Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17050g8.261ON58458429520.0
KLLA0F19118g8.261ON57857620280.0
Ecym_43098.261ON57757520260.0
AGR087C8.261ON57757719880.0
KLTH0G13706g8.261ON58456319700.0
TDEL0F038808.261ON57956819090.0
YLR088W (GAA1)8.261ON61461418990.0
Skud_12.1568.261ON61261218600.0
Kwal_56.238048.261ON57857918560.0
Suva_10.1728.261ON61461418410.0
Kpol_543.378.261ON57857718280.0
Smik_12.1478.261ON61361318300.0
ZYRO0C01672g8.261ON56957917520.0
TBLA0F030808.261ON58357817480.0
KNAG0H032508.261ON58558517210.0
NCAS0B038608.261ON58357317150.0
CAGL0L12232g8.261ON59159516790.0
NDAI0J013908.261ON58358216430.0
TPHA0A018208.261ON58158016260.0
KAFR0B055508.261ON55555015350.0
Kwal_26.71547.86ON121380751.8
TPHA0J018406.124ON52848732.7
Kpol_2001.101.207ON764109733.4
TBLA0A078003.45ON41341714.2
TBLA0H003202.411ON130151724.9
KAFR0A081703.85ON63378706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17050g
         (584 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...  1141   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   785   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   785   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   770   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   763   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   739   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   736   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   721   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   719   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   713   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   708   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   709   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   679   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   677   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   667   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   665   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   651   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   637   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   630   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   595   0.0  
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    33   1.8  
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    33   2.7  
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    33   3.4  
TBLA0A07800 Chr1 complement(1921256..1922497) [1242 bp, 413 aa] ...    32   4.2  
TBLA0H00320 Chr8 complement(56811..60716) [3906 bp, 1301 aa] {ON...    32   4.9  
KAFR0A08170 Chr1 complement(1643716..1645617) [1902 bp, 633 aa] ...    32   6.3  

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score = 1141 bits (2952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/584 (95%), Positives = 559/584 (95%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              NTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 421 EXXXXXXXXXXXMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480
           E           MPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA
Sbjct: 421 ELLLSLNVLLLLMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480

Query: 481 FPMTLVRTTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLG 540
           FPMTLVRTTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLG
Sbjct: 481 FPMTLVRTTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLG 540

Query: 541 CWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEKTESRNIKSE 584
           CWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEKTESRNIKSE
Sbjct: 541 CWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEKTESRNIKSE 584

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/576 (64%), Positives = 454/576 (78%), Gaps = 7/576 (1%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MALVEKLHRR I +GL+PKFI+ L  LS+ C V+G+ WL   +P+DGQFRRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKK-SSTHERNEEVSSWLQQFGAKTAIYTNEEYGE 119
           PSQAYSYFRE+EWN+LRGYRTQ++LF+  S+TH+ N EVS WLQ+FG KTAIY +E+YGE
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 120 TLYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLS 179
           TLYGI HAPRGDGTEAMV+AAPWYN   +YNTGG ALA+SL RFFSRWPVWSKNIIIVLS
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 180 EDPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLV 239
           EDP+A+LRSWV AYHTSLDLTGGSIE+A+V+D+PG++D F Y+EIH+DGLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 240 NVAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGW 299
           NVAVHI EHEG+KVSLHG+   EL +ND+ SR+KT++LG+K+  LSGIK  +GNE FSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 300 RIHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSY 359
           RI S+TLKA G DGP DITTFGR+PEA+ RSVNNLLEKFHQSFFFYLLLAPR F+SIG+Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 360 LPXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQ 419
           L               N ILNN+Y  LPLLS YN++++L F ++L  +F T+Q F+Y P 
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 420 PEXXXXXXXXXXXMPIIF-TRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGC 478
           P            +P++  TR++I+ PFSYR K+FAY+Y ++VLTSLLV+NFSLA  +G 
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 479 LAFPMTLVRTTS---GNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535
           LAFPMT  RTT+    NLR  +KN VLL+ISNPFIA W     V+  L G +VFY L  A
Sbjct: 481 LAFPMT--RTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEA 538

Query: 536 WKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVP 571
            + LGCWTW++IC+GW PSWLLV Y+ ID++ +  P
Sbjct: 539 SQQLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTP 574

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/575 (62%), Positives = 454/575 (78%), Gaps = 1/575 (0%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MA++EKLHRR +DMGL+P+ IA LP +SIFCA++ +SWL LF+P +GQ+RRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRE+EWN+LRGYR ++E  K    HERN  V+SW++++GAKT+I TN +YGET
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYGI+H  RGDGTEAMVLAAPW  ++  YN GG ALA+SL+R+F+RWPVWSKNII+VLS 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           DPQA+LR+WV+AYHT LDLTGGSIE+AVV+D+PG+ND+FKY+EI ++GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
            AVHI+EHEGMKVSLHG+   EL ++ +  R+KT++ G+K+M L+GIK + G+E F+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I SVTLKA G DGPFD+TTFGR+PEAIFRSVNNLLEKFHQSFFFYLLL+PR FVSIGSYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              ++ILNNEY+ LPLLS YN++AL  FAVAL +SF+TA+AF Y P P
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 421 EXXXXXXXXXXXMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480
                       +     + KI+ PFSYR K+FA+LYFS+VLTSLLVVNF+LA  +G LA
Sbjct: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVLA 480

Query: 481 FPMTLVRTTS-GNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDL 539
           FPM+L +TT+   ++ +L+N +LL+ SNPFIA W+     + +L G  +F+ L  AW  L
Sbjct: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540

Query: 540 GCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDE 574
           GCWTW+V+CIGW PSW+LVAYS IDS+ IV    +
Sbjct: 541 GCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKK 575

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/577 (62%), Positives = 455/577 (78%), Gaps = 1/577 (0%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MA++EKLHR+ +DMGL+PK I  L  +S    ++ V+WL LF+P +GQ+RRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRE+EWN+LRGYR++I+  +  +  ERN  V+SW++++GAK A+Y ++ +GET
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LY +LHA RGDGTEAMVLAAPW   E QYNTGG+ALAV++ R+FSRWPVWSKNIIIVLSE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           DP A+LRSWV+AYHT LDLTGGSIEAA+V+D+PG+ND+F++VEI ++GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           VAVHITEHEGMKV+LHG   EELG + +FSRM+ ++ G+K+MALSGIK++ GNE FSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I SVTLKA GT+G FDITTFGR+PEA+FRSVNNLLEKFHQSFFFYLLLAPR FVSIGSYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              +++LNNE+ SLPL+S YN++ALL F+VAL VS ITA+ F Y P P
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 421 EXXXXXXXXXXXMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480
                       MP    + KI+ PFS+R K+ AYLYFS VL+SLLV+NF LAF +G LA
Sbjct: 421 ALLLAFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480

Query: 481 FPMTLVRTT-SGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDL 539
           FPMT VRTT   ++R ++KN +LLL+SNPFI+I +F    + EL G  VFY L  AW DL
Sbjct: 481 FPMTFVRTTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540

Query: 540 GCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEKT 576
           GCWTW+V+C+GW P+W++VAYS IDSV I  P  + +
Sbjct: 541 GCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKKSS 577

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/563 (63%), Positives = 441/563 (78%), Gaps = 1/563 (0%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MAL+EKL RR ID+GLLP+ +  LP LSI C ++G+ WL L +P +GQ+R TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRETEWN+LRGYRTQI++ ++ S+ ERNE V+SW Q+FGAKTA Y ++ +G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           +YG+LHAPRGDGTEAMVLAAPWYN + +YN GG ALA +LSRFFSRWPVWSKNIIIV S+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           DP+A+LRSWV AYHTSLDLTGGSIE+AVV+D+PGSNDFFKYVEI++ GLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           VAVHITEHEGMKVSL+G+SEEE+ K ++FS+MKT+++GVK MALSG++  +GNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I ++ L+A GTDGPFDITTFGRIPEA FRSVNNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              + +L +  ++ P  S +N+ A++GF VAL +SF  +  F +    
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 421 EXXXXXXXXXXXMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480
                       +P IF R  I    SY+ KS A+LY SVVLTSLLV+NF+LAFG+G LA
Sbjct: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLLA 480

Query: 481 FPMTLVRTTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLG 540
           FP+ LV+    + R R+KN +LL++SNPFI+  LF    + +L G+Q+F+ L  AW+ LG
Sbjct: 481 FPLILVKAPMTS-RQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLG 539

Query: 541 CWTWFVICIGWLPSWLLVAYSGI 563
           CWTW V+CIGWLPSWLLVA SGI
Sbjct: 540 CWTWSVVCIGWLPSWLLVACSGI 562

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/568 (61%), Positives = 444/568 (78%), Gaps = 5/568 (0%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           M+L+ KLHRR ID+GL+PK +A LP LS+  AVV V WLAL +P +G++RRTYISENAL+
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLAL-LPLEGRYRRTYISENALL 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRETEWN LRGYRTQIE    S++ ERNEEV+ WL++FG KTAIY +E++G+T
Sbjct: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG+LHA RGDGTEA++LAAPW N++   N  G+++ ++L+RFFSRWPVWSKNII+VLSE
Sbjct: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P+ ++RSWVEAYHTSLDLTGGSIEAAVV+D+PG ND+F +VEIH+DGLNGE PNLDLVN
Sbjct: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           +A+ ITEHEGMKVSLHG+S +++  NDF+SR+  ++ G+KN ALSG++K +GNE FSGWR
Sbjct: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I +VTLKA GT+G  D+TTFGRIPEA+FRS+NNLLEKFHQSFFFY+LLAPR FVSI SYL
Sbjct: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              + ++NN Y  LPL STYN+ +L  + ++L   F  AQ FL    P
Sbjct: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419

Query: 421 EXXXXXXXXXXXMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480
                       +P++  + KI  P +YRLKS A+L+FS+VLTSLL+VNF LAF +G  A
Sbjct: 420 TILISFSALISFLPLLLKK-KIAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 481 FPMTLVRTTSGN---LRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWK 537
           FPMTLVRT+S N   LR +LKN +LLL+SNPFIA ++F  C + +L G  VF    +AWK
Sbjct: 479 FPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538

Query: 538 DLGCWTWFVICIGWLPSWLLVAYSGIDS 565
           +LGCWTWFVICIGWLPSWL+VA S +++
Sbjct: 539 ELGCWTWFVICIGWLPSWLMVALSTLNT 566

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/614 (58%), Positives = 444/614 (72%), Gaps = 41/614 (6%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MAL+EKLHRR +DMGL+P+ IALLP +S+ CA+ G   +A+ +P DGQ+RRTYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRE+EWN+LRGYR+QI+     ++ ERN  + SWLQ+FG KTAIY NE+YGET
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG++HAPRGDGTEAMVLA PW+NS++++N GG AL VSL+RFFSRWPVWSKNII+V SE
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P+AALRSWVEAYHTSLDLTGGSIEAAVV+D+  + DFF+YVEI +DGLNGELPNLDLVN
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           +A+ ITEHEGMKVSLHG+  ++L  N+F+SR+K + LG+++ ALSG+KK HGNE FSGWR
Sbjct: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I SVTLKA G  G  DITTFGRIPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              N  +NN Y ++ L S YN+ ALL + V+L +SF+ +QAFL  P  
Sbjct: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418

Query: 421 EXXXXXXXXXXXMPIIFTR-VKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479
                       +P+I +R + I  P SYRLK+ A+LYFS+V TSLL++NF++A  +G L
Sbjct: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 AFPMTLVRT--------------------------------------TSGNLRARLKNCV 501
           AFPMT V+T                                      T    + +LKN V
Sbjct: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLV 538

Query: 502 LLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLGCWTWFVICIGWLPSWLLVAYS 561
           LL+++NPFI+I LF +  D E  G  +   L SAW DL CW+WFV+CIGWLP WLL+  S
Sbjct: 539 LLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598

Query: 562 GIDSVSIVVPQDEK 575
             +S S+VV   EK
Sbjct: 599 SFESKSVVVRSKEK 612

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/612 (58%), Positives = 442/612 (72%), Gaps = 39/612 (6%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MAL+EKLHRR +DMGL+P+ IALLP +S  CA+ G   +A+ +P DGQ+RRTYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRE+EWNVLRGYR+QIE  +  ++ ERN ++ SWLQ+FG KTAIY +++YGET
Sbjct: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG++HAPRGDGTEAMVLA PW+NS++++N GG AL VSL+RFFSRWPVWSKNII+V SE
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P+AALRSWVEAYHTSLDLTGGSIEAAVV+D+  + DFF+YVEI +DGLNGELPNLDLVN
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           +A+ ITEHEGMKVSLHG+  ++L  NDF+SR+K + LG+++ ALSG+K  HGNE FSGWR
Sbjct: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I SVTLKA G  G  DITTFGRIPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              N  +NN Y S+ L S YN+ ALL + ++L VSFI +Q FL  P  
Sbjct: 359 PSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418

Query: 421 EXXXXXXXXXXXMPIIFT-RVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479
                       +P++ + +V I  P SYRLK+ A+LYFS+V TSLL++NF++A  +G L
Sbjct: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478

Query: 480 AFPMTLVRT------------------------------------TSGNLRARLKNCVLL 503
           AFPMT +RT                                         R +LKN +LL
Sbjct: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLL 538

Query: 504 LISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLGCWTWFVICIGWLPSWLLVAYSGI 563
           +++NPFI+I LFA+  D E  G  +   L SAW DL CW WFV+CIGWLP WLL+  S  
Sbjct: 539 VLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598

Query: 564 DSVSIVVPQDEK 575
           +S S+VV   EK
Sbjct: 599 ESRSVVVKSKEK 610

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/579 (59%), Positives = 439/579 (75%), Gaps = 2/579 (0%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MAL+E+L R+ ID+GLLP+ +  LP LS+ C ++G+ W+ L +P +GQ+R TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRETEWN+LRGYRTQI+  +  S+ ERNE + SWLQ+FG KTA+Y +E  G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG+LHAPRGDGTEAMVL+APW+N + ++N GG AL V+L+R+FSRWPVWSKNII+V S+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           DP+A+LRSWV+AYHTSLDLTGGSIE+AVV+D+PG NDFFKYVEI++ GLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           VA+H+TEHEGMKVSL+GI E+E+   D+F+RMKT+++G+K MALSG+++ +GNE FSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I +V L+A G  GPFDITTFGR+PEA+FRSVNNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              + +L    ++       N+ A++GF VAL  SF  +  F     P
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 421 EXXXXXXXXXXXMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480
                        PI+  RV+I++ +++RLK+ AYLY SVVLTSLLVVNF+LAFG+G LA
Sbjct: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLLA 480

Query: 481 FPMTLVRTTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLG 540
           FP+ LV+ ++   R   KN +LLL+SNPFI+  LFA   +  L G+Q+   L  AW + G
Sbjct: 481 FPLILVKNST-TPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFG 539

Query: 541 CWTWFVICIGWLPSWLLVAYSG-IDSVSIVVPQDEKTES 578
           CWTW V+CIGWLPSWLL+AYS  I  VS ++   EK  S
Sbjct: 540 CWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKKSS 578

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/614 (58%), Positives = 441/614 (71%), Gaps = 41/614 (6%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MAL+EKLHRR +DMGL+P+ IALLP +S  CA+ G   +A+ +P DGQ+RRTYISENALM
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRETEWN+LRGYR+QIE     ++ ERN  + SWLQ+FG KTAIY NE+YGET
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG++HAPRGDGTEAMVLA PW+NSE ++N GG +L VSL+RFFSRWPVWSKNII+V SE
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P AALRSWVEAYHTSLDLTGGSIEAAVV+D+  + DFF+YVE+ +DGLNGELPNLDLVN
Sbjct: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           VA+ I EHEGMKVSLHG+  E+LG NDFFSR+K + LG+++ ALSG+K  HGNE FSGWR
Sbjct: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I SVTLKA G  G  DITTFGRIPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 300 IQSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              N  +NN+Y S+ L S YN+ A+L + +A+ VSF+ +Q FL     
Sbjct: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418

Query: 421 EXXXXXXXXXXXMPIIFT-RVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479
                       +PI  + +V I  P SYRLK+ A+LYFS+V TSLL++NF++A  +G L
Sbjct: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 AFPMTLVRT------------TSGNL--------------------------RARLKNCV 501
           AFPMT ++T            T  N+                          R +LKN +
Sbjct: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLL 538

Query: 502 LLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLGCWTWFVICIGWLPSWLLVAYS 561
           LL+++NPFI+I +F +  D E QG  +   L SAW DL CW+WF++C+GWLP WLL+  S
Sbjct: 539 LLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILAS 598

Query: 562 GIDSVSIVVPQDEK 575
             +S S+VV   EK
Sbjct: 599 SFESKSVVVKSKEK 612

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/577 (57%), Positives = 430/577 (74%), Gaps = 4/577 (0%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           M+++E L RR ID GLLPKF+A LP LS+    V V  L L++P DGQFRRTYISENALM
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVM-LMLYLPMDGQFRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRETEWN+LRGYR +IE+    S+ ERN  +SSWL++FG KT++Y N+EYG++
Sbjct: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG+ +APRGDGTE+MVLA PWYN+E+++N  G AL VSL+RF SRWPVWSKNII+V SE
Sbjct: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P+ ALRSWVEAYHTSLDLTGGSIEAAVV+D+PG +D+F+Y+E+H++G NG LPNLDLVN
Sbjct: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           +A+ I EHEG+KVSLHG++ +E+G  D++SR+K I LG KN+AL+G+++ +GNE FSGWR
Sbjct: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I ++TLKA G D   D+TTFGR+ EA+FRS+NNLLEKFHQSFFFY LLAPR FVSIGSYL
Sbjct: 300 IQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              ++ +NN+Y S+   S YN+ + + +AV++ V F    +F Y PQP
Sbjct: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418

Query: 421 EXXXXXXXXXXXMPIIFTR-VKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479
                       +P+   + + I  P +YRLK+ +++Y S+V+TSLLVVNF LAFG+G  
Sbjct: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478

Query: 480 AFPMTLVR-TTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKD 538
           A+PMTLV    + NLR + +N +LL ISNPFIA WLF   V+ +L G++  YGL  AW  
Sbjct: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538

Query: 539 LGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEK 575
           LG WTWF+ CIGW PSW+LVA S +    +    + K
Sbjct: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSK 575

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/613 (57%), Positives = 438/613 (71%), Gaps = 40/613 (6%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MAL+EKLHRR +DMGL+P+ IA LP +S+ CA+ G   +A+ +P DGQ+RRTYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRE+EWN+LRGYR+QIE     ++ ERN  + SWLQ+FG KTAIY NE+YGET
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG++HAPRGDGTEAMVLA PW+NS++++N GG AL VSL+RFFSRWPVWSKNIIIV SE
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P AALRSWVEAYHTSLDLTGGSIEAAVV+D+  + DFF+YVEI +DGLNGELPNLDLVN
Sbjct: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           VA+ ITEHEGMKVSLHG+  ++L  N+++SR+K + LG+++ AL+G+K  HGNE FSGWR
Sbjct: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I SVTLKA G  G  DITTFGRIPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              N  +NN Y S+ + S YN+ ALL + ++L +SF+ +Q FL  P  
Sbjct: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418

Query: 421 EXXXXXXXXXXXMPIIFT-RVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479
                       +P+I + +V I  P SYRLK+ A+LYFS+VLTSLL++NF++A  +G L
Sbjct: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478

Query: 480 AFPMTLVRT---TSGNLRARLKNCVLL--------------------------------- 503
           AFPMTLV+T   +SG      K  + +                                 
Sbjct: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLL 538

Query: 504 -LISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLGCWTWFVICIGWLPSWLLVAYSG 562
            +++NPFI+I +F    D E QG  V   L SAW DL CW+WFV+CIGWLP WLLV  S 
Sbjct: 539 LVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598

Query: 563 IDSVSIVVPQDEK 575
            +S  +++   EK
Sbjct: 599 FESKRVMLKSKEK 611

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/579 (57%), Positives = 424/579 (73%), Gaps = 13/579 (2%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MAL+E+L RR ++MGL+PK IALLP +S+ CA++   WLA  +P +GQFRRTYISENALM
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLAT-LPIEGQFRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRE+EWN+LRGYR+QIE F + S +ERNE+++ WLQ+FGAKT+IY NEEYG++
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYGILHA RGDGTEA++LA PWYN+E   N GG +L +SLSRFFSRWPVWSKNIIIV SE
Sbjct: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P  ALRSWV+AYHTSLDLTGGSIEAA+V+D+PG+ND+F Y EI + GLNGELPNLDLVN
Sbjct: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           +AV ITEHEG+ VSLHG++ E +    ++SR+K ++ G+   A +G++   GNE FSGWR
Sbjct: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299

Query: 301 IHSVTLKACGTD-GPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSY 359
           I SVT+KA G + G  DITTFGRIPEA+FRS+NNLLEKFHQS+FFY+L+APR FVSI SY
Sbjct: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359

Query: 360 LPXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQ 419
           LP              N++L N+Y++L   S YN+ ALL + V++ VSF+ +Q FLY P 
Sbjct: 360 LPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419

Query: 420 PEXXXXXXXXXXXMPIIFTRV-KIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGC 478
                        +P+   R+  I  P S+RL+ +A+LY S+V+TSL++VNF+LAF +G 
Sbjct: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479

Query: 479 LAFPMTLVRTTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKD 538
           LAFPMT V T         K   LL+ISNP ++ ++            Q+   L SAW+D
Sbjct: 480 LAFPMTAVGTQRS---LTFKKYALLIISNPLVSFFIVK-------PHPQLLQKLISAWQD 529

Query: 539 LGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEKTE 577
           LGCWTWFV+C+GWLPSW L+A S   S ++      K E
Sbjct: 530 LGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKE 568

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/578 (56%), Positives = 433/578 (74%), Gaps = 6/578 (1%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MAL+  +HRR IDMGL+PK +  LP +SIF A +G+  L L +P DGQ+R TYISENALM
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRE+EWN+LRGYRT+I++F    + +RN  ++ WL++FG KT++Y N+EYG+T
Sbjct: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYGI +APRGDGTEA+VLA PWYN++ ++NTGG AL ++LSRFFSRWP+WSKNII+V SE
Sbjct: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P  ALRSWV+AYH SLDLTGGSIEAA+VMD+P S+DFF YVEI++ G+NGELPNLDL+N
Sbjct: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           +A+ ITEHEGM+VSLHG+ +E L +N++FSR++T++LG K+  LSGIK  HGNE FSG+R
Sbjct: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299

Query: 301 IHSVTLKACGT--DGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGS 358
           I ++TLKA  T  +   DIT+FGRI EA FRSVNNLLEKFHQSFFFYL+LAP+ FVSI S
Sbjct: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359

Query: 359 YLPXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAP 418
           YLP              ++ +NN Y++LP+ S YN+ A L F +++  SF  A+  L   
Sbjct: 360 YLPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419

Query: 419 QPEXXXXXXXXXXXMP-IIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLG 477
           +P            +P ++  R  I  P SYRLKS A+LY S+VLTSLLV+NFSLAFG+G
Sbjct: 420 EPRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIG 479

Query: 478 CLAFPMTLVRTTS--GNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535
            L F MT V+T +   ++R R++N + LL+SNPF ++ LF    D+++ G+++FY    +
Sbjct: 480 ILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539

Query: 536 WKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQD 573
           W  L CWTWF+IC+GWLP W+LV+ S I + +++   D
Sbjct: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPD 577

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/585 (58%), Positives = 425/585 (72%), Gaps = 13/585 (2%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           M L E L R+ + +GLLPK +A LP LS   AVV V  + L IP +GQ+R TYISENALM
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVV-MILIIPMNGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELF--KKSSTHERNEEVSSWLQQFGAKTAIYTNEEYG 118
           PSQAYSYFRETEWN+LRGYRT+IE+   +  S  +R + V+ WL +FGAKTA+Y NEE G
Sbjct: 60  PSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMG 119

Query: 119 ETLYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVL 178
           +TLYG+LHAPRGDGTEAMVL APW NSE ++N GG ALA++LSR+FSRWPVWSKNII+V 
Sbjct: 120 DTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVF 179

Query: 179 SEDPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDL 238
           S++P  ALRSWVEAYHTSLDLTGGSIEAAV++D+P +ND+F Y EIHF+GLNGELPNLDL
Sbjct: 180 SDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDL 239

Query: 239 VNVAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSG 298
           VNVAVHIT+HEGMKVSLHG+   EL KN+++SR+K + LG+K+  L+G+KK+HGNEVFSG
Sbjct: 240 VNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSG 299

Query: 299 WRIHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGS 358
           WRI +VTLKA G +G  DITTFGRIPEA+FRS+NNLLEKFHQSFFFY LL+P  FVSI S
Sbjct: 300 WRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISS 358

Query: 359 YLPXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYA- 417
           YLP              +  +NN Y S  L  TY + A L   ++L VSF+ A  FLY+ 
Sbjct: 359 YLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLYST 417

Query: 418 PQPEXXXXXXXXXXXMPIIFTRVK--IRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFG 475
             P             P++ +R    +R P  YR+++  Y+Y+S++LTSLL++NF LAF 
Sbjct: 418 TSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFS 477

Query: 476 LGCLAFPMTLVRT----TSGNLRARLKNCVLLLISNPFIAIWLFAICVDR-ELQGVQVFY 530
           +G   +PMTLV+     +   +  +L+N VLL+ISNPF+A WL    V+  E   + VF 
Sbjct: 478 IGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFA 537

Query: 531 GLTSAWKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEK 575
            L SAWKDL CWTWFV+C+GWLP+WLLV +S   S+       EK
Sbjct: 538 ALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEK 582

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/573 (56%), Positives = 423/573 (73%), Gaps = 6/573 (1%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           M L E++ R+ I  GL+PK I+LLP +S  C V+G+  +   +P +GQ+R TYISENALM
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIV-IIGILPFEGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRE+EWN++RGYR+QI   + +S  ERN  +S WLQQFG KT IY N E G+T
Sbjct: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG+ HAPRGDGTE+MVLA PW+N++ ++N  G AL V+L+R+FSRWPVWSKNII+V +E
Sbjct: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P+AALRSWVEAYHTSLDLTGGSIEAA+V+DF G  D F Y+EI++DGLNGELPNLD+VN
Sbjct: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           + V   EHEGMKVSLHG   +++ ++  FSR+K ++  +KN ALSG+KK++GNE FSGWR
Sbjct: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I SVTL+A G +GPFD+T+FGR+PEA+FRS+NNLLEKFHQSFFFYL+LAPR FVSI SYL
Sbjct: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              N+  NN Y +LP  S Y + ++L + V+L V+FI +  F+Y+P P
Sbjct: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419

Query: 421 EXXXXXXXXXXXMPIIFT-RVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479
                        P I      ++   SYRL+S A+L+ S++LTSLL+VNF LAFG+G L
Sbjct: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLL 479

Query: 480 AFPMTLVRTTSGNL----RARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535
           +FPMT V+T + +     R R+KN VLLL+SNPFIA WLF++  D E  G+ VF  L SA
Sbjct: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539

Query: 536 WKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSI 568
            ++LGCWTW V+C+GW   WLLVA S +D+V +
Sbjct: 540 SRELGCWTWLVLCVGWWTPWLLVAISALDTVKL 572

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/595 (54%), Positives = 420/595 (70%), Gaps = 16/595 (2%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           M+L++K++RR  + G + K +  LP +S    VV +  L   +P DGQ+RRTYISENALM
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIV-LLAILPLDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRETEWN+LRGYR+QIE  + SS  +RNE V+ WLQ+ G KTA+Y +E++G+T
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG+LHA RGDGTEAMVLA PW N ++Q+N GG AL VSLS+FF RWPVWSKNII+V SE
Sbjct: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           D  AALR+WV+AYHTSLDLT GSIEAAVV+D+P  +DFF+YVEI +DGLNGELPNLDLVN
Sbjct: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           +AV ITEHEGMKVSLHG+   E+   D+F+R+K + +G+KN ALSG+K+ HGNE FSGWR
Sbjct: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I SVTL+A G +G  DIT FGRIPEA+FRSVNNLLEKFHQS+FFYLLLAPR FVSI +YL
Sbjct: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              ++ +NN+Y S+P  S   +   +  + ++FVSF+ ++  +  P  
Sbjct: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419

Query: 421 EXXXXXXXXXXXMPIIFTRVKIRT---PFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLG 477
           E           +P++ ++  I       +YRLKS   +Y+S++LTSLL+VNF+L F +G
Sbjct: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIG 479

Query: 478 CLAFPMTLVRTTSGNL------RARLKNCVLLLISNPFIAIWLFAICVDRELQG-VQVFY 530
            LAFP+T +   S         ++ LKN  +L I+NPFI++WLF   +D +  G   V Y
Sbjct: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539

Query: 531 G-LTSAWKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEKTESRNIKSE 584
             + ++W  LGCWTWF+IC+GWLP WL+   S I S  IV    E+T   + K E
Sbjct: 540 NRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPIV----ERTSILDDKKE 590

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/582 (53%), Positives = 415/582 (71%), Gaps = 9/582 (1%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           M L+E++ R  +  GL+PK +A LP +SI    + +  +A+ +P DGQ+R TYISENALM
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAI-LPMDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRETEWN++RGYR ++   + S++ ERN+ + SWL +FG KT IY N +  E 
Sbjct: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEV 118

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG+ HAPRGDGTEA+VLA PW+N + ++NT G A+ V+L+R+FSRWPVWSKNII+V SE
Sbjct: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P +ALRSWVEAY+TSLDLTGGSIEAA+V+D PG ND+F Y+E+++DGLNGELPNLDLVN
Sbjct: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           + ++I EHEGM+VSLHG   +++ +N++++R+K ++  +++ A SG+ K+HGNE FSGWR
Sbjct: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I S+TLK  G  GP DIT FGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              ++ +NN   +LP  S Y +   + + V L   FI AQ FL  P P
Sbjct: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIP 418

Query: 421 EXXXXXXXXXXXMPIIFTRVKIRTP-FSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479
                         II    K+  P  S RL+SFA+L+ S++LTSLL+VNF L+F +G +
Sbjct: 419 SLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLM 478

Query: 480 AFPMTLVRTTSGNL--RARLKNCVLLLISNPFIAIWLFAICVDRE----LQGVQVFYGLT 533
           AFPMT VR+ + N   + +L+N +LL+ISNPFIA+ ++           LQG++V   L 
Sbjct: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538

Query: 534 SAWKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEK 575
           SAWKD+ CWTWFV+C+GWLPSW++VA S I++       D K
Sbjct: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVK 580

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/580 (52%), Positives = 413/580 (71%), Gaps = 7/580 (1%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           MAL+E LHRR   +GLLPK I  L  +S    ++ +  L L +P DGQ+RRTYISENAL+
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIG-LILCLPLDGQYRRTYISENALL 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRE+EWN+LRGYRT IE         RNE +SSWL  FG K A+Y N   G+T
Sbjct: 60  PSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDT 119

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           LYG+ ++ RGDGTEA+VLA PWYN++N+ N GG AL +SLSR+FSRWP+WSKNII+V+SE
Sbjct: 120 LYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISE 179

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           +P  A++SWV+AYH SLDLTGGS+EAA+V+DFP  +++F++VE++F+G+NGELPNLD+VN
Sbjct: 180 NPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVN 239

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           VA+ + EHEG+KVSL G++  E+  + +F+R+KT++ GVKN ALSG +K +GNE FSG R
Sbjct: 240 VAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRR 299

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I ++TLKACGT+G  DITTFGRIPEAIFRSVNNLLEKFHQSFFFY L+APR FVSIGSYL
Sbjct: 300 IQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P              ++ +NN+Y ++PL    ++ AL+ F  ++ +SFI  Q      QP
Sbjct: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQP 418

Query: 421 EXXXXXXXXXXXMPIIFT---RVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLG 477
                       +P+       + I+   SYRLKSFA++Y S+VLTSLLV+NF+LAFG+G
Sbjct: 419 HLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMG 478

Query: 478 CLAFPMTLVRTTSG--NLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535
            LAFP+T  ++ S     ++++ NC  L ISNPFIAI++F    + ++   +VF  L S+
Sbjct: 479 LLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISS 538

Query: 536 WKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEK 575
           +K +G WTW + CIGW  +W +V  + +D+    +  D K
Sbjct: 539 FKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTK 578

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/550 (55%), Positives = 383/550 (69%), Gaps = 11/550 (2%)

Query: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60
           M LVE++ R+   MGL+PK    LP  S   A++ +      +P DGQ+R TYISENALM
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLI-SIAILPIDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120
           PSQAYSYFRETEWN+LRGYRTQ+E        ERN+ + +WL   GAKT  + N     T
Sbjct: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----T 115

Query: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180
           +YGI H+PRGDGTEA+VLA PW+NSE Q+NTGG AL VSL+RFF RWP+WSKNII+V SE
Sbjct: 116 IYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSE 175

Query: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240
           D  A+LRSWVEAYHTSLDLTGGSIEAAV++D+   +DFF YVEIH+DGLNGELPNLDLVN
Sbjct: 176 DTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVN 235

Query: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300
           +AV ITEHEGMKVSLHG+  EEL +   +SR K ++  +K+ +L+GIKK HGNE FSGWR
Sbjct: 236 IAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWR 295

Query: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360
           I ++TLKACG +G  DITTFGRIPEA+FRS+NNLLEKFHQSFF+YLLLAPR FVSI SYL
Sbjct: 296 IQALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354

Query: 361 PXXXXXXXXXXXXXXNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420
           P                 +N+   S+P +S+Y + A++ + +++  SF  A  +L    P
Sbjct: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414

Query: 421 EXXXXXXXXXXXMPII---FTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLG 477
                       +P+I       + +   ++R+K+FA+ YFS+VLTSLL++NF LA  +G
Sbjct: 415 VMLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIG 474

Query: 478 CLAFPMTLVR--TTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535
            LAFPMTLV+   T       LKN +LLL+SNP+I+I  F+   D EL G+     L  A
Sbjct: 475 VLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPA 534

Query: 536 WKDLGCWTWF 545
           W D+ CWTWF
Sbjct: 535 WNDMNCWTWF 544

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 19/80 (23%)

Query: 208  VVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVNVAVHITEHEGMKVSLHGISEEELGKND 267
            +++DF   +D++ Y+E    G +G +   DL+ +   +TEHE M +              
Sbjct: 1023 MLLDFFEDDDYY-YIETAVHGTSGSIDLFDLIEMKTDMTEHEAMLI-------------- 1067

Query: 268  FFSRMKTIILGVKNMALSGI 287
                 K I  G+KN+  +GI
Sbjct: 1068 ----FKQIASGIKNLHDNGI 1083

>TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {ON}
           Anc_6.124 YBR227C
          Length = 528

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 305 TLKACGTDGPFDITTFGRIPEAIFR-SVNNLLEKFHQSFFFYLLLAPR 351
           T+ A     P D+ +FG IPE + R  +   L+  HQ   F++L  P+
Sbjct: 358 TIPALNLTSPADLISFGIIPELVGRVPIVTALQPLHQKDLFHILKEPK 405

>Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON}
           (30724..33018) [2295 nt, 765 aa]
          Length = 764

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 46/109 (42%), Gaps = 12/109 (11%)

Query: 472 LAFGLGCLAFPMTLVRTTSGNLRARLKNCVLLLISNPF---IAIWLFAICVDRELQGVQV 528
           + FG  C        RT    +++R      +++  P+   I +W     +     G+ +
Sbjct: 521 IDFGSSCQE-----SRTLFSYIQSRFYRSPEVIMGIPYSTSIDMWSLGCIIAELFLGIPI 575

Query: 529 FYGLTSAWKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEKTE 577
           F G +S +  L   T  + CIG  P+W++      D   I +  DE+TE
Sbjct: 576 FPG-SSEFNQL---TRIISCIGNPPAWMIDMGKSSDKYFIKIESDEETE 620

>TBLA0A07800 Chr1 complement(1921256..1922497) [1242 bp, 413 aa]
           {ON} Anc_3.45 YOL126C
          Length = 413

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 25/41 (60%)

Query: 223 EIHFDGLNGELPNLDLVNVAVHITEHEGMKVSLHGISEEEL 263
           +I+ DG+NG   +L  ++ AVH+T H G    +  +++ +L
Sbjct: 78  DINKDGVNGVTTDLSHIDTAVHVTSHSGEDGLVESLTDSDL 118

>TBLA0H00320 Chr8 complement(56811..60716) [3906 bp, 1301 aa] {ON}
           Anc_2.411 YLR032W
          Length = 1301

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 250 GMKVSLHGISEEELG------KNDFFSRMKTIILGVKNMALSGIKKSHGNE 294
           G+K+S     EE +       +NDFF  +K++I  + N AL  +   HGN+
Sbjct: 135 GLKLSEDEAKEENIDEYLNAKRNDFFKTIKSVIPSIDNKALEYLYVKHGNK 185

>KAFR0A08170 Chr1 complement(1643716..1645617) [1902 bp, 633 aa]
           {ON} Anc_3.85 YDR496C
          Length = 633

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 11/78 (14%)

Query: 273 KTIILGVKNMALSGIKKSHGNEVFSGWRIHSVTLKACGTDGPFDITTFGRIPEAIFRSVN 332
           K+I+  +KN A   IK  HGN VF       +TL  C  D      TF      I  S+N
Sbjct: 348 KSILKTLKNHASELIKNEHGNLVF-------ITLLMCVDDTVLVFKTFN---STIKESLN 397

Query: 333 N-LLEKFHQSFFFYLLLA 349
             +++K+ +  F Y+LL 
Sbjct: 398 EFVVDKYGRRPFLYMLLG 415

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,075,829
Number of extensions: 2406304
Number of successful extensions: 6971
Number of sequences better than 10.0: 28
Number of HSP's gapped: 7084
Number of HSP's successfully gapped: 32
Length of query: 584
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 469
Effective length of database: 40,294,809
Effective search space: 18898265421
Effective search space used: 18898265421
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)