGSTSALKELSSYSQ--------NCPSYKLEPKFE 1221
                         ++ ++ + F    GST+   + S++ +        +  +   E  ++
Sbjct: 1179 ------------VSLLDDRTIFRMPFGSTNTPNQASTHHEEDMDPLEFSNSTVSTEKNYQ 1226

Query: 1222 YDSFIINLGKTIIAINPSSEKCLLSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAV 1281
             D+ +I++    + INPS    + S+       +            ++  S +    S++
Sbjct: 1227 CDNLVIDIEYISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSI 1286

Query: 1282 TN--LRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTE 1339
            TN  LRVL   I   +   + ++ +  Y      ++    ++ Q+ I        L    
Sbjct: 1287 TNIKLRVLYSDI---YWGERDRYGIELY------LDKLDFEMSQRNIEKDREKGLL---- 1333

Query: 1340 EVTSSLKASSINFFINQQQLKPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDF 1399
            E+T   K  SI   I+++    K   +  P  S+V                 ++  + D 
Sbjct: 1334 EITMLAKTRSIRASISEEG-STKNEKERPPALSLVVEGCELWSATAEKQVNSIDTISTDI 1392

Query: 1400 FVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSP 1459
             ++ SQLEWL  ++         +  + +  +      +++LI +   A+  Y I HD  
Sbjct: 1393 TIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPY 1452

Query: 1460 VITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARD 1519
            VITKPA+ITRLSK H+RENRSW+IITRLRHIL Y+P  W    E  LK++     D+A+ 
Sbjct: 1453 VITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKK 1512

Query: 1520 QFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGAD-FKVNLERISFSLSSSTHE 1578
             F+ +FSNWR+WEFSDV + YIY R+FL+   +K++ +     KVNL   SF L+S T  
Sbjct: 1513 VFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNLS--SFFLTSYTAG 1570

Query: 1579 ---DEDFMVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMI-ISCNIKSIRGDLGDNI 1634
               D++F++        +N + E + PP    TE   S EK+I ++ +I S++G+  D +
Sbjct: 1571 YDIDQNFVLTN------ANIVFEQT-PPF---TEAGVSREKLINLTGSIGSVKGNFSDEL 1620

Query: 1635 VKLVRMYDGLSNLSDTNLKTTSVKHDVKPK--LIQGVLLVDRTDTNIHLDGKRLILRSFR 1692
            ++L  +   L+   +   ++ S + D  PK   +  +LL ++T+  + +   +L  R   
Sbjct: 1621 LRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRILN 1680

Query: 1693 NRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLI 1752
             + S  ++          S+      SE  + H +  L+E+ ++D +L+ +   +     
Sbjct: 1681 GKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPT 1740

Query: 1753 TKVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSS 1812
              V  +     + +MA T   ++ +  +  +V  I K+L+ +         S  K     
Sbjct: 1741 VLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLKDV 1800

Query: 1813 RLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTR 1872
             +  V     LS  S  I P++PF I   T   ++  ++    N  I + D D  L S  
Sbjct: 1801 EIEVV---CQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDL 1857

Query: 1873 SKQRYLKFS----QSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDET 1928
            +KQ+Y + S    Q T NL+     E   + ++  V++ + KLT S+P   + S ++DE 
Sbjct: 1858 TKQQYFRISFGDFQITYNLI-----EGEFIIVDANVSASMIKLTFSEPNRILSSFLQDER 1912

Query: 1929 LAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNN 1988
             A ++F  LK+L      + + + +      + WLL  +++Y GI+V + +  +V E + 
Sbjct: 1913 TASESFKLLKALKPFLLPQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETHA 1972

Query: 1989 VLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEE 2048
            ++ S+S +I   KY E+         SIENV+ LI    +   LS+++D +++    Q+ 
Sbjct: 1973 LVLSMS-DIDTEKYTEKD--ETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKM 2029

Query: 2049 GDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSSLLQHKKTAPTDI--- 2105
             +   + Q+ES+HFR+ L P SL +++W   +F  ++  YK      + + T   DI   
Sbjct: 2030 MELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYK------EQRGTDLWDIKAS 2083

Query: 2106 ---------SELSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKL 2156
                     S +     S  +LSYNFCIGW+F   + + PG++ G+ RLF+AY+  YGKL
Sbjct: 2084 KLKKEKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKL 2143

Query: 2157 TLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERL 2216
            TL+DA+FS+A GA+S TF+    E +  NRSYLP+MQI YW  K G   ++F+R  GE L
Sbjct: 2144 TLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEAL 2203

Query: 2217 DVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEKPVNSEAAPLDPILSKIRAF 2276
            DV+FL++ I +    ++S Q FQELK +++ P     TTE     +   L P LS I++ 
Sbjct: 2204 DVSFLTTFITVIESMLQSFQVFQELKTSLIQP--NTSTTENNTEPKIKSLAPFLSNIKSV 2261

Query: 2277 NCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDP 2336
            NC  KY GGVFK+FS EDI+++ +PSFE+++P V +  +YKH    +K HWIR LV +  
Sbjct: 2262 NCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGS 2321

Query: 2337 SNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNST----ISSSGMNYKKLLRAFDIA 2392
            ++NTLF  C P+++   + +  M+K  +S  K +  +T      S  ++YK+LL  FDIA
Sbjct: 2322 THNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIA 2381

Query: 2393 FLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHI 2452
            F +   +Q +SLSCEPKAKVQADVGF+   + + TNNLD +EPL+ S+ I+  +A+ +HI
Sbjct: 2382 FKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHI 2441

Query: 2453 FSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDS 2512
            FS+E STSF +D ID  F+ THP+II  YGT L+S+V +YFN+KQLQ+L LF+DIWK  S
Sbjct: 2442 FSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSS 2501

Query: 2513 QILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVL 2572
             I   PKG +   +  + H  LP    Q        PW++TLIF+NI G  DLGPSLGVL
Sbjct: 2502 FIRPGPKGKSNNGKRENKHLTLP----QPSNLYGEIPWSFTLIFTNINGSADLGPSLGVL 2557

Query: 2573 SVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFY 2632
            S++  R+W  SDH+ D RQ +  F + +   S GRL G   ++   W SE+SWP +   +
Sbjct: 2558 SLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTH 2617

Query: 2633 ETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKI 2692
              PL+++S+ + +L+LK +FDYHMFLI  +      L++E+D +G + DLL V+ TC  I
Sbjct: 2618 NYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMI 2677

Query: 2693 HLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQN-QNVLESLSLLR 2751
            ++  TAL +AN +D+YNT++RMRQDNK  Y+ETL++S+T  T+    N +++L SL+LL+
Sbjct: 2678 NICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQ 2737

Query: 2752 TDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLS 2811
            TD+S  I +  LQV P  LFD+EVLV+  E++SA   T    K+KT L  ++++  V+LS
Sbjct: 2738 TDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALS 2797

Query: 2812 AFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSF 2871
              K + +E+ VS I V +Y+++A+K+ GGTI+  P + + MT+WQE +S+++E LY  +F
Sbjct: 2798 TSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTF 2857

Query: 2872 GGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNK 2931
              K+ VKWNLGP+NFI+EMW THV+ALA+RR  ++ D +     DE ++++IK+ +  +K
Sbjct: 2858 EDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQ--TDEEVQKRIKEEENISK 2915

Query: 2932 YVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYA 2991
              Y+P+EEPRI+MPQI+DLGDATPP+EWFGVNR+R P  THQ+VVVP+QKL H AE++YA
Sbjct: 2916 LKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYA 2975

Query: 2992 RVLGN 2996
             +L N
Sbjct: 2976 SLLDN 2980

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 2109 bits (5464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1181/3046 (38%), Positives = 1758/3046 (57%), Gaps = 158/3046 (5%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            M+  SQF+ + +S E N                     Y GR  AY IT++++W LW+ +
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            KVKI+++SL+I+ L G + F+NL +I KDQTIS L+GS  WRY LL +R           
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 121  X--------XXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXX 172
                         K+  L CRF L  +GFE+FIYNRTVAY+ I++  +            
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 173  XXXXS--LHSSEEKLEDE---TLAXXXXXXXXXXXXXRNFQE--QDSRSMLLQFLPIHLK 225
                S   H   E+ +D+                   R F E     +S+ ++FLP+ L+
Sbjct: 181  KQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQ 240

Query: 226  VNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNIS 285
            ++RG+++LGN  TPS++I    S  GVVD+CQ  EKLDLYK+ + +DF ++D+ I+ NI 
Sbjct: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300

Query: 286  FGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLAL 345
            +   N  K+   + ++SR+W  F K+      H   ++ +      + + F  KW+GL L
Sbjct: 301  Y---NRKKATFKNGKLSRMWATFVKVL-----HIPFYNKSHNNKGTESEPFMTKWKGLGL 352

Query: 346  YS--EYNVTTSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVP 403
            Y    ++    D+            +  D  NHEYAK + I+KS +  +TY+YDIPG+VP
Sbjct: 353  YKGLTFDRDGEDYD----------EVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVP 402

Query: 404  HGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDA 463
            HGA  T+E   GP+VGN+GAPPEF +D + YG TICYGPWA R+IQ+L RM+ P V+R +
Sbjct: 403  HGAHPTLE---GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSS 459

Query: 464  IPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLD 523
            +P+K L+PGSRRIYT F  +  +++ + WRIPTRE SKDQ+FLK+++ +  + RPFGWLD
Sbjct: 460  VPIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLD 519

Query: 524  IKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPL 583
            +K   ++   +T  +CP   GF NK+  H  + E  SSVNHD+  K +   ++ D+GYPL
Sbjct: 520  LKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPL 579

Query: 584  GWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDN 643
            GWNS A W    +S Q+ TF LR+H+ L++DIF DF SG PTPYELFRPF+Y+  W ID 
Sbjct: 580  GWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDG 639

Query: 644  YSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFH 703
            YSIYLNVND NI+NNPLDFNENCYLSLHG+ L ID +    +ITG    V Y I TP F 
Sbjct: 640  YSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFR 699

Query: 704  LQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCC 763
            L L+TP W+TL+EFMKNKEVGRSY F + G Y  +S++D+ N+DT+ +EC S  TTL C 
Sbjct: 700  LLLNTPPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCY 759

Query: 764  GFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFV 823
            GFV+RYLMN+ MNYFGDF HF T+EEYT  ++ K +    +   +++ D S+ +S+ S  
Sbjct: 760  GFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGG 819

Query: 824  TNDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGL 883
             +D             DP V R+D+KR  NE D+WFTF V +G LV PE IY+C  C+ L
Sbjct: 820  LSDPYV------RLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVAL 873

Query: 884  HFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELN 943
            HF  L VDLR  NYYMDL A++S T IKR+       +F+ +R   G  +   G L+ L 
Sbjct: 874  HFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALT 933

Query: 944  IHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYE 1003
            IH HRM+GLP IE TYFC+W   +  L I+SD +FAKG    F+ IGFGY + EN L+Y+
Sbjct: 934  IHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYD 993

Query: 1004 IIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNI 1063
            +  P DMTS+T+    ++  V + ++  VV  D+  ++ + IDFENERYS ++  K+P++
Sbjct: 994  VETPDDMTSVTVRVRDMNVVVENDSSRAVV--DVPNLTFTSIDFENERYSQRIDLKVPSL 1051

Query: 1064 KLLVSEKSSKNEVQGLFE--TSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLP 1121
             +L+      +E   L +  T + L  F Q RDF  HR+ QR++ITL+DSP++RC+FLLP
Sbjct: 1052 SILLLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLP 1111

Query: 1122 MQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKE 1181
               Q++ LY  L G+I+P  S+PPL  P++  TID I E LLG+     +C    +Y  +
Sbjct: 1112 CYLQESPLYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKC----DYDTQ 1167

Query: 1182 TAITEENSSFIQGSGSTSALKE------LSSYSQNCPSYKLEPKFEYDSFIINLGKTIIA 1235
              + + +S     S  TS   E         ++Q        P  +YD+ II++    + 
Sbjct: 1168 RTVDDPDSP--SESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVD 1225

Query: 1236 INPSSEKCLLSIYLQFCVGSXXXXXXXXXXXXVE----KFSKYFVEKSAVTNLRVLAPKI 1291
            ++P     L+  Y+   +G             +E    K        + V NL++    I
Sbjct: 1226 LDP-----LICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLWNNTCVLNLKLYVVDI 1280

Query: 1292 CFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNS-SKLEYTEEVTSSLKASSI 1350
             F +G    K     +D L  ++   + DL  + I  +  + SKL        S++A+  
Sbjct: 1281 NFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLR-------SVRATVF 1333

Query: 1351 NFFINQQ-QLKPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWL 1409
            +  I +  + +P       P  S+                  ++  + D  V+ SQLEWL
Sbjct: 1334 DRSITEGVEERP-------PALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWL 1386

Query: 1410 SDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITR 1469
            S Y+         +  SF+K     Q  +++L+     AS  Y I H+  VITKPA+I R
Sbjct: 1387 SVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMR 1446

Query: 1470 LSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWR 1529
            LS  H+REN SWRIITRLRHIL YLP  W  R   +++        DA      + S+WR
Sbjct: 1447 LSNGHVRENPSWRIITRLRHILTYLPNEW--RNNSAIQVSPTVDSTDA-----SVASHWR 1499

Query: 1530 SWEFSDVQKCYIYKRVFLS-RSMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNL 1588
             WE SD+ + YIY+ +FLS +S  + +      KV+     F++ S     E + V  N 
Sbjct: 1500 RWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYS-----EGYRVAHNF 1554

Query: 1589 KSVISNELIESSLPPSAKNTEDSASTEK---MIISCNIKSIRGDLGDNIVKLVRMYDGLS 1645
              VI+   I     P+A+ ++   + +    M ++ ++ +I+G+L D ++KL  ++   S
Sbjct: 1555 --VITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNIF---S 1609

Query: 1646 NLSDTNLKTTSVKHDVKPKLIQGVLLV-DRTDTNIHLDGKRLILRSFRNRFSTFMERVPS 1704
                  LK +    ++       VLL  DR++    L   RL  R    + +  +E++ +
Sbjct: 1610 KAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKN 1669

Query: 1705 KSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSV 1764
             +   +S       SE+W++H   VL E+  ++ +L  +  L+       + ++     +
Sbjct: 1670 SAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHI 1729

Query: 1765 SAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLS 1824
             AM STE  ++ I  I  S+  +++  A    +K    +  T    S  L    L  + S
Sbjct: 1730 RAMTSTELLVNSIKQIMESISELKRHFAM---EKTTPNVQGTSTNLSIPLQNTALTVSFS 1786

Query: 1825 GFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQST 1884
              +  + PLTPF +      + +++ +       I+I D +I L S ++ ++Y  F+   
Sbjct: 1787 DVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGD 1846

Query: 1885 VNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKF 1944
            +  V  N P +++  LNVG+++ + KLT+S+PR  + S ++DE L  ++   +K L + F
Sbjct: 1847 LQ-VKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLF 1905

Query: 1945 PSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLE 2004
                + K+   + + + W L  N+ Y GI+V + S  +V E++ +L +++N   A    +
Sbjct: 1906 SPLARNKT---QSSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAMNN---ASDGQD 1959

Query: 2005 QGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRV 2064
            +G H + G  SIEN LLLI    L  +LSKL+D ++ +  SQ+  +  Q+ QIESSHFRV
Sbjct: 1960 EGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRV 2019

Query: 2065 ALCPMSLTKVLWAINEFTRVSEAYKTRSSLLQHKKTAPTDISELSNK------FRSIQIL 2118
             L P SL +VLW  ++   + E ++      Q K  +P  + + S        FRSI IL
Sbjct: 2020 CLSPGSLVQVLWGTHQLQSLLEYFRKHRK--QDKAISPFSLFDGSASADRQIDFRSIHIL 2077

Query: 2119 SYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNG 2178
            SYN CIGW+F  G +   GLI G++RLF+AY+K YGKLTL+D YFS+A+G S+DTF+S G
Sbjct: 2078 SYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQG 2137

Query: 2179 KEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTF 2238
             EK ++NRS+L ++QI YW  +     +LF+R+ GE L+V+ LS+S  I    + SIQ F
Sbjct: 2138 SEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKF 2197

Query: 2239 QELKKTMVDPFATNKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNN 2298
            Q LKK  +    +    +  + + +  + P LS IR  +C  KY GGV K++S +D+   
Sbjct: 2198 QTLKKERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRA 2257

Query: 2299 SKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRN 2358
              PS E++SP V +A+ Y H     + H IR LV++DP++N L+  CVPIL+ + +  + 
Sbjct: 2258 EGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQR 2317

Query: 2359 MLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGF 2418
            M++    K  PD     SS  ++YK LL +FDIAF V  G+Q +SLSCEP+AKVQADVGF
Sbjct: 2318 MVQ----KHSPDETPLESSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGF 2373

Query: 2419 EKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEII 2478
            +     + TN+L +  P  +S+ +E ++++ RHIFSRE S SF +D +D   + THP++ 
Sbjct: 2374 DSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPDV- 2432

Query: 2479 QTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGN------TRTRSLSSHD 2532
              +G  LVSD+ ++FNMKQLQ+LNLFLDIW+ + ++    +  +      T++ +LS   
Sbjct: 2433 --FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQTKSMTLSKRT 2490

Query: 2533 KLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQR 2592
              P S            W++TLIF+N+KGD+DLGPSLGVLS+R +R+W  +DH+   R+ 
Sbjct: 2491 STPTS----------ICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRV 2540

Query: 2593 LSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSF 2652
            L  F + + + S+GRL G   ++   W SE+++P  G    +  +SLSL +G +A+KT+F
Sbjct: 2541 LHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAF 2600

Query: 2653 DYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTII 2712
            DYHMFLI  ++ +   L +E D  GIL DLL V+++C ++    TAL +AN +DIYNTI 
Sbjct: 2601 DYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTIT 2660

Query: 2713 RMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFD 2772
            RMRQDN+ SYIETL++SN+   +      ++L+SL+LLRTDLS  I  F  Q+ P +LFD
Sbjct: 2661 RMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFD 2720

Query: 2773 MEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIK 2832
            +EVLVL  +++SA ++TQ   K+KT L+ Q+ N KVSLS  K + +EE V++I +++Y+ 
Sbjct: 2721 VEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYML 2780

Query: 2833 HATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWA 2892
            +A+K+ GGTI+  P +LV MTTWQ+  S++IE L+T  F  +V VKWNLGPINFI+EMW+
Sbjct: 2781 YASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWS 2840

Query: 2893 THVRALALRRVHD---MRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKD 2949
            TH+++LA+R+      M +K+K    D   EE+IK      K  Y+PL+EP IEMPQIKD
Sbjct: 2841 THIKSLAVRQTQSNKTMSEKDKQ--ADLDPEEEIK-----AKLQYVPLDEPYIEMPQIKD 2893

Query: 2950 LGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLG 2995
            LGDATPP+EWFGV+R+R P  THQ  +V +QKL H AE+EYA+V G
Sbjct: 2894 LGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQG 2939

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score = 2078 bits (5384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1164/3028 (38%), Positives = 1745/3028 (57%), Gaps = 116/3028 (3%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            MD  ++F+AI +  E                       Y  RA+ Y +T ++ WV+W+RY
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            KV INIQSL  S +GG+V+FKN+++  +DQTIS L+G+FTWRYWLLN R           
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIN- 119

Query: 121  XXXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXXSLH- 179
               D+ S+   CRF LE DG ELFIYN+   Y+ IL  +A                    
Sbjct: 120  ---DENSK---CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGR 173

Query: 180  -SSEEKLEDETLAXXXXXXXXXXXXXRNFQEQDSRSMLLQFLPIHLKVNRGAVLLGNTTT 238
              ++  +  + L               +   Q +  + L FLP  + ++ GAV++GN  T
Sbjct: 174  VKTDSSVMFDPLDESSEQSKVGQTILNSVSNQSAVPLYLDFLPAEVILSSGAVVVGNKHT 233

Query: 239  PSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVH 298
            PSV II Y   EG++DV      LD YK+R + + ++  + +KPNISFG+ +  K + + 
Sbjct: 234  PSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKID 293

Query: 299  SRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSV 358
             +   +W+K K      +SH LA + N+K +    ++F   W+GLA+Y   +V TSD   
Sbjct: 294  GKPFNLWQKLKDCLLFTISHILAFTGNKKGL-TGQEEFLTSWKGLAMY---DVATSD--- 346

Query: 359  GXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDV 418
                      +  D+ NHEYAKYT IL + ++ + Y+YD PG++    +   E  D P  
Sbjct: 347  -----TFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETLIKGYENGDIP-- 399

Query: 419  GNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYT 478
                  PE+S+D +LY A   YGPWAHRQ+QY  +M  P VSRD    +K   G  R + 
Sbjct: 400  ----PSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHA 455

Query: 479  RFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGM 538
             F   +++MED++WRIPT+E SKD  FL +Y+ + ++ R FGW+DIKL K+T++ + +G+
Sbjct: 456  NFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGL 515

Query: 539  CPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSK 598
              +  GFEN    +LV P I +SVNHD+ F A A  I A   YP  WNS   W   F S 
Sbjct: 516  QASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISS 575

Query: 599  QVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINN 658
             +  F LRDH NLL D+F DF SG   PYELFRP +Y+F W I NYS+YLN NDANI+NN
Sbjct: 576  DLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNN 635

Query: 659  PLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFM 718
            PLDFNENCY+S+HG++ +I   + ++TI+  S T++Y I TP+F +QL TP W TLHEFM
Sbjct: 636  PLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEFM 695

Query: 719  KNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYF 778
              + VGRS++F  +GSY  ++DVD+ N+DTI +EC++ + T    GF++RY+MN+ +NYF
Sbjct: 696  AQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYF 755

Query: 779  GDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYD-LHEF 837
            G+F  F+TTEEY+ EL ++ +    ++  +N  D+++++       N    + +D LH  
Sbjct: 756  GEFAQFRTTEEYSEELAQRNDV-ATDIFNNNDDDQTTELVEP----NSYGESGFDILH-- 808

Query: 838  NEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNY 897
                K+ +A LKR  NEKD+W TF  EDGC V PE+ YD  SC GLHFD++  D+RYL+Y
Sbjct: 809  --GKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSY 866

Query: 898  YMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGLPIIEE 957
            Y DL  S++ TYIKR+ D +  ++FDV  +   +   + G+LSE NIH HRMFGLP  EE
Sbjct: 867  YADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEE 926

Query: 958  TYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVT 1017
            TY  K D  +G L  +SDI+  KG I   +K  FG+ ++E++L YE+ +  D++ L+   
Sbjct: 927  TYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFA 986

Query: 1018 DSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKNEVQ 1077
            D IS ++ + +TN  ++L +  +S  ++DF   +YS + +  IPN   LVS     N V 
Sbjct: 987  DDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNIVL 1046

Query: 1078 GLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAI 1137
            G   TS+  A F +N DF    NLQ  HI L D+P+ RC+FL P +YQ + LY  L+ +I
Sbjct: 1047 GTISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKLLYASI 1106

Query: 1138 TPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSSFIQGSGS 1197
             P  SIP L +P+ PN  D+IFE+LLG  YQDY      + S +T +      F + S +
Sbjct: 1107 PPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYISEGTFDISNDTKLQLNIDEFKKHSEN 1166

Query: 1198 TSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFCVGSXX 1257
            + +  +    ++N     ++   E  SF+  L    I I+    +    +Y Q    +  
Sbjct: 1167 SFSKHK----TKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTIS 1222

Query: 1258 XXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYV-EVNH 1316
                      V  FSK F   S+VT  +V+ P+I F     +  + + D  H +V ++N 
Sbjct: 1223 DTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYE-YYALEDVKHYFVSDINK 1281

Query: 1317 PSLDLCQKKIFG-QTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLL----KARPVF 1371
              L+L  ++ +  ++ +S++    +++   K +     IN + L  +  +     +   +
Sbjct: 1282 LDLNLRLRQEYDKESANSEMNSKNKLSVYYKTA----LINGKMLSKENFIYPSESSEFSY 1337

Query: 1372 SIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSK 1431
               F                 N +    F+N    + +S++++ + L       S + SK
Sbjct: 1338 KSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISK 1397

Query: 1432 TLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHIL 1491
               ++ ++EL+ R A A  +Y I HD PVITKPA ITRLS++H+RE+RSWRI+TRLRH+L
Sbjct: 1398 NFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVL 1457

Query: 1492 NYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSM 1551
            NYLP+ WY+ T   L+K +F+  +DA+ QFL IF+ WRSWEF+DV++C++YK+ ++   +
Sbjct: 1458 NYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYIPAEV 1517

Query: 1552 KKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAKNTEDS 1611
               +     F  +L  ISF+       D++ + + +    I N+   SS    +   + S
Sbjct: 1518 TFAKTIC--FSSDLLTISFN-----ERDKEHLFMNSFMIDIRNDCYVSSAVGESMAAK-S 1569

Query: 1612 ASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSVKHDVKPKLIQGVLL 1671
             +  K ++S +   I  D    I+KL ++   L            V  D   +     L 
Sbjct: 1570 NNVYKTVVSLDELQINVD-KKIILKLSKLIHTLK-FEYVYSNPIVVAKDANGRCKNISLQ 1627

Query: 1672 VDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVLL 1731
            +++  TN  L    L     R    + ++ + S + + +S+      ++ + R+ +  L 
Sbjct: 1628 LNKITTNCFLGNVSLGFIFERIYVYSLIDTLDSGNNSLLSVLLFFDVAKLFFRYKTRNLF 1687

Query: 1732 ESSLKDGALNFSQSLFHEHLITKVVLRSGGLSV-SAMASTEQYIHFIWSIKASVDGIRKE 1790
                 D  L+F+ +   +         +  +++ S++ S    I     I+  ++ I ++
Sbjct: 1688 SLDFTD--LHFNLTYLSKQKTYGFYHSAEFMNINSSIPSINDIIEANNEIRLHINEIGQD 1745

Query: 1791 LASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVE 1850
             AS I      T     P++        +   ++  ++ +Q L PF +  S    E++V+
Sbjct: 1746 FASNI----QYTELPVLPDSQVLKPIAMVKMNIAAINIQLQLLLPFILRYSCKEFEINVD 1801

Query: 1851 KHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLV---ISNTPEQNAMFLNVGVASG 1907
                L + ++++D  +ELLS   ++ Y+K+S S + L+   + NT     + L+    S 
Sbjct: 1802 FGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLGRISLD----SS 1857

Query: 1908 ISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWL-LHV 1966
             SKL++ +P++ +   + D   A+KN   L+S      +K+     +   + +I + L++
Sbjct: 1858 FSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTM--LETKSSTVQNEFPFSRLIPIQLNL 1915

Query: 1967 NVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHAN 2026
            NVEYIG+++  G+  YVLE NN+  S S + ++   +   +     D+S E++  LI   
Sbjct: 1916 NVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPV---VPTFSSDYSSESICFLIKDR 1972

Query: 2027 RLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSE 2086
            R+K  LSK++D ++ +KV +     +Q++QIESS+    L PMSL ++L  +NEF+ +  
Sbjct: 1973 RVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKS 2032

Query: 2087 AY---KTRSSLLQHKKTAPTDISELSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYE 2143
             Y   K RS+      ++ + +S L    +S  ILSYN CIGW+FD G   + GLIWGYE
Sbjct: 2033 IYHDIKPRST------SSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYE 2086

Query: 2144 RLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGD 2203
            RLFA Y KPYGKLTLLDAYFS+AHG SS T++ +G EK   NRSYLPSMQI YW  +E  
Sbjct: 2087 RLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENG 2146

Query: 2204 TSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEKPVNSEA 2263
            T +LF+R+ GE LDV+ L+    I + A +S+  F++LK+T++DP     T+  P+  E 
Sbjct: 2147 TKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKV--TSNDPILGEW 2204

Query: 2264 APLD-PILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDV 2322
              LD P+ S +R+ NCI+ YAG   KL+S +DIQ+ +  SFE+ SP+  V IDYK+ P  
Sbjct: 2205 NYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQHGT-CSFEIRSPAHTVTIDYKYYPSK 2263

Query: 2323 IKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSK-PKPDRNSTISSSGMN 2381
             KSHWIR L TV+ ++NTLFP CVP+L+ M      MLK+  S+      N   + + +N
Sbjct: 2264 KKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAEIN 2323

Query: 2382 YKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSID 2441
            Y+ LL AFDIA ++N+GKQ ISL+CEP AK+QA +GFEK  +K+FTN++   EPL LS+D
Sbjct: 2324 YRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVD 2383

Query: 2442 IEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDL 2501
            + +L A+SRH+FSRE+S+S  +  I  VF LTH E I TYG+TL+S    YFN+KQ++DL
Sbjct: 2384 LHNLMASSRHVFSREISSSLSLQQISMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDL 2443

Query: 2502 NLFLDIWKPDSQ-----ILEMPKGGNTRTRSLSSHDKLP-VSKFQKPAGTNAFPWNYTLI 2555
            NLFL+IW  + Q     I+  P          SS + +P + K Q+      F W+Y LI
Sbjct: 2444 NLFLEIWSIEKQKSVNDIILAPVTA-------SSFESVPSMPKLQRVPINATFSWDYLLI 2496

Query: 2556 FSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIE 2615
             S I  +IDLGPSLG++ V+++  W +S H +DW Q+L + ++ I +SS GRLGG++ I+
Sbjct: 2497 ISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIK 2556

Query: 2616 RVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDE 2675
             + W S+I+WP+   F+  PL+ LSL LG+   K SFDYHMF I+ +++  ++L+N++DE
Sbjct: 2557 DIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDE 2616

Query: 2676 MGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTK 2735
             G L DLL+VSV+   I +F+T+LA AN  DIY+TI RMR D+  + ++ L +SN     
Sbjct: 2617 RGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLL-ESNELKKI 2675

Query: 2736 SKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHT------QT 2789
            S   N  +L SL  LRT+LSV   L  L +F +TL   EV+VL+   + A+T      +T
Sbjct: 2676 SSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKT 2735

Query: 2790 QGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAIL 2849
              D KV+T L WQL +  +SLS+FK+Q +E  + +I+V +Y+K A+ + GG IL AP+I 
Sbjct: 2736 TSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIF 2795

Query: 2850 VDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDK 2909
            V M TWQ   SNVIELLY+SSFG  V + WNL PINFI++MW+ H+ A+ LR +      
Sbjct: 2796 VTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSS 2855

Query: 2910 NKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPG 2969
                 +DE IE K+  VDLG KY+Y PLEEP IEMP+IKDLGDATPPVEWFG+NR RFPG
Sbjct: 2856 EIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPG 2915

Query: 2970 LTHQSVVVPLQKLAHMAEEEYARVLGNV 2997
            LTHQ VVVPLQKL+ +AE+EY R+LG V
Sbjct: 2916 LTHQIVVVPLQKLSAVAEKEYVRILGKV 2943

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 2061 bits (5340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1166/3072 (37%), Positives = 1774/3072 (57%), Gaps = 155/3072 (5%)

Query: 2    DAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRYK 61
            D  SQF +I + K  +                     Y GRA+A+ I+ + +W+LW+RY+
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   VKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXXX 121
            +K+NI+SL++S LGGR+FFKNLT+I KD TISFL G  +WRYWL   R            
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 122  XXD---QKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXXSL 178
                  Q++  L CR  LE +G ELF+YNRTVAYD  ++  +                + 
Sbjct: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182

Query: 179  HSSEE----------KLEDE------TLAXXXXXXXXXXXXXRNFQEQDS-RSMLLQFLP 221
             +S E          K +DE      T +             R F ++++ +++ L +LP
Sbjct: 183  RASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLNYLP 242

Query: 222  IHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIK 281
            + +KV+  + ++GN  TPS++I+  +SAEGV+D CQ  EKLD+YK +  +D  NV + +K
Sbjct: 243  LQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSLK 302

Query: 282  PNISFGDENPIKSYIVHSRMSRVWKKF-KKIFFERMSHYLAHSDNQKIMFVKHQQFFEKW 340
             NI + +E  +K  +   ++S++W  F K   F R    L  S  +K        F +KW
Sbjct: 303  QNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKP--LGLSRKKKNRPSVTANFHQKW 360

Query: 341  RGLALYSEYNVTTSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPG 400
            RGL+LY  Y      + +         ++  D+  HEYAK+T I+K  +  +TY +DIPG
Sbjct: 361  RGLSLYKNYMFEDVQNDLD--------DIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPG 412

Query: 401  MVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVS 460
             VPHGA  T+   DGPD+GN+GAPP F L+ +L+G ++CYGPWA RQ+ ++Q +L P +S
Sbjct: 413  FVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQIS 472

Query: 461  RDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFG 520
            RD  P+K L PG RR+YT F L +++ ED  WRIPTRESSKD +FL+ Y+ +    RPFG
Sbjct: 473  RDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFG 532

Query: 521  WLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLG 580
            WLD+K +K++       +C T  G +N +  HL   EIRSSVNHDIF K+ +     +LG
Sbjct: 533  WLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLG 592

Query: 581  YPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWS 640
            +PLGWN +A+W     S Q+ TF LR+HI L++D   DF +G PTPYELFRPF+Y   W 
Sbjct: 593  FPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWK 652

Query: 641  IDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTP 700
            +D YSIYLNVND NI+NNPLDFNENCYLS HGD L +D +V    I   +T ++Y+I TP
Sbjct: 653  LDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTP 712

Query: 701  EFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTL 760
             F L L+ P W+TL+EFMK+KEVGR+YDF   G+Y  ++++DV N+D I I C SK T L
Sbjct: 713  MFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVL 772

Query: 761  QCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSST 820
             C GFVIRYLMNI MNYFGDF HF T+EEYT ++  K     +  + +  SD++S     
Sbjct: 773  HCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGS--LFEKYSDDAS----- 825

Query: 821  SFVTNDKETTEYDLHEFNEDPKVK----RADLKRKENEKDVWFTFCVEDGCLVFPENIYD 876
            +FV++  +  E       ED KVK     AD++RK NE D+W TF + +G L+ PE IY+
Sbjct: 826  TFVSDFDKNNE-------EDDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYN 878

Query: 877  CTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGL-VDGH 935
            C  CI LHF  L +D+R  NYYMDL ASL    ++++S+  P  IF+ VR C G  V GH
Sbjct: 879  CDPCIALHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGH 938

Query: 936  QGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKD 995
              ++S +NIH HRM+GLP  E TYFCKWDF +G++ ++S++DF KGL+ +F KIGFG+ D
Sbjct: 939  -SYISNINIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDD 997

Query: 996  YENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNK 1055
             EN+L+YE     DMT++T+        + +   +    L L+ +    IDFENE+YS +
Sbjct: 998  LENVLLYEKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTR 1057

Query: 1056 MSAKIPNIKLLV---SEKSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSP 1112
            M  +IP +KL +   + ++SK      FET ++   F   ++   HR LQR++IT++D+P
Sbjct: 1058 MDIRIPLLKLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAP 1117

Query: 1113 YHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYEC 1172
            +HRC F+LP  YQ +V+Y KL+G+I P  S+PPL  P++  T + I +  L ++    +C
Sbjct: 1118 FHRCGFILPASYQNSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDC 1177

Query: 1173 CS-DANYSKETAITEENSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGK 1231
               +  Y   T +   NS        T+      +  +  P     P+ E D+++I+   
Sbjct: 1178 IILNLPYPDSTNL---NSDSFNSYPDTAPHTLSDTIIRKSPL----PEDERDNYVIDFRY 1230

Query: 1232 TIIAINPSSEKCLLSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKI 1291
              I+I+P     +  +   F                V++ S +    S++ N ++   +I
Sbjct: 1231 ISISIDPELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKI---RI 1287

Query: 1292 CF--TFGSPKGKFEVSDY-DHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKAS 1348
             F   F   +    +  Y D L  E+N  S++  ++K              EVT+ +K +
Sbjct: 1288 LFFDVFWGQRDTGGIELYLDTLDFEMNEKSIEKNREKSL-----------TEVTTLMKLN 1336

Query: 1349 SINFFINQQQLKPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEW 1408
            SI   +N +  + KT  +  P  S++                 +   ++D  ++ +Q+ W
Sbjct: 1337 SIRASVNAKYSRGKTEGQP-PALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVW 1395

Query: 1409 LSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYIT 1468
            L ++          +  +F K + L    +KELI R  +AS  Y I HD  VITKPA+IT
Sbjct: 1396 LFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFIT 1455

Query: 1469 RLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNW 1528
            RLS+ H+RENRSW+IITRLRHI+ YLP  W +   + LK+ ++    DA+  F+ +FS+W
Sbjct: 1456 RLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSW 1515

Query: 1529 RSWEFSDVQKCYIYKRVFLS-RSMKKNRITGADFKVNLERISFSL-SSSTHEDEDFMVVK 1586
            R+WEFSDV + YIY +VFL+ ++ K+ +     +K     +  ++ ++    D  F+V K
Sbjct: 1516 RNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTK 1575

Query: 1587 NLKSVISNELIESSLPPSAKNTEDSASTEKMI-ISCNIKSIRGDLGDNIVKLVRMYDGLS 1645
                  SN + E     +   TE   + EK+I ++ N+ SI+G + D + KL  + + + 
Sbjct: 1576 ------SNLVFEE----TPDTTESGYNQEKVINVTGNLGSIKGKISDKMFKLHNLMNLVQ 1625

Query: 1646 NLSDTNLKT-TSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPS 1704
               D  LK+ +S     K  +    LL D +D  + + G+  +  +  +  ++F+   P 
Sbjct: 1626 QQEDPALKSISSFSRSFKLNI---ALLFDSSDL-LFVFGETSLTNTIHSGKASFLWENP- 1680

Query: 1705 KSETK--VSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGL 1762
            K  TK   SL       E  ++H +++L E+ +   AL+ +      H       +   +
Sbjct: 1681 KGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAAADSIISHPSIVANFQCDDI 1740

Query: 1763 SVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNT---VTL 1819
            ++  M  TE  + F+    A  + +++   +    K   T  + KP T +++N    V L
Sbjct: 1741 NLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKP-TPTKINPFLLVDL 1799

Query: 1820 DAT--LSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRY 1877
            D T   S  SL+I P+ PF   Q T  +E         N    I D D+ L S  +KQ+Y
Sbjct: 1800 DFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQY 1859

Query: 1878 LKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQL 1937
             + S   + +  +N    N +  N+ V++ I KLT S+P   ++S ++DE    ++  +L
Sbjct: 1860 FRLSLGNIIVGYTNGRLVNTIH-NLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKL 1918

Query: 1938 KSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNI 1997
            + L   F S+  E +       I W L+ +++Y+GI++ + +  +V E++ +L SL++  
Sbjct: 1919 QVLGNLFSSE-PEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMHTLLASLADVD 1977

Query: 1998 SARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQI 2057
                Y E       G  S++N+L LI    +   LS+++DL+  +   Q+  +   + QI
Sbjct: 1978 YGEIYREADEAS--GQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQI 2035

Query: 2058 ESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSS-----------LLQHKKTAPTDIS 2106
            ES H R    P SL ++LW  ++   +   Y+   S               +    +  S
Sbjct: 2036 ESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPKKEKKVEEDKTTSFFS 2095

Query: 2107 ELSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIA 2166
             L+  F S  ILSYNFC+GW+F    +TD GLI GY RLF+AY+K  GKLTL+DA+FS++
Sbjct: 2096 TLT--FGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVS 2153

Query: 2167 HGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIG 2226
            +G +SDTF+S+G E+D++NRS+LP++QI YW     +  ++F+R+ GE LDVNFLSS + 
Sbjct: 2154 NGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVK 2213

Query: 2227 IANGAVKSIQTFQELKKTMVDPFA--------------------TNKTTEKPVNSEAAPL 2266
            I    ++SIQ FQELKK +V+P                      T    EK  ++    +
Sbjct: 2214 IIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKKEDAPRKDI 2273

Query: 2267 DPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSH 2326
             P LS IR  NC  KY GG+FK++S EDI++N  PSFE+ SP V + +DYK+    +K H
Sbjct: 2274 APFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPH 2333

Query: 2327 WIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNSTIS--SSGMNYKK 2384
             IR L+TV+ ++N LF  C P+L  +++D+++M+K  +SK KP+    +S  S  ++YK+
Sbjct: 2334 LIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPKQRVSRPSQNIDYKR 2393

Query: 2385 LLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEH 2444
            LL +FDI F +   +Q +SLSCEPKAKVQA+VGF+     + TN+LD SEPLS ++ +++
Sbjct: 2394 LLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKN 2453

Query: 2445 LRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLF 2504
             R+  RHIFSRE S SF +D ID  F+ THP II  +G  L+SDV++YFN+KQLQ+L LF
Sbjct: 2454 TRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLF 2513

Query: 2505 LDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDID 2564
            LDIWK  +  L  PK          + D  P S        N  PW +TLIF+NI G +D
Sbjct: 2514 LDIWKLSN--LLRPKPMKKPEDHHVAIDAPPSSPMDV---GNIIPWCFTLIFANINGKVD 2568

Query: 2565 LGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEIS 2624
            LGPSLG+LS+   ++W  SDH+   RQ L  +++ I L++ GRL G + ++   W++E++
Sbjct: 2569 LGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVN 2628

Query: 2625 WPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLA 2684
            WP     Y  PL++LS  + +++LK +FDYHMFLI  V + +  L++ERD  G + DLL 
Sbjct: 2629 WPKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLK 2686

Query: 2685 VSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVL 2744
            V +TC +I +  TAL +AN +D+YNTI+RMRQD   SY+ETL++SNT  TK     +++L
Sbjct: 2687 VMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKDIL 2746

Query: 2745 ESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLH 2804
            + L+L++TD+ V I+   +Q+ P +LFD+EVLV+   ++ A+ +T    K++T L+ QL+
Sbjct: 2747 KVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLY 2806

Query: 2805 NFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIE 2864
            N   SLS+ K + +E++VS+I V++Y+ +A+K+ GGTI   P + + M T+Q+ +S+++E
Sbjct: 2807 NAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILE 2866

Query: 2865 LLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIK 2924
              Y S+FG K+ V+WNLGP+NFI+EMW TH++ALA+RR   +        E+  +E++++
Sbjct: 2867 YGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGD--EEGDVEKRMR 2924

Query: 2925 DVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAH 2984
            D +  +K  YI +EEP+I+ PQIKDLGDATP +EWFG+NR++FP  THQ+V+VP+QKL H
Sbjct: 2925 DEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIH 2984

Query: 2985 MAEEEYARVLGN 2996
             AE+EYA ++G+
Sbjct: 2985 SAEKEYANIVGH 2996

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2037 bits (5277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1164/3095 (37%), Positives = 1741/3095 (56%), Gaps = 195/3095 (6%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            MD  S F+ + + +  N                     Y GR   + +T +++WV+W+R 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            KVKINI+SL+I+ LGG + F+NL +I +D TIS L+G+  WRYWL NSR           
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 121  XX--------XDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXX 172
                           R   CRF L  +G E+F+YN+T +Y+ I+   +            
Sbjct: 121  EERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180

Query: 173  XXXXSLHSSEEKLEDETLAXXXXXXXXXXXXXRN-------------------------- 206
                +   +E + E++ L+              N                          
Sbjct: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNN 240

Query: 207  ------FQEQDS--RSMLLQFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQS 258
                  F++Q S  +SM ++FLPI +   R +++LGN  TPS++++  ++++G++D+C  
Sbjct: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300

Query: 259  NEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSH 318
             EKLDL+KI+ + +  +VD  +K NI F D+          R+S++W+KF +IF      
Sbjct: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFL----- 355

Query: 319  YLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSVGXXXXXXXXNMMSDVGNHEY 378
             L     + +   +   F E W+GL+LY + N+   +            N+  D  NHEY
Sbjct: 356  -LPTLGPKHLQTQEDITFRENWKGLSLYRQ-NMEEDE----------LENVDFDFANHEY 403

Query: 379  AKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATI 438
            A+   ILKS K+  TY YDIPG+VP     T++   GP+VGNSGAPPEF +D +LYGA I
Sbjct: 404  ARVISILKSAKIVFTYEYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANI 460

Query: 439  CYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRE 498
            CYGPWA RQ+ YL+ +L P+VSR   P+K LTPGS+RIYT F  S+ +ME++ WRIPTRE
Sbjct: 461  CYGPWAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTRE 520

Query: 499  SSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEI 558
             SKDQ+FL+ Y E+K + RPFGW+D+K  K++   +   +CPT  G  N + FH    EI
Sbjct: 521  KSKDQEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEI 580

Query: 559  RSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMD 618
            R+SVNH++  +A +    AD+GYPLGWN +A W    +S Q+  F LR+HI L+SD+F D
Sbjct: 581  RTSVNHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFAD 640

Query: 619  FGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKID 678
            F SG PTPYELFRPF+YR  W++D YSIYLNVND NI+NNPLDFNENCYLSLHGD L  D
Sbjct: 641  FSSGDPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFD 700

Query: 679  FSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFH 738
              +  +T+    T + Y I TP F L L+TP W+TL+EFMKNKEVGRSY+F +NG Y   
Sbjct: 701  VKIPRQTVANRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVF 760

Query: 739  SDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKL 798
            S++D+ N+DTI +EC S  TTL C GFV+RYLMN+ MNYFGDF HF T EEYT       
Sbjct: 761  SELDIDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTN------ 814

Query: 799  ETREAEVIADNVSDESS--QMSSTSFVTNDKETTEYDLHEFNED-PKVKRADLKRKENEK 855
                 E   +N+ DE S   +SST  V  D+   E      N+  P  KR++LKR ENE 
Sbjct: 815  ANHTEEPKNENLGDEHSGFNISSTEDVETDRTNPEG--RPANKGIPMPKRSELKRTENEM 872

Query: 856  DVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSD 915
            D+WF F V +G L+ PE IY+   CI LHF+ L+VDLR  NYYMDL A+++ T +KR+  
Sbjct: 873  DIWFVFSVWEGALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVS 932

Query: 916  FNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSD 975
             +P ++F+ VR   G  +   G+LS L IH HRM+GLP  E TYFC+W   I  L+I+SD
Sbjct: 933  RHPHDLFECVRKDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSD 992

Query: 976  IDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVAL 1035
            ++FAKG +  FSKIGFG+K+ EN+L+YE     DMTS+T+    + F + D +T+    L
Sbjct: 993  LEFAKGFLTCFSKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVL 1052

Query: 1036 DLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKNEVQGLF----ETSLDLAYFGQ 1091
               KI+ + IDFENE YS ++  K P+I  L+ E   +N+ +G F    +T L+   F Q
Sbjct: 1053 HAKKITFTAIDFENEAYSQRVDFKFPDINFLIFEL-DENQKEGRFLLHLKTQLNFTDFIQ 1111

Query: 1092 NRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVI 1151
            N+ F +HR  QR +ITLHDS Y+RC+FLLP  +Q++VLY +L G+I+P  ++PPL  PV+
Sbjct: 1112 NQAFADHRYRQREYITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVL 1171

Query: 1152 PNTIDSIFESLLGKHYQDYECCSDANY----SKETAITEENSSFIQGSGSTSALKELSSY 1207
              TID I E  LG++    +    ++      + T +T E++ F   SG          +
Sbjct: 1172 AETIDYIIEDCLGEYAPTVKPDDSSSSDTSEGQRTPLTNEDTRFQANSG---------FF 1222

Query: 1208 SQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFCVGSXXXXXXXXXXXX 1267
            S + P      +  Y+++++++    + + PS    LL+   +F                
Sbjct: 1223 SPHMPHNPPNNRDRYNNYVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAI 1282

Query: 1268 VEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIF 1327
            V+K        S VT  R+    + F +   +G         + + +N    DL +K I 
Sbjct: 1283 VKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGS-------GVELALNSFDFDLRRKTIE 1335

Query: 1328 GQTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLLKARPVFSIVFXXXXXXXXXXXX 1387
             +     LE T  + S++    I+      +  P ++        +              
Sbjct: 1336 NEDEKVILEKT--MFSNIHTLRISLL----EAHPSSISMKPAALQLSIEDLELWSSTVDE 1389

Query: 1388 XXXXLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTAL 1447
                +N  +  F ++ SQLE +S YL   I        S  + + L +  QK+LI     
Sbjct: 1390 NVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQKDLICDLTS 1449

Query: 1448 ASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESL- 1506
            AS  Y I HD  VITKPA+I RLS+ H+RENRSWRIITRLRHIL YLP  W  RT + L 
Sbjct: 1450 ASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDW--RTADHLV 1507

Query: 1507 ---KKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSR---SMKKNRITGAD 1560
                 E   +P    D F+ +FSNWR+W+ SD+ + YIYK++FL +   S KK   T   
Sbjct: 1508 TVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTV-- 1565

Query: 1561 FKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAK-NTEDSASTEKMI- 1618
             K+N +   F++  S +E      V          +I   LPPS   ++E+    EK+I 
Sbjct: 1566 LKINFQSFFFTVLISGYE------VARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVIT 1619

Query: 1619 ISCNIKSIRGDLGDNIVKLVRMY--------DGLSNLSDTNL-----------------K 1653
            ++ N+ +I+G+ G+ + KL  ++        D LSNL   +                  +
Sbjct: 1620 LTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSR 1679

Query: 1654 TTSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLA 1713
             +      +   I   ++ +R D +  +   RL  R    + S  +E   SK  T  +L+
Sbjct: 1680 ASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLEN--SKENTPPALS 1737

Query: 1714 AT--CASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLS--VSAMAS 1769
            A       E W++H + VL E  LK   +  +  L    +I  V L     +  + AM S
Sbjct: 1738 AVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL---GVIPFVSLNCQATNSFIRAMPS 1794

Query: 1770 TEQYIHFIWSIKASVDGIRKELASAIPK------KNNTTISTTKPETSSRLNTVTLDATL 1823
            T         ++ SV+ I++++   IP+      KN++ ++   P    + +   +    
Sbjct: 1795 TV-------VLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIKFD---IRFNF 1844

Query: 1824 SGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQS 1883
            +  S  I  L+PF + Q    + ++   H  +   +   + D+ L S  S +++ KFS +
Sbjct: 1845 TDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSST 1904

Query: 1884 TVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAE- 1942
             +        ++    + V +++ + KLT+ +PR  +++L++DE   +++   ++ L   
Sbjct: 1905 DLQFKCE-VADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNF 1963

Query: 1943 -KFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARK 2001
             +  S   ++S  R   N  W L  N++Y G++V + S  Y+ EL+++  SL+N  +  +
Sbjct: 1964 LRSASGGNDRSPSR---NTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTN--ANEQ 2018

Query: 2002 YLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSH 2061
            Y E   H   G   +E+  LL+    L   LSK++D ++    SQ+  + LQ+ QIESS+
Sbjct: 2019 YEEYDRH-FSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSY 2077

Query: 2062 FRVALCPMSLTKVLWAINEFTRVSEAYKT-RSSLLQHKKTAPTDISELSNKFRSIQILSY 2120
            FR+ L P  L  +LW+++    +   +K   +  L +         E +  FRSI ILSY
Sbjct: 2078 FRLCLFPELLVDILWSVHYLQSLLNHFKKHHTPWLPYSSNKTAKSGESTLDFRSIHILSY 2137

Query: 2121 NFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKE 2180
            NFC+GW+F+ G  ++PGLI GY+RLF+AY+K +GKLTL+D Y S+A+G +SDTF+S   E
Sbjct: 2138 NFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSE 2197

Query: 2181 KDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQE 2240
            KD + R+YL +MQI YW   E    +LFVR  GE +DV FLS+S  +    + SI+ F E
Sbjct: 2198 KDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNE 2257

Query: 2241 LKKTMVDPFATNKTTEKPVNSEAAP--LDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNN 2298
            +KK  +    T  +T+  +N EAA   L P L+ IR  N  + +AGGVFK++S  ++ + 
Sbjct: 2258 MKKAKIK--QTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSK 2315

Query: 2299 SKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRN 2358
            ++P  E++SP V++AI+Y+      KSH IR   T++P++N LF  C P+LS    +++N
Sbjct: 2316 AEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKN 2375

Query: 2359 MLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGF 2418
            M+++ +S+ K   +  ++ S ++YK LL  +DIAF +  GKQ +S SCEPKAKVQ D GF
Sbjct: 2376 MIRNLSSEDKSHPSKPVTDS-IDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGF 2434

Query: 2419 EKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEII 2478
                 ++ T+ +D+ EP ++S  ++ + ++ RHIFSR+ S +F +D+ID V + T+P + 
Sbjct: 2435 NSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNV- 2493

Query: 2479 QTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSK 2538
              YG  LVSD+ IY NMKQ Q+LN+FLDIW+  ++    P       +S +     P   
Sbjct: 2494 --YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKSLSPPFS 2551

Query: 2539 FQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLE 2598
                     FPW++T+IF+N+ G +DLGPSLGVL++   + W  + H  D ++    F  
Sbjct: 2552 PSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAH 2611

Query: 2599 NILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFL 2658
             I ++S+GRL G   +++    SEISWP +      PLIS+S+ +  +++K++FDYHMFL
Sbjct: 2612 GITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFL 2671

Query: 2659 IANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDN 2718
            I +++ + + L+NE D   IL DLL VS+    I L  TAL +ANA+DIYNTI+RM+QDN
Sbjct: 2672 IGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIMRMQQDN 2731

Query: 2719 KNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVL 2778
            + SYIETLK+SN  ++ +    + VL SL+LLRTD+SV +    + + P +LFD EVLV+
Sbjct: 2732 RISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVV 2791

Query: 2779 KAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVR 2838
               D++A ++TQ   K+KT L  Q+ +   SLS+ K + +EE VS+I V +Y+ +A+K  
Sbjct: 2792 SVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLYASKFS 2851

Query: 2839 GGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRAL 2898
            GGTI+  P +LV MTTWQ+ SS V+E L+T  F  K+ +KWNLGP+NFI+EMWATHVR+L
Sbjct: 2852 GGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSL 2911

Query: 2899 ALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVE 2958
            A+RR         S  E E   E  K+  + +K++Y+PL+EP IEMPQIKDLGDATPP+E
Sbjct: 2912 AVRRTQ----LGNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLE 2967

Query: 2959 WFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARV 2993
            WFGV+R+  P  THQ+ V+ +QKL H AE+EYA++
Sbjct: 2968 WFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 1975 bits (5116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1124/3063 (36%), Positives = 1706/3063 (55%), Gaps = 136/3063 (4%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            M+  SQF +I + +E                       Y  R      T ++ W +W++Y
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            KVKINI+S+++SFLGG VF KN+++I +D T+SFL+    WRYWLLNSR           
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 121  XXXDQ-----------KSRMLQCRFFLESDGFELFIYNRTVAYDGILR--------SVAX 161
                Q           K+  L C   +E  GFE+F+YNR  AY+ +LR          + 
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 162  XXXXXXXXXXXXXXXSLHSSEEKLEDETLAXXXXXXXXXXXXXRNFQEQDSRSMLLQFLP 221
                           +++S ++   +                     + + +S+L  FLP
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFLP 240

Query: 222  IHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIK 281
            I L++  GAV LGN  TPS+++  YE+  GV+DV  +NEK+DLYK +  + F +V++ +K
Sbjct: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300

Query: 282  PNISFGDENPIKSYIVHSRMSRVWKKFKKIF------FERMSHYLAHSDNQKIMFVKHQQ 335
            PN+++  E   +  I   ++SR+W  F  I       F ++ H         +       
Sbjct: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDV----ESM 356

Query: 336  FFEKWRGLALYSEYNVTTSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYA 395
            F  KWRGL+LY +       + +             D  N EYAK++ ILK     ++Y 
Sbjct: 357  FVNKWRGLSLYKDNLRDAGRYGLDEASY--------DFLNREYAKFSSILKCPNFTLSYY 408

Query: 396  YDIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRML 455
             D PG+VPHGA  T  ++DGPD+GNSG+PPEF +D ++  A+I YGPW +RQ+ YL RML
Sbjct: 409  LDSPGIVPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRML 468

Query: 456  CPIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNK 515
             P+VS++ IP+KKL PGSRRI+T F +SV +++++ WRIPTRE SKD++F+KQ+ ++ + 
Sbjct: 469  SPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDD 528

Query: 516  ERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTI 575
             RPFGWLD  L K T       + PTI G  N    H +  E+ +SVNHDI  K+    +
Sbjct: 529  FRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDV 588

Query: 576  SADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVY 635
             AD+GYPLGWNS+A W F   +KQ+ TF L++HI+L SD+F DF S  PTPYELFRPF Y
Sbjct: 589  VADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTY 648

Query: 636  RFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNY 695
               W I+ YSIYLNVND NI+NNPLDFNENCYLSLHGD L ID  +    I+   T + +
Sbjct: 649  SLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAF 708

Query: 696  SIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQS 755
            +I TP F L L+TP W+TL EFMK+KEVGR++DF + GSY  +SD+D+ N+DTI +EC S
Sbjct: 709  NIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTS 768

Query: 756  KYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESS 815
            + TTL C G VIRYLMN+  NYFGDF+HF T+EEY+  LQ+  +    E  +   S  SS
Sbjct: 769  RSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFTYSTTSS 828

Query: 816  QMSSTSFVTNDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIY 875
              +S+S      +T  Y   +    P V+RAD+ R ENE D+WFTF V DG L+ PE +Y
Sbjct: 829  VQNSSS-----DDTVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLY 883

Query: 876  DCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGH 935
            +   C  L F  L +  R  NYYMD   +L    I R  +F+P  IF  VR  +  ++  
Sbjct: 884  NGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIV 943

Query: 936  QGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKD 995
             G LS++ IHAHRMFGLP  + TYFC+W    GSL IDS+I+F     G F+K+GFGY +
Sbjct: 944  HGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSN 1003

Query: 996  YENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNK 1055
             EN L+Y++    DMT LTL  + +   V+D  +    +L++ K+  + IDF+NERYS +
Sbjct: 1004 LENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKR 1063

Query: 1056 MSAKIP--NIKLLVSEKSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPY 1113
            ++ KIP  +I +      +   +   F+T +D   F    DF N  N QR +ITLHDSPY
Sbjct: 1064 INLKIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPY 1123

Query: 1114 HRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECC 1173
            HRC F+LP  YQ++ LYN+L+G ITP  SIP L  P++PNTID + E  L K Y D    
Sbjct: 1124 HRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFL-KEYSD--LL 1180

Query: 1174 SDANYSKETAITEENSSFIQGSGSTSALKELSSY---SQNCPSYKLEPKFEYDSFIINLG 1230
             +   +  +    + SS        + + E + +    +N  +Y  +PK+EYD++I+N+ 
Sbjct: 1181 ENPFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNY--DPKYEYDNYILNVE 1238

Query: 1231 KTIIAINPSSEKCLLSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPK 1290
               + INP     + S+  +    +            V +           TNL++    
Sbjct: 1239 YIRVDINPLFSDFIDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISY 1298

Query: 1291 ICFTFGSPKGKFEVSDYDHLYVEVNHPSLDL-CQKKIFGQTNSSKLEYTEEVTSSLKASS 1349
            +   +GS   +          +E+    LD   +++IF   N   LE    + S LK+  
Sbjct: 1299 VDIFWGSRNSE---------GIEIYLDKLDFEMRQRIFDDFNQRSLE-ERTILSKLKSLR 1348

Query: 1350 INFFINQQQLKPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWL 1409
             +F   Q +   +   +  P  S+                  +N  + D  V+ SQ  WL
Sbjct: 1349 CSFSETQYE---EIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWL 1405

Query: 1410 SDYLRAVILCATKLFASFSKSKTLIQAR----QKELIFRTALASVEYNIIHDSPVITKPA 1465
              YL   +    + F +   S  L+Q R    QK LI +   AS  Y I HD  VITKPA
Sbjct: 1406 IKYLNKQV----EFFYNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPA 1461

Query: 1466 YITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIF 1525
             I RLS +H+RENRSWRI+TRLRHILNYLP+ W K +   ++        D ++ FL +F
Sbjct: 1462 LIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVF 1521

Query: 1526 SNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVV 1585
            SNWR+WE SDV + YIY+RVFL   ++KN I     K+ +E   F++ S  +  +  +VV
Sbjct: 1522 SNWRNWEVSDVARSYIYRRVFLP-DIEKNLINNTT-KIGMESFYFTIYSQRYAVDHNIVV 1579

Query: 1586 KNLKSVISNELIESSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLS 1645
              +  +I   L +     +  N  D        I+  + + +G+LGD +++L ++Y    
Sbjct: 1580 TRINVIIDQMLSDEEPKAATANKNDKIYD----ITGTVGTFKGELGDQLIRLKKLY---- 1631

Query: 1646 NLSDTNLKTTSVKHD--VKPKL--IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMER 1701
              S+   K  S K      PK   I  VL+V++ +  +     +LI R    + S F E 
Sbjct: 1632 --SEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTLAAANTKLISRIKNGKISGFFEN 1689

Query: 1702 VPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGG 1761
                +    S+      +E W++H   +LL++ L D  ++    L  +     V ++S  
Sbjct: 1690 ARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFISVIAELLVKKPTILVNVKSSH 1749

Query: 1762 LSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDA 1821
            L   A+ +T+  + F+   +  +  I   L     KK +T   +T P  S++   ++ D 
Sbjct: 1750 LRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHT---STSPIFSTKKIDISFDI 1806

Query: 1822 TLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFS 1881
             +   S  I  L+PF +  S   +++   +    +   +I D D+ L S ++  +Y + S
Sbjct: 1807 NIFDISSEIVILSPFTVKHSMKELKIVFNREGDNDTIFSILDADLYLTSYQNGVQYFRLS 1866

Query: 1882 QSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLA 1941
               +NL    T  ++ + + + + + + KLT++DP++   SL++DE    ++   +K+L 
Sbjct: 1867 YQDINLEAMLTDSKSKL-ITINIVTSLIKLTLADPKKITNSLLQDEKTFEQSLESIKTLN 1925

Query: 1942 EKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARK 2001
              F S N+E           ++++ ++ Y G++  + ++ ++LEL+++L + SN     +
Sbjct: 1926 TLF-SSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFILELHSLLATFSNVYMNPQ 1984

Query: 2002 YLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSH 2061
             L++    I  + +++N L +I +  +  ++SK++D +VNL    +  +  ++ ++ESSH
Sbjct: 1985 QLKE---KITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEVESSH 2041

Query: 2062 FRVALCPMSLTKVLWAINEFTRVSEAYK--TRSSLLQHKKTAPTDISELSNK---FRSIQ 2116
            FRV L P SL K+L  + + +   + YK  TR  + + KK A      L        SI 
Sbjct: 2042 FRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGAPLIEYSIH 2101

Query: 2117 ILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFS 2176
             LSYNFCIGWIF+    + PGLI GY+RLF+AY+  YGKLT++D +FSIA+G SSDTF+S
Sbjct: 2102 FLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYS 2161

Query: 2177 NGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQ 2236
             G EK+++NRSYLP++QI YW  +      LFVR  GE +DV FLS+   I N  ++S+Q
Sbjct: 2162 QGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESVQ 2221

Query: 2237 TFQELKKTMVDPFATNKTTEKPVNSE--AAPLDPILSKIRAFNCIVKYAGGVFKLFSEED 2294
             FQ +KK  V     N   EK V  +  +       SK++  NC   Y GGVF ++    
Sbjct: 2222 HFQMIKKETVR--EMNVEAEKKVGEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRG 2279

Query: 2295 IQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTK 2354
               +++ + E+ +P V + +DYK+  D+ K HWIR  + ++P+ NTL       L+   +
Sbjct: 2280 NHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGE 2339

Query: 2355 DVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQA 2414
             V  M+  F+ K +P    T+S   ++YK++L  FD++F ++ GKQ +SLSCEP AKV A
Sbjct: 2340 SVHEMVAKFSPKEQPPAPKTVSPP-IDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHA 2398

Query: 2415 DVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTH 2474
            +VGFE     + TN+ D +EPLS S+ +  ++ +  H FS E + SF +D +D   + TH
Sbjct: 2399 NVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTH 2458

Query: 2475 PEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKL 2534
            P+I   YGTTL+SDV +YFN+KQLQ+L +FLDIW     I   P+    ++  +   +  
Sbjct: 2459 PDI---YGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQ----KSVPVKKPESR 2511

Query: 2535 PVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLS 2594
              S  +  + T   PW++T+I ++I GDI LGPSLG LS++  ++W  ++HF D R+ L 
Sbjct: 2512 VSSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGNLSLKLKKNWISTNHFQDRRKALR 2571

Query: 2595 VFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDY 2654
             F +++ L+S GRLGG + +  + W   + +       ++PL+ ++L + ++A+K +FDY
Sbjct: 2572 FFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDY 2631

Query: 2655 HMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRM 2714
            HMFLI  V ++L  L +E+D +G L DLL + + C +I +  TAL ++N +DI NTI R 
Sbjct: 2632 HMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRT 2691

Query: 2715 RQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDME 2774
            RQD++NSYIETL +SN    KS     ++L+SL+LLRTD+ + I    +Q+ P +LFD+E
Sbjct: 2692 RQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVE 2751

Query: 2775 VLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHA 2834
            V+V   E++SA + TQ   K+ T L  +++   +SLS    + +EE VS+I V +Y+ +A
Sbjct: 2752 VIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYA 2811

Query: 2835 TKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATH 2894
             K+ GG IL+ P + V MTTWQ  +S +IE L+   F  K+ V+WNLGP+NFI+E+WATH
Sbjct: 2812 MKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATH 2871

Query: 2895 VRALALRRVHDMRDKNKSFF--------------EDEHIEEKIKDVDLGN-------KYV 2933
            V++LA+RR     DK                   E E +  +  + D  N       K++
Sbjct: 2872 VKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVSSEELEMLRSESSNADNDNNEYSEEDKFI 2931

Query: 2934 YIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARV 2993
            Y+PL+EP+IEMP+IKDL DATPP+EWFGVNR++FP +THQ+ ++ +QK+ H+A++EYA+V
Sbjct: 2932 YVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKV 2991

Query: 2994 LGN 2996
            LG+
Sbjct: 2992 LGD 2994

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 1710 bits (4428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1031/3018 (34%), Positives = 1603/3018 (53%), Gaps = 202/3018 (6%)

Query: 39   YFGRALAYCITILMKWVLWRRYKVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGS 98
            Y GR L Y ++     VLW++Y+V ++IQSL  S L G+V FKN++V ++DQ IS L+G+
Sbjct: 8    YVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLKGT 67

Query: 99   FTWRYWLLNSRXXXXXXXXXXXXXXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRS 158
             TWRYWL+                 D   R   CRF L+ +GFE F+YNR   YD I R 
Sbjct: 68   ITWRYWLIGR--------YRRSGTADGARR---CRFALKFEGFEYFVYNRNGVYDRIARE 116

Query: 159  VAXXXXXXXXXXXXXXXXSLHSSEEKLEDETLAXXXXXXXXXXXXXRNFQEQDSRSMLLQ 218
            +                 S+ S EE +                       E     ++ +
Sbjct: 117  L------DGEDTSAEPTVSVPSVEEVI----------------------AELQDDPLIRR 148

Query: 219  FLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDL 278
            FLP+    N+GA++LGN  T SV I+ YE   G V +   ++       R +   +N  +
Sbjct: 149  FLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKISNCTV 208

Query: 279  KIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQ--QF 336
             IKPNIS+  +NP+K Y+   R +R+WKK+K +    +   L H+  +K    +HQ  ++
Sbjct: 209  AIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATL-HAKRKK---EQHQTPKW 264

Query: 337  FEKWRGLALYSEYNVTTSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAY 396
            ++ WRGL++Y        D  V             D+ +HEYAK T +LK+ ++ VTY+Y
Sbjct: 265  YDNWRGLSMYDVNLDEELDEEVKF-----------DIEHHEYAKCTTVLKADQMDVTYSY 313

Query: 397  DIPGMVPHGALHTMEQRDGPDVGNSGAP-PEF--SLDFKLYGATICYGPWAHRQIQYLQR 453
             +PG        T    D  +  N     PE   S+D  +Y A   YGPWA+RQ+Q   R
Sbjct: 314  GMPG--------TARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLR 365

Query: 454  MLCPIVSRDAIPLKKLTPGSRRIYTR---FNLSVLMMEDALWRIPTRESSKDQDFLKQYR 510
            +  P V R+    K  TP      T    F LSV +MED++ R+P +ESSKD  FL++Y+
Sbjct: 366  VFSPTVCRN---FKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYK 422

Query: 511  ESKNKERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKA 570
            +++++ RPFGW+DI++ KE+++ + +   PT  GFEN L  +LV   I +SVNHD   KA
Sbjct: 423  QTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKA 482

Query: 571  DAQTISADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELF 630
             +  I+ D  YP GW  +A+W F   S Q   F LRDH+ L+SD+  DF  G    YE F
Sbjct: 483  KSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQF 542

Query: 631  RPFVYRFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNS 690
            RPF YRF W I  YS YLNVNDANIINNP+DF ENCYLS+HGD  +I FS+ + +I    
Sbjct: 543  RPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKY 602

Query: 691  TTVNYSIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTIL 750
             TV+++I TP F L L+ P W T  E +  KE+GRS +F + GSY  +S+VDV N+D + 
Sbjct: 603  VTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALN 662

Query: 751  IECQSKYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNV 810
            I C++ Y  + C G +++ ++N+ +NYFG+ +HF+TTEEY  ELQ +   ++        
Sbjct: 663  IACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRR--NKQNPSTCRPF 720

Query: 811  SDESSQMSSTSFVTNDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVF 870
            + + +   S    T   E  +     F   P +K++ LKR  NE DVWFTF  + GC  F
Sbjct: 721  NSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFF 780

Query: 871  PENIYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEG 930
            PENIY   +C+G +FD+L+  LR+LNYY+D   SL   Y KRH+D + R +F V+     
Sbjct: 781  PENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGI 840

Query: 931  LVDGHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIG 990
             +D    +LS+ +   H+M G+   EE+Y C++D ++ +LD+  D+   K  +     + 
Sbjct: 841  PIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLA 900

Query: 991  FGYKDYENMLIYEIIKPIDMTSLTLVTDSISFKV--TDGNTNCVVALDLDKISASMIDFE 1048
            FG+KD EN L YE  +  D+  ++ V ++++ K+   D + +  ++L+L   + +  D  
Sbjct: 901  FGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLA 960

Query: 1049 NERYSNKMSAKIPNIKLLVSEKSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITL 1108
            NERYS +    IP +   +    S++   G F T + +  F +   F   R LQR HI +
Sbjct: 961  NERYSRRSDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILV 1020

Query: 1109 HDSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQ 1168
            +D+P+HRC+F+LP +Y+K  +Y  L+G I P  S+P   +P+  +  + IFE LLG+ YQ
Sbjct: 1021 NDAPFHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEIYQ 1080

Query: 1169 DYECCSDANYSKETAITEE----NSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDS 1224
            +Y   S    + ++  + E    N +     G++S+L   S   Q   S          S
Sbjct: 1081 EYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLS----------S 1130

Query: 1225 FIINLGKTIIAINPSSEKCLLSIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNL 1284
            FI+        ++ S+ + +L IY      S            + +F + F E + ++ +
Sbjct: 1131 FIVEFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEV 1190

Query: 1285 RVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSS 1344
            RVL P I  +  + + KF +       +     +LD+  +     ++ +     E+ T  
Sbjct: 1191 RVLCPNISLSATNKQSKFSM-----FKLSSKIKNLDITSR--IKSSDPNLKPDPEKTTLC 1243

Query: 1345 LKASSINFFINQQQL--KPKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVN 1402
             K   I   I Q  +   PK   +   +FS                    N ++    ++
Sbjct: 1244 YKIDYIRANIVQDGIVVPPK---QPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLS 1300

Query: 1403 HSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVIT 1462
                + L ++L   I     L    S  +  + A ++E +        +Y I HD PVIT
Sbjct: 1301 PGTDKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVIT 1360

Query: 1463 KPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFL 1522
            KPA ITR S  HIR   SWRII RLRHILNYLP+ W++     L  ++F  P++A  +FL
Sbjct: 1361 KPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFL 1420

Query: 1523 KIFSNWRSWEFSDVQKCYIYKRVFLS-RSMKKNRITGADFKVNLERISFSLSSSTHEDED 1581
             IFS+WRSWE +DVQ  +++++VF   RS     + G  F  +  R++    +       
Sbjct: 1421 SIFSDWRSWEPTDVQGSFVHEKVFTKKRSRPFAALQGFTFSSDDIRLNMKDDARVP---- 1476

Query: 1582 FMVVKNLKSVISNELIESSLPPSAKN--TEDSASTEKMIISCNIKSIRGDLGDNIVKLVR 1639
             + VK +   I N    + L P   +  TE S      I  C    +   +  + VK ++
Sbjct: 1477 -ITVKGVTLGIRN----NGLAPEQVDGRTEGSMPDPDYISFCTTDEVVMRVDRSFVKTLK 1531

Query: 1640 MYDGLSNLSDTNLKTTSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFM 1699
             +  L +         + KHD             +      L G  + LR   +  S  M
Sbjct: 1532 EFRDLIHRFKIGGPVGTAKHDNVSLFSNITFQFGKLYVVAKLAG--VYLRICLDNLSALM 1589

Query: 1700 ERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLIT------ 1753
                S  E+KV      +SS     H  A+L   S +   ++        H +       
Sbjct: 1590 LTSQSSVESKV-----ISSSTLSFDHMQAILGYRSFRFMTIDIDMFSVLLHYLPGQGCYS 1644

Query: 1754 ------KVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTK 1807
                  K  + S   +   +  +  Y+     IK  V+ +  EL +  P +        +
Sbjct: 1645 IDWKARKFHIDSSSATTKDLTESLPYVRD--EIKYLVEALVPELFAEPPIE--------R 1694

Query: 1808 PETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIE 1867
              + ++++ V     ++  +L +Q L+PF I    ++ E+  E    +  D+   +  +E
Sbjct: 1695 ESSGNKIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYME 1754

Query: 1868 LLSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVED- 1926
            + S + K  Y K++ + + L  S T     +F ++    GI KL+V D +  I  L++D 
Sbjct: 1755 ISSAKQKLDYFKYTHTCLKL--SGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDI 1812

Query: 1927 --ETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWL------LHVNVEYIGIIVLLG 1978
                 ++K+ + + ++++  P+ +   S         W       L +   Y G+++  G
Sbjct: 1813 KAALFSMKSLSDILNISQSSPTASAFGS---------WFSILPDNLSLQATYAGLLLGFG 1863

Query: 1979 SAGYVLELNN-----VLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELS 2033
               Y+LE NN         L + I+ R   +        D SIE+   LI   R+   L+
Sbjct: 1864 HTLYILEFNNFEAKHTRDGLPDAITPRPCFKV-------DHSIESASFLIKDRRIDDRLA 1916

Query: 2034 KLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSS 2093
            K+VD AVN  +  +    +Q++QIES+H ++ L PM++ ++L  INEF  + + +   S 
Sbjct: 1917 KVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESI 1976

Query: 2094 LL---QHKKTAPTDISELSN---KFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFA 2147
                  H  +  T+  E S      +S  ILS++F I W+FD  + +  GLI GY+RLF+
Sbjct: 1977 YTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFS 2036

Query: 2148 AYQKPYGKLTLLDAYFSIAHGASSDT-FFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSN 2206
             Y+KPYGKLTLL+AYFS A   +S+  F+S+   K + N SYL  MQ+ YWF ++ + ++
Sbjct: 2037 VYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTD 2096

Query: 2207 LFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATNK----TTEKPVNSE 2262
            LF+RI G +L V+  +  + +    ++SIQTF  LKK +VDPF T K     +++P N  
Sbjct: 2097 LFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKEPYNWN 2156

Query: 2263 AAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDV 2322
                + + + +R+ NCI+ YAG   KL S  D + ++ P  E+ SPS +VAIDYK+ P++
Sbjct: 2157 ----NQLATGVRSLNCIINYAGVTLKLHSH-DGRGDASP-LELTSPSYKVAIDYKYFPNL 2210

Query: 2323 IKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNST---ISSSG 2379
             K+H  R L+T  P++NT + T   ++  +      +LK+ +++ K    ST   I   G
Sbjct: 2211 EKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEG 2270

Query: 2380 MNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLS 2439
             +   LL + D+  ++N+GKQ ++ SCEPKAKVQA VGFEK  +K+F NN+++ E L L+
Sbjct: 2271 SDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLA 2330

Query: 2440 IDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQ 2499
            I+IE+L   SRHI+SREV  S ++ HI  VF +   ++ + YG+TL+S    YFNMKQLQ
Sbjct: 2331 IEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQ 2390

Query: 2500 DLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNI 2559
            DL LF+D W P  Q   M  G       +    +   SKF K + +++F W Y++I +  
Sbjct: 2391 DLKLFIDQWFP--QKTPMNTGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGS 2448

Query: 2560 KGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCW 2619
              +I+LGPSLGVL+V +   WAIS   VDW Q+L + +  + ++S GRLGG   +     
Sbjct: 2449 CAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHL 2508

Query: 2620 SSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGIL 2679
            S E+ WP    F++ PL+ + L   ++  K SFDYH F I++++     L+NERDE G L
Sbjct: 2509 SLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSL 2568

Query: 2680 KDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQ 2739
             DLL+V+V+   +++FLTALA+AN  DI N+I R+++DN+ SY+ +   S+ Q +    +
Sbjct: 2569 ADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASD-QPSDEPEE 2627

Query: 2740 NQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRL 2799
            +  + ++LSLLRT LS+ + +F LQ+ P++LFD +VL+L A  M A+T  Q D K+KT L
Sbjct: 2628 DGGIFDTLSLLRTQLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDL 2687

Query: 2800 NWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVS 2859
            +WQL +  ++L  F N  +E  ++ +EV +YI+ ++ ++GG I +AP+I+V+MTTWQE  
Sbjct: 2688 HWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQ 2747

Query: 2860 SNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRR--VHDMRDKNKSFFEDE 2917
            SNVIELLY++SFGG V ++WNLGPI+FI++MW  H+ A+ LR    H + +   +     
Sbjct: 2748 SNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLN 2807

Query: 2918 HIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVV 2977
                 + ++ LG+ Y Y+PL+EP IEMP+IKDLGDATPP+EWFGVNR +FPG THQ V+V
Sbjct: 2808 SKAVPL-EMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIV 2866

Query: 2978 PLQKLAHMAEEEYARVLG 2995
            PLQKLA  AE+EY ++LG
Sbjct: 2867 PLQKLARTAEKEYEKILG 2884

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 1690 bits (4377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 975/2824 (34%), Positives = 1559/2824 (55%), Gaps = 123/2824 (4%)

Query: 213  RSMLLQFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLD 272
            R + L  LP+ + +N+GA+ +GN  T S+++I +  A G++D    + KLD++K +   +
Sbjct: 301  RKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFE 360

Query: 273  FNNVDLKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVK 332
             N++D+ IK NI +  E   +       ++R+W  + ++    +      +  + + + +
Sbjct: 361  INDIDMSIKRNIGYNPELASRFNFRAGVLTRIWS-YLQLVLNLIPTGRLKTWYESLRYKE 419

Query: 333  HQQFFEKWRGLALYSEYNVTTSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILKSTKVAV 392
               F +KW GL LY +        SV         ++  D  NHEYAK +   K+ ++  
Sbjct: 420  DTTFVKKWDGLVLYKD--------SVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIF 471

Query: 393  TYAYDIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQ 452
            +   DIPG+VPHG+   + +  GPD+GN  +PP F +D +L  A+I +G W +R I  L+
Sbjct: 472  SIESDIPGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLR 531

Query: 453  RMLCPIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRES 512
             ++ P++S+D  PL KL PG  R+++ FN SV +++D+  R+PTRE SKD DFLKQY E+
Sbjct: 532  DLMFPVISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLET 591

Query: 513  KNKERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADA 572
            K+  R FGW+D+   K ++  + + M PT  GFEN L     + E+ +SVNH++ FK+++
Sbjct: 592  KDDFRAFGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNS 651

Query: 573  QTISADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRP 632
              I+A++GYPLGWN    W+F  NSKQ+  F LR+HI LLSD+ +DF +  PTPYELFR 
Sbjct: 652  LNIAANIGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRS 711

Query: 633  FVYRFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTT 692
            F Y     I  YS Y NVND NIINNPLDFNENCYLS HGD    + ++ + ++     T
Sbjct: 712  FTYNLNLKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVT 771

Query: 693  VNYSIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIE 752
            ++Y I TP F L L+TPSW+TL EFM+NKE+GRS+DF ++G+Y  +S++D+ N+D++ I+
Sbjct: 772  ISYEIFTPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTID 831

Query: 753  CQSKYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSD 812
             +S  T L C GFVI+Y+MN   NYFG FI F TTEEY            +E+I +NV+D
Sbjct: 832  FESNSTVLYCFGFVIKYMMNFQANYFGSFIKFITTEEY------------SELIRNNVND 879

Query: 813  ESSQMSSTSFVT----NDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCL 868
                +++    +       ++   D+ + N+   +KR+DL R ENE D+W  F V DG L
Sbjct: 880  NLGSINTNDLTSIEGLQKMDSITNDVEDINQ-KTIKRSDLLRTENETDIWLNFKVNDGAL 938

Query: 869  VFPENIYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRAC 928
            + PE +Y+  SC+ L F  L +++R  NYYMD+  +L    + R    +P  +F+ ++  
Sbjct: 939  ILPEELYNGDSCVSLSFGELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQT- 997

Query: 929  EGLVDGHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSK 988
                   +G +S++ IH HRM+GLP  E TYFC+W   IG+  IDSD+ F    I + +K
Sbjct: 998  RNRSSSVEGNISDITIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNK 1057

Query: 989  IGFGYKDYENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFE 1048
            IGF   + EN L+YE     DMT L++  +S+   ++D        +    I    IDFE
Sbjct: 1058 IGFFLSNKENSLLYESDTVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFE 1117

Query: 1049 NERYSNKMSAKIPNIKLLVSE---KSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNH 1105
            NE+Y+ ++          +      S K  +  +  T L++  F +  +  NH + QR  
Sbjct: 1118 NEKYTKRLDVNASEFYFSLDSLKIDSGKKNILDV-RTKLNITNFFKTDNHINHLDTQRKF 1176

Query: 1106 ITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGK 1165
            I LHDSPYHRC FLLP ++Q++  Y +L+G+ITP  S+P L  P I +T + I E +L  
Sbjct: 1177 IGLHDSPYHRCFFLLPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGIL-- 1234

Query: 1166 HYQDYECCSDANYSKETAITEENSSFIQGSGSTSALKELSSYSQNCPSYK----LEPKFE 1221
               DY     +++  + +I  E       S  T+ LK+  S+     +++     E  +E
Sbjct: 1235 --DDYSEFLLSDHHNQMSINAE-----LNSVDTTPLKD--SFDMQITNFQNILTTEDPYE 1285

Query: 1222 YDSFIINLGKTIIAINPSSEKCLLSIYLQFCVG-SXXXXXXXXXXXXVEKFSKYFVEKSA 1280
             D+F++N+    + +NP     +     +F    S            V + S      S+
Sbjct: 1286 TDNFVVNVKYLTVTVNPDIVFTIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISS 1345

Query: 1281 VTNLRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEE 1340
              N+ +   KI   +G     F +  Y      +N    +L Q+  +   N+  L+  ++
Sbjct: 1346 KINVNLNVEKIDAAWGHRDVCF-IGTY------INMLKFELSQESTYN--NNGGLQ--KD 1394

Query: 1341 VTSSLKASSINFFINQQQLKPKTLLKARPV-FSIVFXXXXXXXXXXXXXXXXLNARAVDF 1399
            +T   K  S+   I  Q     +    RP   S++                 LN  + D 
Sbjct: 1395 LTLLGKFRSVRIII--QNHSYNSFSDDRPPGLSLMLEGFEAWSSTTTKQLTTLNLTSFDI 1452

Query: 1400 FVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSP 1459
             V+  Q+ WL  Y+++ IL  TK+  S         + QK  I     A  +Y I HD  
Sbjct: 1453 TVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPY 1512

Query: 1460 VITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARD 1519
            VITKPA + RLS  HIRENRSWRI+T+LRHIL YLP+ W  R +E    +   +  +A  
Sbjct: 1513 VITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPEDWEDRLDEEDLIKRSGLEKEAAS 1572

Query: 1520 QFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGADFKVNLERISFSLSSSTHE- 1578
             FL +FSNWR+WE SD++K YIY+ +F+    K  RI     KV LE   F++ S  +  
Sbjct: 1573 TFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSK--RILQNSIKVFLETFYFTIYSRNYSA 1630

Query: 1579 DEDFMVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLV 1638
            D++F++ K    +I+NE  + +     +  E     E + +   I SI+ +  + I+KL 
Sbjct: 1631 DQNFLITK-ANILINNEADQVNEVDLIRKQE-----EIVDVVTKIGSIKFEFTEAILKLK 1684

Query: 1639 RMYDGLSNLSDTNLKTTSVKHDVKPKL-IQGVLLVDRTDTNIHLDGKRLILRSFRNRFST 1697
            R  + +   S  + K+   K  +     +    + D  D N       L  R       +
Sbjct: 1685 RDIEQIIKTS-VDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSLKSRMSNVNILS 1743

Query: 1698 FMERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVL 1757
            + E     S    S       +   ++H + +L++  +++   + +  L        +  
Sbjct: 1744 YFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLMINF 1803

Query: 1758 RSGGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTT----------K 1807
            R   L   ++  TE +++ I +I+  V+ +  E++ A    +N     T          K
Sbjct: 1804 RCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNKMQK 1863

Query: 1808 PETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNAD---ITIRDI 1864
             + +S+ N +TL AT +  S  I  L P  +   T+S+ +    ++ +N D   + + D 
Sbjct: 1864 AKPNSK-NNITLSATFTNVSSEITLLHPIYLKHETNSVNI---SYNTINIDELLVQVLDT 1919

Query: 1865 DIELLSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLV 1924
            D+ L S+ +K++Y + S   + L  +  P+ N   +++ ++S I KLT SDPR  ++S +
Sbjct: 1920 DLYLNSSHTKEQYARLSYDKLELT-TFLPDLNEKLIDLEISSSILKLTTSDPRRMLFSFL 1978

Query: 1925 EDETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVL 1984
            +DE     +   L+SL E    K   +  +   ++  W+++   +Y+G+++ + +  YV 
Sbjct: 1979 QDEKELKNSLTFLRSL-ESLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQATYYVF 2037

Query: 1985 ELNNVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKV 2044
            EL++ L+++SN       + +  HG   D S ++++ LI    +  + SK++D ++ L  
Sbjct: 2038 ELHDALSTVSNKEEPSSAVHKKFHG---DLSFDHIIFLIKDQSIPHKFSKILDFSIKLST 2094

Query: 2045 SQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSSL----LQHKKT 2100
             +   +  ++ +IESS FRV L P SL + +W   +   +  +Y  +S++          
Sbjct: 2095 HRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQSTVNFFVFNDNNI 2154

Query: 2101 APTDISELSNKF--RSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTL 2158
                 SE  N F  RS  ILSYNF IGW++     T PGLI GY RLF+ Y+  +GKLTL
Sbjct: 2155 DGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTL 2214

Query: 2159 LDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDV 2218
            +D +FS+A+G+S DTF+S+G E  +FNRSYLP++QI YW  +     +LF++  GE LDV
Sbjct: 2215 VDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDV 2274

Query: 2219 NFLSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEKPVNSEAAPLD---PILSKIRA 2275
            NF  + + I    V+SI  FQ LK+  ++P    K  E+   S +A  +   PI  K++ 
Sbjct: 2275 NFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKP-ERDEKSNSALTNIKGPIFGKLKQ 2333

Query: 2276 FNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVD 2335
             NC   Y GG+F+LFS   + N  +P+  ++SP V++ + Y +    +K HWI  L+ ++
Sbjct: 2334 VNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIE 2393

Query: 2336 PSNNTLFPTCVPILSGMTKDVRNM--LKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAF 2393
            P+ N L   CVP LS     ++++  L+  N +   D N       +N   LL  FDI F
Sbjct: 2394 PTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNV---KDPINITSLLENFDICF 2450

Query: 2394 LVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIF 2453
             +  G Q ++L CEPKAK+  DVGF      + T +L+  +PL +S+ I  ++ + +H F
Sbjct: 2451 KLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQF 2510

Query: 2454 SREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQ 2513
            S E S SF++  +D + + THPE+   +GT LV DV+++FN+KQ Q++++FLDIW     
Sbjct: 2511 SNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKS 2567

Query: 2514 ILE--MPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGV 2571
              +    K  NT   + SS    P++  Q    ++  PW++  I +NI GDI++G +LG 
Sbjct: 2568 TEKKLFKKDSNTLVDAKSS----PIA--QTIVNSSTLPWSFVFIATNINGDINMGSTLGN 2621

Query: 2572 LSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGF 2631
            L++   R+W  +DHF + RQ L +F +N+ +SS+GRLGGF+ I+ + W  ++++  K  F
Sbjct: 2622 LALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKF 2681

Query: 2632 YETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGK 2691
              +PL+ L  ++G +++K +FDYHMFLI+ V+ L   + +E+D   IL DLL V++TC +
Sbjct: 2682 VVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDE 2741

Query: 2692 IHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLR 2751
            I +  TAL ++N +DIYNTI+R RQDNKNSYIETL +SN    K K   +++L+SL+LL+
Sbjct: 2742 IKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQ 2801

Query: 2752 TDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLS 2811
            T LS  I    LQ+ PS+L+D EV++++ +D+ + T+T+   K+KT L  +++N  +SL+
Sbjct: 2802 TSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLT 2861

Query: 2812 AFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSF 2871
            +F  +  EE ++++  + YI +A+ +  G I   P + ++MTT+Q   + +++  Y+ SF
Sbjct: 2862 SFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSF 2921

Query: 2872 GGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNK 2931
             GKVDV WNLGPINFI+E+WATHVR+L +R V  M + + S   +   +E +K   + + 
Sbjct: 2922 DGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENEGDTDESVK---VLSN 2978

Query: 2932 YVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYA 2991
              YI LEEP IEMPQIKDL DATPP+EWFG+NR+ FP  THQSV+VP+QKL ++A++EYA
Sbjct: 2979 IEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYA 3038

Query: 2992 RVLG 2995
            +VLG
Sbjct: 3039 KVLG 3042

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 60/106 (56%)

Query: 4   GSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRYKVK 63
           G++F  + +S+E                       Y  +   + +T   +W+LW+   +K
Sbjct: 5   GTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIK 64

Query: 64  INIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSR 109
           + I+S+++SFL G +FFKN+ +I +D+TIS L+ S TWRYWLLN+R
Sbjct: 65  VTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTR 110

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 1689 bits (4375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 974/2616 (37%), Positives = 1487/2616 (56%), Gaps = 99/2616 (3%)

Query: 420  NSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYTR 479
            N  APPE +++F+L+ A+I YGPWAHR I  +QR+  PIVSR         PG  R YT 
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 480  FNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGMC 539
              +SV +MED+ WR+PTRE SKDQDFLK+Y ++ +  R FGW D+  ++ ++    +   
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 540  PTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSKQ 599
            P + G+ NKL       E+RSSVNHDIFF++ +  + +D+GYPLGWN E  W F F+S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 600  VHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINNP 659
            + TFFLR+H+ L++D F DF SG PTPYE FRP +Y+ +W+   YS YLNVND NIINNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 660  LDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFMK 719
            LDFNENCY+S+HGD   I   +    IT   T + + I TP F L L+TP W+TL+EFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 720  NKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYFG 779
            NKE+GR YDF   GSY  +SD+D+ N+D++ IEC ++  TL   GFVI YL+N+ MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 780  DFIHFKTTEEYTRELQEKLETREAEVIAD-NVSDESSQMSSTSFVT-NDKETTEYDLHEF 837
            +F HF T EEYT ++    +      +AD +V  E++ +S+ S    N   +++ ++ + 
Sbjct: 950  EFSHFITAEEYT-DIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDP 1008

Query: 838  NEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNY 897
              +P +++ D+KRK NE D+WFTF V +G L+ PE +Y+   CI L F  L +D R  +Y
Sbjct: 1009 LYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDY 1068

Query: 898  YMDLQASLSPTYIKRHSDFNPRNIFDVVR--ACEGLVDGHQGFLSELNIHAHRMFGLPII 955
            Y+DL A+L+ T  KR    N  +IF++V   A + L +   G +S ++IH HRM+G P  
Sbjct: 1069 YLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEE--HGSVSNISIHGHRMYGAPPT 1126

Query: 956  EETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTL 1015
              +YF  W   + +L I+SDI F +G I   +K+GF + + +N+L+Y+     +MTS+T+
Sbjct: 1127 SPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTV 1186

Query: 1016 VTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKNE 1075
                I   V D +T+  V L++D I+ + I+F N+RYS+++  ++P +     +  S  +
Sbjct: 1187 HGTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMD 1246

Query: 1076 VQGLFE--TSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKL 1133
               LFE  T ++   F Q +D + H   Q+  I L+DS +HRC+FLL    Q+++LY++L
Sbjct: 1247 KTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHEL 1306

Query: 1134 FGAITPGVSIPPLTQPVIPNTIDSIFESLLGKH-YQDYECCSDANYSKETAITEENSSFI 1192
            +G ITP  S+PPL  PV   TI  I +  LG       E     + S  T I   N    
Sbjct: 1307 YGGITPSSSVPPLPIPVQAETIAFIIDDFLGPFGINSTELL--GSISTSTPIHSSNKPLK 1364

Query: 1193 QGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFC 1252
              S S     E S  S   PS  +     + ++II++    + INP       +   +F 
Sbjct: 1365 PPSSSVIHPIE-SMQSHLVPSQSVT----HGNYIIDISYITLDINPLFFTYASNFLDEFY 1419

Query: 1253 VGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYV 1312
              +            V +      E  +VTN+++    + F FG         + + L +
Sbjct: 1420 SENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQ-------RNTEGLEL 1472

Query: 1313 EVNHPSLDLCQKKIFGQTNSSKLEYTEEVTS--SLKASSINFFINQQQLKPKTLLKARPV 1370
             V+   L++ QK  F + ++  L+    ++   SL+AS     IN++++  +   +  P 
Sbjct: 1473 YVDQIDLEVSQKT-FQKKSTVVLDEIAILSRFLSLRAS-----INEKKVL-EDFDERPPA 1525

Query: 1371 FSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKS 1430
             S+                  LN  + D  V+ SQ+EWL DYL  +++   +L  S    
Sbjct: 1526 LSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSI 1585

Query: 1431 KTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHI 1490
            +      QK+L+    LAS  Y I HD  VITKPAY+ R+SK H+R+NRSWRI+TRLRHI
Sbjct: 1586 QKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHI 1645

Query: 1491 LNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSR- 1549
              YLP  W    +E ++ ++     D+ D FL +FSNWR+WE SDV + YIYK++FLS  
Sbjct: 1646 YTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSND 1705

Query: 1550 ---SMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAK 1606
               S KK + T    K+NL  I F++ S+ +  +  +++   K+VI  EL          
Sbjct: 1706 ETTSEKKLQTT---VKLNLNSIFFTIYSTGYAIDHNIILT--KAVILLEL--------TT 1752

Query: 1607 NTEDSASTEKMIISC--NIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKT--TSVKHDVK 1662
             T  S   EK I++   ++ SI+G+  D  ++L+ +    S   D    T  +S+  +  
Sbjct: 1753 ETAVSPPIEKSILNMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKS 1812

Query: 1663 PKL-IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASSEA 1721
            P   I   LL +     + +    L       + S  +E+     E   S A     SE 
Sbjct: 1813 PYFTIHLFLLFENGGLQLTMGDTTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEM 1872

Query: 1722 WVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVL---RSGGLSVSAMASTEQYIHFIW 1778
             ++H   ++ E  L    L  S  ++    I  V+L   RS  L   ++ASTE+ +  I 
Sbjct: 1873 CLKHNKDIIAEFQLHHLGL-ISTGIYTP--ICPVILINLRSADLHFKSLASTEKIVKTIE 1929

Query: 1779 SIKASVDGIRKELASAIPKKNNTTISTTKP----ETSSRLN-TVTLDATLSGFSLNIQPL 1833
             I         E +  + K  +    TTKP    +   ++N  V +   LS  S  +  +
Sbjct: 1930 DIT--------EYSVHLYKHYDLRKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLI 1981

Query: 1834 TPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTP 1893
            +PF +   T  ++++  ++      +++ D DI + S  +K++Y +FS   + +  +   
Sbjct: 1982 SPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMS 2041

Query: 1894 EQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSK 1953
            E+N + + V +++ + KLT S+PR    S ++DE + I++F +LK L + F S  +   K
Sbjct: 2042 EKNKVLV-VSLSASLVKLTFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKK 2100

Query: 1954 -----QRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLH 2008
                  ++ T   W L +N+ Y GI++ + S  +VLEL+ +L SL+N       +++  +
Sbjct: 2101 LNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTNTTEE---IQEVNN 2157

Query: 2009 GIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCP 2068
             I G  S+EN+L LI+   L   LSKLVD ++ +   Q+     +++QIESSHFR+   P
Sbjct: 2158 QISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSP 2217

Query: 2069 MSLTKVLWAINEFTRVSEAYKTRSS-----LLQHKKTAPTDISELS-NKFRSIQILSYNF 2122
             SL  VLW + +     E YK   +     L  HK    +  SE   N FRSI ILSYNF
Sbjct: 2218 ESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHKTGTKSSTSESPLNYFRSIHILSYNF 2277

Query: 2123 CIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKD 2182
            CIGW+     +  PG ++GY+RLF+AY+K YGKLTL++ Y S+ +  SS+ FFS G+EK+
Sbjct: 2278 CIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKN 2337

Query: 2183 QFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELK 2242
            + NRS+LPSMQI YW  +     +LF+R+ G+ LDV+ LS+ + I     KS Q F++ +
Sbjct: 2338 RHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFR 2397

Query: 2243 KTMVDPFATNKTTEKPVNSEAAP--LDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSK 2300
            K+ +      +   + + SE A   +   LS I + NC  KY GG  ++FS +D++ +S 
Sbjct: 2398 KSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDST 2457

Query: 2301 PSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNML 2360
            PS E+ +P V + ++YKH  D  K HW+R ++ +  S+N L+  C P +    + ++ +L
Sbjct: 2458 PSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEIL 2517

Query: 2361 KSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEK 2420
            ++   +PK    S I++    YK++L  FDIAF +   KQ +S SCEP AKVQA+VG + 
Sbjct: 2518 ENRPVEPKQSV-SKIATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDS 2576

Query: 2421 LAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQT 2480
                + T      +PLSL++ I  +  + +HIFS+E S SF ++ ID  F+ T P +   
Sbjct: 2577 FLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPTL--- 2633

Query: 2481 YGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQ 2540
            Y   L+SD+ I+FNMKQ Q+L LFLDIW     I   P     + +    H ++P    +
Sbjct: 2634 YCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNRKKRKHKKHKGHTQIP----E 2689

Query: 2541 KPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENI 2600
             P      PWN+ +IF+N+  DI LGP+LG++S +  ++W ISD ++D RQ L +F + +
Sbjct: 2690 TPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGM 2749

Query: 2601 LLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIA 2660
            +L S GRL G L I    W  E+++      Y +P++++ +++G +ALKT+FDYHMF+I+
Sbjct: 2750 VLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMIS 2809

Query: 2661 NVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKN 2720
             V ++  +L++ERD  G L DLL  ++ C +I +  T L ++N +DIYNTIIR RQD KN
Sbjct: 2810 KVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISICSTTLVASNILDIYNTIIRTRQDTKN 2869

Query: 2721 SYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKA 2780
            SY ETL +SN Q T++     ++L+SL+LLRTD+ + +    LQ+ P +LFD EVLV+  
Sbjct: 2870 SYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINI 2929

Query: 2781 EDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGG 2840
            ++MSA ++T    K+KTRL  Q+ N  V+LS  K + +EE V++I V +Y+ +A+K++GG
Sbjct: 2930 DNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGG 2989

Query: 2841 TILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALAL 2900
            TIL  P +LV MTTWQ+V+SN IE  +T  F GKV V+WNLGP+NFI+EMWATHV++LA+
Sbjct: 2990 TILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAV 3049

Query: 2901 RRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWF 2960
            R+         S  E E   E I       K+ Y+ L EP IEMPQIKDL DATPP+EWF
Sbjct: 3050 RQARIEEPVEYSSEELESSPESIYLEPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWF 3109

Query: 2961 GVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996
            G+NR++FP  THQ+ V+ +QKL H  E+EYA+++G+
Sbjct: 3110 GLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGH 3145

 Score =  136 bits (342), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 116/198 (58%), Gaps = 19/198 (9%)

Query: 217 LQFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVC-QSNEKLDLYKIRYDLDFNN 275
           L F P  LK+ +G+++ GN  TPS++II Y+SAEG+VDV   +N ++DLYK++  LDF N
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 276 VDLKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIF------FERMSHYLAHSDNQKIM 329
            ++++KPNIS+ D++  K++   S +SR+W KF  +F        R  H+     N   +
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 330 ---FVKHQQFFEKWRGLALYSEYNVTTSDHSVGXXXXXXXXNMMSDVGNHEYAKYTQILK 386
                + + F +KW+GL+LY +  +   +            ++  D  NHEYA+Y  I+K
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGN---------PEEHIEFDFLNHEYARYCSIVK 468

Query: 387 STKVAVTYAYDIPGMVPH 404
           + ++  T  YDIPG+VP+
Sbjct: 469 APRLIFTNEYDIPGIVPY 486

 Score =  110 bits (276), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 76/128 (59%), Gaps = 6/128 (4%)

Query: 39  YFGRALAYCITILMKWVLWRRYKVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGS 98
           Y  R  AY +T ++ W+LWR YKVKI+ +S+++S L  R+ FKNL +IT++ TIS L+G 
Sbjct: 39  YIDRVFAYSLTFILDWLLWRPYKVKIHCESIRLSLLSARISFKNLCIITENSTISILEGK 98

Query: 99  FTWRYWLLNSRXXXXXXXXXXXXX------XDQKSRMLQCRFFLESDGFELFIYNRTVAY 152
             W+YWLLN+R                      K+  L C+F  + +G E+F+YN+T AY
Sbjct: 99  IIWQYWLLNTRVSAYELHQQQKEHGYITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAY 158

Query: 153 DGILRSVA 160
           + I+ S +
Sbjct: 159 ENIIDSFS 166

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/1111 (42%), Positives = 685/1111 (61%), Gaps = 36/1111 (3%)

Query: 1896 NAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQR 1955
            N +  ++G+ + I KLT+SD R +I  L +     +   ++L  + +   + N+  + + 
Sbjct: 1834 NTLLTDIGLDTDIVKLTLSDNRVYIEELTDSLNGTV---SELIKIFKNKNADNEPAAPKF 1890

Query: 1956 KQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFS 2015
            K  +      +N  YIG++  L +  YVLE N    S ++   A +      +       
Sbjct: 1891 KPCS----FKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLV 1946

Query: 2016 IENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVL 2075
            I+NV +L+    +   LSK+ D+   LK+   E D  + +QIE+ H RV L P +L  V+
Sbjct: 1947 IQNVCILVLNPEVLPTLSKIFDIGFALKLI--EDDIKKTLQIETPHSRVMLAPSTLIAVI 2004

Query: 2076 WAINEFTRVSEAYKTRSSLLQHKKTAPTDISELSNKFR--SIQILSYNFCIGWIFDAGSE 2133
            + I E     +  K +      K  + ++  E+   F   S+ ILS   C+GWIF+  ++
Sbjct: 2005 FFIQEAKVSLQKVKQKG-----KFNSSSNAIEIPPYFETLSVNILSNKLCLGWIFEEDTD 2059

Query: 2134 TDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFF-SNGKEKDQFNRSYLPSM 2192
             + G++ GYE LFAAY+KPYGKLT++D Y + A G  S+ FF +NG    + NRS+L SM
Sbjct: 2060 EN-GIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGVP--ELNRSHLSSM 2116

Query: 2193 QIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATN 2252
            QI +WF  +    +LFVR+  ++LDV  L++S+ I N    SI++FQ+ K   +     +
Sbjct: 2117 QINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQK-KLAKISNIKKS 2175

Query: 2253 KTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDI-QNNSKPSFEVESPSVE 2311
              +   V    +    ILS IR+ NCI KY GG+  L++ +DI Q++ K S E+ SPS+E
Sbjct: 2176 SISTHNVAENLSDKVSILS-IRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIE 2234

Query: 2312 VAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKP-- 2369
            V++DY H     K HWIR LV V+ ++N LF +CVP+L  +T +++  ++ FNS+ K   
Sbjct: 2235 VSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLV 2294

Query: 2370 ----DRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKM 2425
                ++ +       +YK L +  D A ++N+G Q I+L+CEP+AK+QAD+GF    + M
Sbjct: 2295 HKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISM 2354

Query: 2426 FTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTL 2485
            FT++ D+SEPLSLS+    +  ++RHIFSRE+S+S  I+ +   F+LTH   I+TYG TL
Sbjct: 2355 FTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTL 2414

Query: 2486 VSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGT 2545
            +SD++ Y NMKQLQ++ LFLDIW P ++  +    G    +         +++F  P   
Sbjct: 2415 ISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQ---ALTEFTTPK-- 2469

Query: 2546 NAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSD 2605
               PW Y +IF N    ID+ PSLG ++ +    W  S H VDW   +S +L+ +   SD
Sbjct: 2470 --IPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSD 2527

Query: 2606 GRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHL 2665
            GRLGG   I+ + + S ISWPVK   +E PLI+L+ ++  L+ K  FDYH FLIA V  L
Sbjct: 2528 GRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDL 2587

Query: 2666 LLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIET 2725
             L + NERDE G+LKDLL VS++ G +++FLTALASAN  DIY T  RMR +NK SY++T
Sbjct: 2588 QLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQT 2647

Query: 2726 LKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSA 2785
            LK+SN +S+     + N L +   LRT+L+  I  F L VFPSTLFD EVLVLKA  M+ 
Sbjct: 2648 LKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNV 2707

Query: 2786 HTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAA 2845
               TQ + K KT L WQ+ +  +SL+ FKN+  EE  +++ V+EY + A  + G  ILAA
Sbjct: 2708 EAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAA 2767

Query: 2846 PAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHD 2905
            P++ V +TTWQ++    IE LY+SSFG KVD+KWNL PINFIREMWATHVRAL++RR H 
Sbjct: 2768 PSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRRGHT 2827

Query: 2906 MRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQ 2965
                +K FFEDE+I EKIK V+LG KY YIPLEEP IEMP ++DLG+ATPP+EWFGVNR+
Sbjct: 2828 EPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRK 2887

Query: 2966 RFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996
            RFPG+ HQ +VVPLQKL ++AE++Y R LG+
Sbjct: 2888 RFPGMAHQLIVVPLQKLIYVAEDQYNRTLGD 2918

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/1592 (33%), Positives = 799/1592 (50%), Gaps = 75/1592 (4%)

Query: 1    MDAGSQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRY 60
            MD+ S F+ I IS E +                     Y GR LA+ +T  + + +WR+Y
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRXXXXXXXXXXX 120
            K+KIN+QS+K+SFLGGR+FFKNLTV++ D TISFL+GSFTWRYWLL++R           
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 121  XXXDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAXXXXXXXXXXXXXXXXSLHS 180
               +     L CRF L+ DG E+F+YN+   Y+ +LR                   ++++
Sbjct: 121  DASENAK--LPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDGQETESNDDITINT 178

Query: 181  SEEKLEDETLAXXXXXXXXXXXXXRNFQEQDSRSMLLQFLPIHLKVNRGAVLLGNTTTPS 240
             E+   +  L+              +  +  +++ L    PI L+ NR A++LGN  T  
Sbjct: 179  -EKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKTKLF---PIQLEANRAAIVLGNRNTRH 234

Query: 241  VMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVHSR 300
            V +  +E A+GV D+  S   LD Y+ +  LD  +   +++ N+ + ++NPIK+++V   
Sbjct: 235  VGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVEKT 294

Query: 301  MSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSVGX 360
            M ++W+  KK         L    NQ       Q + + W+GL LY         H+   
Sbjct: 295  MDKIWQTVKKQCISISKLLLP---NQGKTINNQQAYIDSWKGLDLYH--------HTKAV 343

Query: 361  XXXXXXXNMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDVGN 420
                    ++ +    EYA+Y++++K+ +V++TY +DIPG+VP  +     Q D  +  N
Sbjct: 344  QEENVDTTVLHE---QEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLN 400

Query: 421  SGA---PPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIY 477
                   P F  D  +Y A + YGPWAH+ +Q + R+  PIVSRD +   K  PGS RIY
Sbjct: 401  CNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIY 460

Query: 478  TRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVG 537
              F LSV   + ++  IPTRESSKD++F+K+Y+ + +  R FGWL++ L +  ++   + 
Sbjct: 461  ENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLA 520

Query: 538  MCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNS 597
            +C       N+L   L+ PEI+SSVNH++ F+ + QTI A++GYP GWN +A W+F+ +S
Sbjct: 521  LCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDS 580

Query: 598  KQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIIN 657
            +    F LRDHI+L+SD+F DF +     YELFRPF Y  +W    Y ++LNVNDANIIN
Sbjct: 581  RTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDANIIN 640

Query: 658  NPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEF 717
            N LD NENC+LSL GD L    ++   +I        + +++P   L +  P W+TLHEF
Sbjct: 641  NLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEF 700

Query: 718  MKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNY 777
            +     G   DF M G+Y     VDV N DTILI+ +S  T     GFV+RYLMNI +NY
Sbjct: 701  LSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNY 760

Query: 778  FGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTE------ 831
            FGDF HFKTTEEY+ +L  + +T+       N  ++          TND E+        
Sbjct: 761  FGDFNHFKTTEEYSNDLSMEEDTKTK---TKNFQEQP---------TNDVESLTSSSSDG 808

Query: 832  -YDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDV 890
             Y + +   +  + ++ L R +NE DVW TF V DGC++ PEN+YDC     L F  L+ 
Sbjct: 809  SYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEF 868

Query: 891  DLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMF 950
            D+RY NY+MDL A  S  Y+   ++F+    F+ V A E     + G+L +LN+H HRMF
Sbjct: 869  DMRYTNYFMDLTAFFSRIYLNHSNEFS----FNRVVAIEESHSENTGYLDDLNLHGHRMF 924

Query: 951  GLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDM 1010
            G+P +EETY CKWD  IGSL  DSD  F    + A  K+GF YKD EN+LIY I KP D+
Sbjct: 925  GVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDV 984

Query: 1011 TSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEK 1070
            TSLT+    +S  +   N      L L+ I+ +  D  N RYS ++   +  I +   ++
Sbjct: 985  TSLTISIGRVS-SIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISVCAIDE 1043

Query: 1071 SSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPM-QYQKTVL 1129
              K  V    +T+++L  F    +  NHR  Q+N + L+DSP+HRC FLL   Q   + L
Sbjct: 1044 --KKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTL 1101

Query: 1130 YNKLFGAITPGVSIP----PLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAIT 1185
            Y+ L G+ITP +S+P    PLT     N  + +  S +     D +     N + +    
Sbjct: 1102 YDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNLTDDRP-- 1159

Query: 1186 EENSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLL 1245
                           L  LS+   N  S +L  +FE ++  +N+    + + P +     
Sbjct: 1160 -----------DDKRLLPLSNTVSNDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAE 1208

Query: 1246 SIYLQFCVGSXXXXXXXXXXXXVEKFSKYFVEKSAVTNLRVLAP--KICFTFGSPKGKFE 1303
            +        S            V  FS   +      N  V+    K+  +  +   K +
Sbjct: 1209 NAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKTQ 1268

Query: 1304 VSDYDHLYVEVNHPSLD---LCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQQQLK 1360
            +   D L + V++ S+    L   +   Q+N S    T++ T S    S+ F I +    
Sbjct: 1269 LEALDRLELSVSNISVISKILKYPQNLEQSNEST-GITDDSTISCNFDSLQFNIFKSS-- 1325

Query: 1361 PKTLLKARPVFSIVFXXXXXXXXXXXXXXXXLNARAVDFFVNHSQLEWLSDYLRAVILCA 1420
               L K  P+                     L   ++   +  + +EW  +YL  +    
Sbjct: 1326 KNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAF 1385

Query: 1421 TKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRS 1480
             K   S  +   L     KE I R A       I     +ITKPAYITRLSK H+R+  S
Sbjct: 1386 CKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTAS 1445

Query: 1481 WRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCY 1540
            W+IITRLRH+  +        ++     EE +     + QFL IF +W++W+  +V++  
Sbjct: 1446 WKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQSS 1505

Query: 1541 IYKRVFLSRSMKKNRITGADFKVNLERISFSL 1572
            ++  +F   S         +  ++LE +   L
Sbjct: 1506 LFTLLFSGESTVHEEDLFNELSLSLEMLHLEL 1537

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 40.8 bits (94), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 29/60 (48%)

Query: 5  SQFKAIPISKENNXXXXXXXXXXXXXXXXXXXXXYFGRALAYCITILMKWVLWRRYKVKI 64
          S+F+ +PIS   +                     YFGR L Y IT +++++ W+RY VK+
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>CAGL0C00473g Chr3 complement(45221..52360) [7140 bp, 2379 aa] {ON}
            similar to uniprot|P38111 Saccharomyces cerevisiae
            YBR136w ESR1 cell cycle checkpoint protein
          Length = 2379

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 53/128 (41%), Gaps = 19/128 (14%)

Query: 912  RHSDFNPRNIFDVVRACE------GLVDGHQGFLSELNIHAHRMFGLPIIEETYFCKWDF 965
            RHSD + RN+   +++ +      G +D   G L      A   F   I E  Y  KW  
Sbjct: 1433 RHSDIHDRNLNSTLKSLQMTYEEIGDIDSIDGLLKSF---ASTSFETKIEELQYSNKWQM 1489

Query: 966  QIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVTDSISFKVT 1025
             +   DI +DI          +K  F +  Y+N++          T   LV D+I  K+ 
Sbjct: 1490 ALECFDILADITKHDSTAQIMTKSMFDHHLYKNVI---------QTVPKLVPDNIQ-KLN 1539

Query: 1026 DGNTNCVV 1033
            + NTN ++
Sbjct: 1540 ESNTNLLI 1547

>CAGL0J02464g Chr10 (238695..241445) [2751 bp, 916 aa] {ON} similar to
            uniprot|P40537 Saccharomyces cerevisiae YIL031w SMT4
          Length = 916

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 12/85 (14%)

Query: 2149 YQKPY-GKLTL---LDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDT 2204
            Y  PY GK  L   +D Y +    A S++ +SNG EK   N S  P+M IG      G+ 
Sbjct: 809  YTSPYFGKSILKDRVDNYTASTENAHSNSTYSNGHEKSNANNSGSPTMDIGV-----GEN 863

Query: 2205 SNLFVRITGERL---DVNFLSSSIG 2226
            S +      ER    DVN +   + 
Sbjct: 864  SEISADDFSERYNESDVNLIPEGVA 888

>Ecym_8207 Chr8 complement(424366..426936) [2571 bp, 856 aa] {ON}
            similar to Ashbya gossypii ACR270W
          Length = 856

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 45/112 (40%), Gaps = 32/112 (28%)

Query: 2285 GVFKLFSEEDIQNN------------------------SKPSFEVESPSVEVAID----Y 2316
            G  +L SEEDI N+                        S+P   V SPS   + +    Y
Sbjct: 718  GANQLKSEEDISNDRSSFSKEKNTNELLSLLKRPQFHLSEPQVPVISPSTNASSENPSFY 777

Query: 2317 KHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPK 2368
             HLP V++S       +  P + T  P+C  +    +KD+  +L+    KPK
Sbjct: 778  AHLPYVVQSSKCEQFSSPQPPSQTYSPSCSAVSQKNSKDLLTLLQ----KPK 825

>Kpol_479.11 s479 complement(21571..23034) [1464 bp, 487 aa] {ON}
           complement(21571..23034) [1464 nt, 488 aa]
          Length = 487

 Score = 34.3 bits (77), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 12/95 (12%)

Query: 664 ENCYLSLHGDTLKIDFSVDLKTITGNSTTV--NYSIRTPEFHLQL--DTPSWSTLHEFMK 719
           +NC L L+ DT  +D S+  + +  NST+     SI+ P   LQ       +S L    +
Sbjct: 12  QNCQLPLNIDTSLLDLSLAQRNLIVNSTSCLPKSSIKIPNDRLQRLSKVNKYSDLK--FQ 69

Query: 720 NKEVGRSY----DFCMNGSYQFHSDVD--VGNMDT 748
           N  +G S+    D   NG+  F S +D  V NM+T
Sbjct: 70  NANLGDSFVLLKDSTANGTQSFQSALDPYVSNMET 104

>TPHA0C03870 Chr3 complement(833740..835455) [1716 bp, 571 aa] {ON}
            Anc_2.481 YKL100C
          Length = 571

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1297 SPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQ 1356
            SP+ +  +SD D+  +  N   +     K + +++ SKL Y   +    K SSI FF  +
Sbjct: 220  SPRFRLTLSD-DNEAINANSGIITNFGYKEYLESDDSKLYYQATIDEIDKDSSIKFFYRR 278

Query: 1357 QQLKPKTLLKARPVFSIVF 1375
            + ++P ++   R +F+I F
Sbjct: 279  EFIEPSSVTAKRQIFNIYF 297

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 33.9 bits (76), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 75/158 (47%), Gaps = 13/158 (8%)

Query: 2215 RLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATN---KTTEKPVNSEAAPLDPILS 2271
            R ++N + + I   NG+++ +   +E   T ++ + T+   K  EK +  E+  L+ I+ 
Sbjct: 709  RNELNDIDAEIDQVNGSIRRVSNERESVLTNIEIYRTSLNTKKNEKLILEES--LNAIVV 766

Query: 2272 KIRAFNCIVKYAGGVFKLFSEEDIQN-NSKPSFE----VESPSVEVAIDYKHLPDVIKSH 2326
            K+   N  + +A    K +  + +QN +S+ S E    +ES + E+ + +  L   + S 
Sbjct: 767  KLEKLNTNLTFAQEKLKTYENDLLQNFDSELSIEEKRKLESLTKEIGVVHNKLN--VTSE 824

Query: 2327 WIRGLVT-VDPSNNTLFPTCVPILSGMTKDVRNMLKSF 2363
             + G+ T +D  N  L    +P  S +   V  +  +F
Sbjct: 825  ALEGITTNIDSLNAELDSKLIPQESDLQAKVSEIGDAF 862

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 314,160,163
Number of extensions: 14221626
Number of successful extensions: 45750
Number of sequences better than 10.0: 61
Number of HSP's gapped: 46400
Number of HSP's successfully gapped: 82
Length of query: 2997
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2869
Effective length of database: 38,804,151
Effective search space: 111329109219
Effective search space used: 111329109219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)