Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17028g8.262ON55055029720.0
Kwal_56.237998.262ON48841811911e-159
KLTH0G13684g8.262ON50853311571e-153
Ecym_43088.262ON52953911201e-147
AGR086C8.262ON5345259861e-127
TDEL0F038908.262ON4763709671e-125
KAFR0B055408.262ON5193669191e-117
KLLA0F19140g8.262ON5274118631e-109
YDR110W (FOB1)8.262ON5665228581e-107
Smik_4.3568.262ON5765268491e-106
Suva_2.2708.262ON6325228521e-106
ZYRO0C01650g8.262ON5863828411e-105
NDAI0J013808.262ON6243668441e-105
Skud_4.3718.262ON5805248281e-103
Kpol_392.68.262ON4573778041e-101
NCAS0B038508.262ON5883697851e-96
Kpol_543.388.262ON4423657564e-94
CAGL0B01771g8.262ON5363867313e-89
TBLA0E044308.262ON4813876438e-77
KNAG0H032408.262ON5194225411e-61
TPHA0J007408.262ON4083975201e-59
TBLA0F030708.262ON4453985091e-57
TPHA0A018108.262ON4573754854e-54
NDAI0D03010na 1ON7781411063e-04
NDAI0B06160singletonON1403129761.3
SAKL0A02904g6.278ON140864752.0
KLLA0D12694g6.278ON136764752.0
TBLA0I03100singletonON20161722.0
TPHA0A037703.325ON105482742.1
CAGL0D01694g3.338ON43273732.8
KNAG0F016406.278ON137364733.2
TDEL0E019005.435ON762321715.5
NDAI0G00550singletonON41258706.2
Kwal_56.22670singletonON67684706.8
ACR285C7.81ON1323160707.1
Kwal_23.5250singletonON90284707.5
Kwal_26.8300singletonON90284707.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17028g
         (550 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...  1149   0.0  
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   463   e-159
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   450   e-153
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   436   e-147
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   384   e-127
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   377   e-125
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   358   e-117
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   337   e-109
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   335   e-107
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   331   e-106
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   332   e-106
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   328   e-105
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   329   e-105
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   323   e-103
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   314   e-101
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   306   1e-96
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   295   4e-94
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   286   3e-89
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   252   8e-77
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   213   1e-61
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   204   1e-59
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   200   1e-57
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   191   4e-54
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    45   3e-04
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            34   1.3  
SAKL0A02904g Chr1 (263239..267465) [4227 bp, 1408 aa] {ON} simil...    33   2.0  
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    33   2.0  
TBLA0I03100 Chr9 (747292..747897) [606 bp, 201 aa] {ON}                32   2.0  
TPHA0A03770 Chr1 (825322..828486) [3165 bp, 1054 aa] {ON} Anc_3....    33   2.1  
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    33   2.8  
KNAG0F01640 Chr6 (294524..298645) [4122 bp, 1373 aa] {ON} Anc_6....    33   3.2  
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...    32   5.5  
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    32   6.2  
Kwal_56.22670 s56 complement(228050..230080) [2031 bp, 676 aa] {...    32   6.8  
ACR285C Chr3 complement(873065..877036) [3972 bp, 1323 aa] {ON} ...    32   7.1  
Kwal_23.5250 s23 complement(1075954..1078662) [2709 bp, 902 aa] ...    32   7.5  
Kwal_26.8300 s26 (729038..731746) [2709 bp, 902 aa] {ON} YGR109W...    32   7.5  

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score = 1149 bits (2972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/550 (100%), Positives = 550/550 (100%)

Query: 1   MAREIELPTNVPKSKDVCSKPTNNDYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLES 60
           MAREIELPTNVPKSKDVCSKPTNNDYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLES
Sbjct: 1   MAREIELPTNVPKSKDVCSKPTNNDYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLES 60

Query: 61  VKGQLTQAQYELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRD 120
           VKGQLTQAQYELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRD
Sbjct: 61  VKGQLTQAQYELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRD 120

Query: 121 DTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEE 180
           DTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEE
Sbjct: 121 DTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEE 180

Query: 181 VKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLT 240
           VKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLT
Sbjct: 181 VKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLT 240

Query: 241 GITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHF 300
           GITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHF
Sbjct: 241 GITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHF 300

Query: 301 YKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKK 360
           YKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKK
Sbjct: 301 YKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKK 360

Query: 361 FKLKREKIIHELFAHNVVTLKDTGGMVYVENENSVFIMEDEDLISVNQDSQESGTPMATS 420
           FKLKREKIIHELFAHNVVTLKDTGGMVYVENENSVFIMEDEDLISVNQDSQESGTPMATS
Sbjct: 361 FKLKREKIIHELFAHNVVTLKDTGGMVYVENENSVFIMEDEDLISVNQDSQESGTPMATS 420

Query: 421 GGQGVEQEMDEMPSMGLTPLKGSNGDMLHKTADSTPKVKRTSSLSRASSKRTGERASLSD 480
           GGQGVEQEMDEMPSMGLTPLKGSNGDMLHKTADSTPKVKRTSSLSRASSKRTGERASLSD
Sbjct: 421 GGQGVEQEMDEMPSMGLTPLKGSNGDMLHKTADSTPKVKRTSSLSRASSKRTGERASLSD 480

Query: 481 TITPTKKVKKVGENRSRLSGSESVEQGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTAR 540
           TITPTKKVKKVGENRSRLSGSESVEQGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTAR
Sbjct: 481 TITPTKKVKKVGENRSRLSGSESVEQGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTAR 540

Query: 541 ADENDISIEL 550
           ADENDISIEL
Sbjct: 541 ADENDISIEL 550

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  463 bits (1191), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 295/418 (70%), Gaps = 19/418 (4%)

Query: 26  YVTPKLGESQVTYSTDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLA 85
           +  PK+GE+   Y   LN ELL RG  DFIKY ESVKGQLTQ Q++L+++  LT E L++
Sbjct: 19  FRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMS 78

Query: 86  VTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLH 145
            +D L   N E K+L LKRR+YVD+D  VRD K DDT+VCEPE +++LI+ GHL N H+H
Sbjct: 79  TSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIH 138

Query: 146 WRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVE 205
           WR+LH +L+ +Y+N TR F Q+C RYCSECNP+E ++P+ KF+HTN Y GLLPLER+HVE
Sbjct: 139 WRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVE 198

Query: 206 IFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFL 265
           I  PF   +LIE  YSHVLY RDY+SRFVW+ PL      E+      FLLSLPR+PIF+
Sbjct: 199 IIAPF--PKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFV 256

Query: 266 ETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGM 325
           ET+TL RQD+F++CE IA +Y L+IGLG++ S+ F +NG+ER++YLLQ N++ C K W M
Sbjct: 257 ETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHM 316

Query: 326 CLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG- 384
           CLK+G  ++N  YN R++G   +LL + VS  G++F+LKRE++I +LFA NVV L++ G 
Sbjct: 317 CLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGR 376

Query: 385 --GMVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPL 440
             GM+Y+E+E+S F M DE+ IS   +++  G               D  P +GLTPL
Sbjct: 377 RRGMIYLEDESSAFKMPDEEYISAENETENEG--------------FDYGPMVGLTPL 420

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  450 bits (1157), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 244/533 (45%), Positives = 335/533 (62%), Gaps = 49/533 (9%)

Query: 25  DYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLL 84
           ++  P +GE    Y   LN+ELLERG  DFIKY ESVKGQLTQ Q++L+++ +LT + L+
Sbjct: 18  EFDMPAVGEPIEKYHNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLM 77

Query: 85  AVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHL 144
             +D L   N E K+L LKRRYYVD+D IVRD+K  DT+VCEPELM++LI+ GHL N HL
Sbjct: 78  TTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHL 137

Query: 145 HWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHV 204
           HWR+LH +L+  Y+N TR F Q+C +YCS+CNP+EE++P+ KF+HTN Y GLLPLER+HV
Sbjct: 138 HWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVHV 197

Query: 205 EIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIF 264
           EI  PF   E IE  YSHVL+ RDY+SRFVW+ PL G   +++   L   LL LPR+PIF
Sbjct: 198 EIISPFS--EAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIPIF 255

Query: 265 LETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWG 324
           +ET+T+DRQD+F+ CE +A +Y L IGLG++ SS F KNG+ER++YLLQ N+++C + W 
Sbjct: 256 IETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWY 315

Query: 325 MCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG 384
           MCLKYG+ ++N  YN RI+G   +LL + V   G++F+LKRE +I +LFA NVV +K +G
Sbjct: 316 MCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIKVSG 375

Query: 385 ---GMVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLK 441
              G++Y+E+E S F M DE+ IS   ++  +   +    G G    +        TPL 
Sbjct: 376 RRRGIIYLEDETSAFKMPDEEYISAENETDMNDDDL----GFGSATRL-------TTPLT 424

Query: 442 GSNGDMLHKTADSTPKVKRTSSLSRASSKRTGERASLSDTITPTKKVKKVGENRSRLSGS 501
            S G    +T + TP              RT  R       TP  +V+KV        G 
Sbjct: 425 -SPGRTPSRTPNRTP-------------GRTPGR-------TPN-EVRKV-------QGG 455

Query: 502 ESVEQGNSEANRDEYD---LSEEIPGPSTSFFATVNHSRT-ARADENDISIEL 550
           E    G      D+ D    S E+ GP+  ++   + S T   A  ND S+E+
Sbjct: 456 ELENLGAENQKVDDVDSTGTSSELSGPAQKYYPGNSRSTTYTEASNNDFSVEI 508

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  436 bits (1120), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 229/539 (42%), Positives = 334/539 (61%), Gaps = 40/539 (7%)

Query: 17  VCSKPTNNDYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTD 76
           V  K T   +  P+   +    + +L+ + L+ G  + IK + +VKGQLTQ  YELI ++
Sbjct: 26  VFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSN 85

Query: 77  TLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVS 136
           TL+ +TLL   D +     E K++ LKRRY +    +V DHKR+D  V EP+L++++I++
Sbjct: 86  TLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQGNVV-DHKREDLPVIEPDLVFDVIMA 144

Query: 137 GHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGL 196
            HL+N HL WRK+H+ LK+ Y+N+TRDF  +   YCS CN    +K F ++KH N Y  +
Sbjct: 145 AHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKV 204

Query: 197 LPLERIHVEIFKPFGTD--ELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEF 254
           +PLER HVEIF PF  D  E IE+KYSHVLYCRDYHSRFVW+ PL GITF++LVP LT+ 
Sbjct: 205 MPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQL 264

Query: 255 LLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQT 314
           L S+ RLPIFLET TLDRQDMFD+CEYIARKY+L IGLGLN+ + F +NG+ R+K L   
Sbjct: 265 LCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAE 324

Query: 315 NKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFA 374
           +K++C K+W MCL+      N  Y+ R+ G  +DLLCNE+S+   KFKLK+ KII EL+A
Sbjct: 325 HKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYA 384

Query: 375 HNVVTLKDTGGMVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPS 434
           H+VV  ++ GGM+Y+E++NS F++++++    N +   + +P   S              
Sbjct: 385 HHVVQFREAGGMIYLEDDNSAFVVDEDEHGPENDNVPVTESPSKES-------------- 430

Query: 435 MGLTPLKGSNG---DMLHKTADSTPKVKRTSSLSRASSKRTGERASLSDTITPTKKVKKV 491
                +K SN    ++L    +S+   KR     ++S ++ G +  ++         K+ 
Sbjct: 431 -----MKSSNNIADNLLEPNNNSSIPSKRVLPSEKSSIRKNGSKKKIN---------KEK 476

Query: 492 GENRSRLSGSESVEQGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTARADENDISIEL 550
             ++ ++  S  + Q     N+D  DLS EIP PS+ +F   N S + R+   D+SIEL
Sbjct: 477 VTDKGKMELSSPLSQA---GNQDFQDLS-EIPEPSSPYFR--NTSISQRSKYADVSIEL 529

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  384 bits (986), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 216/525 (41%), Positives = 318/525 (60%), Gaps = 38/525 (7%)

Query: 40  TDLNV---------ELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLAVTDGL 90
           TDLN+         E ++RG  +  K +++VKGQLTQ  Y+LI +DTL+ + LL   D +
Sbjct: 34  TDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKV 93

Query: 91  IPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLHWRKLH 150
            P+  E KY+ LKRRY V    IV D KR D  V EP+ ++++I+S HL+N+H+ WRK++
Sbjct: 94  TPNTVENKYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVY 152

Query: 151 RFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVEIFKPF 210
           + +K  Y+N+TR+   M   YCS CN    V+ F+++KH N ++ L+PLER HVE+F PF
Sbjct: 153 QHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPF 212

Query: 211 GTD--ELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFLETT 268
             +  E I+ KYSH LYCRDYHSRF+WL PL GI F+ L+P L + L ++ R+PIFLET 
Sbjct: 213 DDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETA 272

Query: 269 TLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGMCLK 328
           TLDRQDMFD+CE IAR+Y+  IGLGLN+ + F KNGI+R+K LL   K++C  DW MCL+
Sbjct: 273 TLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLR 332

Query: 329 YGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTGGMVY 388
                 N  Y  R+ G  +DLLCNE+ +   KFK K++KII +L+AH+VV  K+ GGM+Y
Sbjct: 333 LVLSRVNQTYADRVRGIPSDLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIY 392

Query: 389 VENENSVFIME--DEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNGD 446
           +E+E S F+M+  D+D   V ++      P+A+   Q     +  + S  +T  + +  D
Sbjct: 393 LEDEESAFVMDDPDDDCTPVPEEP-----PVASDSIQNSATILTPITSTQITENEVARQD 447

Query: 447 MLHKTADSTPKVKRTSSLS-RASSKRTGERASLSDTITPTKKVKKVGENRSRLSGSESVE 505
                 +  P  +   SLS R SS+           ++  +K +K+ +   + + S S  
Sbjct: 448 --PDQLEIRPPSQNNESLSDRVSSEEP--------PVSKERKKRKISKRALKTASSPSPN 497

Query: 506 QGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTARADENDISIEL 550
                   +EY  + E+ GP +SFF  ++ S+  R    D+S+EL
Sbjct: 498 VN------EEYYNNSELAGPGSSFFKNISTSQEPRY--GDVSLEL 534

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  377 bits (967), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 182/370 (49%), Positives = 255/370 (68%), Gaps = 5/370 (1%)

Query: 26  YVTPKLGESQVTYSTD-LNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLL 84
           ++ P +GES   Y+   +N+ELLERG +D +KY ES+ GQ+    YELI+T++LT ETL 
Sbjct: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLA 98

Query: 85  AVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHL 144
           + +D     +AE+KY+FL RRYY + + IVRD ++ D IVCEP  +++LI+  HL+N+H+
Sbjct: 99  SNSDKWDKDSAESKYMFLMRRYYAE-NGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157

Query: 145 HWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHV 204
            +R ++  L   YSNITRDFVQM  RYCS CNP    +P  K++H N ++GLLPLER+H+
Sbjct: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217

Query: 205 EIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIF 264
           EIF+ F  +E I  K+++VLYCRDYH+RFVWL+PL    F+ LV  +   LL +  +PIF
Sbjct: 218 EIFEVFD-NESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIF 276

Query: 265 LETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWG 324
           +E++TLD+QD+FD+CE +  KY + +GLG N+SS F+ NGI+RMK LL T K  C  DW 
Sbjct: 277 MESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWN 336

Query: 325 MCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG 384
           MCL+YG YH N  +N    G  NDLL +   +  K F+ K+E II EL A NVV +    
Sbjct: 337 MCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHV--NK 394

Query: 385 GMVYVENENS 394
           G++Y+E+ENS
Sbjct: 395 GLLYLEDENS 404

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  358 bits (919), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 167/366 (45%), Positives = 244/366 (66%), Gaps = 4/366 (1%)

Query: 26  YVTPKLGESQVTYSTD-LNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLL 84
           Y+ P++GES  +Y+   +N+ELL+RG R+  K+ +S+ G LT+  Y+LI+TD+LT ETL 
Sbjct: 47  YIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLA 106

Query: 85  AVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHL 144
           +         AE +YLFLKRRYY D++ ++ DH R D IVCEP  ++++I+  HL+NNH 
Sbjct: 107 STNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHG 166

Query: 145 HWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHV 204
             +K+H  L + YSNITRD      ++CS CNP++++    KFKH N Y  L+PLER+H+
Sbjct: 167 FVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHI 226

Query: 205 EIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIF 264
           EIF+PF  +E IE+KYSH+LYCRDYHSR++W+ PL    F+ LVP +    LS  R PIF
Sbjct: 227 EIFEPF-PNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIF 285

Query: 265 LETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWG 324
           +ET +LD QDMFD+CE IA +Y L IGLG +  + F+  GI +MK  L+ ++++C   W 
Sbjct: 286 IETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWN 345

Query: 325 MCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG 384
           +CLKYGSY +N  +N R  G   DLL +++  C  KFK K  +I+    + +V  L+   
Sbjct: 346 LCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESV--LRVDN 403

Query: 385 GMVYVE 390
           G++++E
Sbjct: 404 GLIFLE 409

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  337 bits (863), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 174/411 (42%), Positives = 255/411 (62%), Gaps = 15/411 (3%)

Query: 12  PKSKDVCSKPTNNDYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLESVKGQLTQAQYE 71
           P S    S   +  +V P  G    ++  +L+ ++L  G     K + +VKGQLTQ  Y+
Sbjct: 43  PASASTESTEPDFKFVLPVKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYD 102

Query: 72  LIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMY 131
           L+ +D LT E LL  +D +  S  E K++ LKRRYYV  + ++ D KR D +V EP  ++
Sbjct: 103 LLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYV-QENLLHDVKRKDLVVYEPNELF 161

Query: 132 ELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTN 191
           +LI+S H+LN+H+  + ++  L + Y+N+T+ F ++   +CS+CN       + KFKH N
Sbjct: 162 DLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHEN 221

Query: 192 AYQGLLPLERIHVEIFKPF--------GTDEL-IEEKYSHVLYCRDYHSRFVWLSPLTGI 242
            +  L+PL R HVEIF PF         TDEL IE KY  VLYCRDY+SR+VWL PL  +
Sbjct: 222 IHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSV 281

Query: 243 TFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYK 302
           T  +L+P +T+ L S+ R+PIF++T TLDRQDMFD+CE IAR Y++ IGLG+N+S+ F K
Sbjct: 282 TLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQK 341

Query: 303 NGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFK 362
            GI+RMK L   +K++C  DW MCLK      N  Y+ R+ G  +DLLC+      KKF+
Sbjct: 342 TGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFR 401

Query: 363 LKREKIIHELFAHNVVTLKDTGGMVYVENENSVFIMEDEDLISVNQDSQES 413
             +  +I  L  H+VV  ++ GGM+Y+E+ENS  +     L+S + +S+ES
Sbjct: 402 TLQRNVISRLLGHHVVQFEEAGGMIYLEDENSPNL-----LLSGDDNSEES 447

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  335 bits (858), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/522 (36%), Positives = 290/522 (55%), Gaps = 31/522 (5%)

Query: 27  VTPKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLA 85
           + P +GES   Y  + LN+ELLERG R+   +LES+  QLTQ  YELIKT +LT +TL  
Sbjct: 47  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 106

Query: 86  VTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLH 145
           ++D      AE K LFL+R+YYVD +  VRD + +D I CEP+ +Y+++++ HL+N HL 
Sbjct: 107 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLR 166

Query: 146 WRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVE 205
            + LH FL S ++NI+   +    ++CS+CN + ++KP  ++K  + Y  LLP+ERIH+E
Sbjct: 167 GKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 226

Query: 206 IFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFL 265
           +F+PF   E IE KYS+VL CRDY S F+WL PL    F+ L+P ++   L+  R+PIF+
Sbjct: 227 VFEPFNG-EAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFV 285

Query: 266 ETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGM 325
            ++TLD+ D++D+CE IA KY L IGLGL +S+ F+  GI  ++Y L + KK+C  DWG 
Sbjct: 286 TSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGK 345

Query: 326 CLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTGG 385
           CL+YG Y  N   N R       +L +EV     KF+ KRE++I   ++ N+  +    G
Sbjct: 346 CLRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKG 405

Query: 386 MVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNG 445
           ++Y+E+ N+  +  + D    N  +          G    E+E+ +   +          
Sbjct: 406 LIYLEDVNTFALANEAD----NSCNNNGILHNNNIGNDNFEEEVQKQFDLTEKNYIDEYD 461

Query: 446 DMLHKTADS-------TPKVKRTSSLSRASSKRTGERASLSDTITPTKKVKKVGENRSRL 498
           D+ H +++        TP+ K   ++     + TG  A +  T  P K  +K  +  S++
Sbjct: 462 DLAHDSSEGEFEPNTLTPEEKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKESDGASQV 521

Query: 499 SGSESVEQGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTAR 540
                             D S EI  P TS++ T+    T R
Sbjct: 522 ------------------DQSVEITRPETSYYQTLESPSTKR 545

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  331 bits (849), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/526 (36%), Positives = 290/526 (55%), Gaps = 31/526 (5%)

Query: 27  VTPKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLA 85
           + P +GES   Y  + LN+ELLERG R+   +LES+  QLTQ  YELIKT +LT +TL  
Sbjct: 49  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 108

Query: 86  VTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLH 145
           ++D      AE K LFL+R+YYVD +  VRD + +D I CEP  +Y+++++ HL+N HL 
Sbjct: 109 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168

Query: 146 WRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVE 205
            + LH FL S ++NI+   +    ++CS+CN + ++KP  ++K  + Y  LLP+ERIH+E
Sbjct: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 228

Query: 206 IFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFL 265
           +F+PF + E IE KYS+VL CRDY S F+WL PL    F+ L+P ++   LS  R+PIF+
Sbjct: 229 VFEPF-SGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFV 287

Query: 266 ETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGM 325
            ++TLD+ D++D+CE IA KY L IGLGL +S+ F+  GI  + Y L + K++C  DWG 
Sbjct: 288 TSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGK 347

Query: 326 CLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTGG 385
           CL+YG Y  N   N R       +L +E+     KF+ KRE++I   ++ N+       G
Sbjct: 348 CLRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKG 407

Query: 386 MVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNG 445
           ++Y+E+ N+  +    D    N  S  +            E+E+ +   +          
Sbjct: 408 LIYLEDVNTFALANKADNSYNNGSSHNNDV-----DNDNFEEEVQKQFDLTEQNYIDEYD 462

Query: 446 DMLHKTADS-------TPKVKRTSSLSRASSKRTGERASLSDTITPTKKVKKVGEN-RSR 497
           D+ H++++        TP+ K T             R    + I     V ++ EN R  
Sbjct: 463 DLAHESSEGEFGPSTLTPEEKNT-------------RIDEEERIGSASGVAQLNENTRQE 509

Query: 498 LSGSESVEQGNSEA---NRDEYDLSEEIPGPSTSFFATVNHSRTAR 540
           +   E   Q +++A      E D S EI  P TS+F T+    T R
Sbjct: 510 IGELEKKHQKDADATPQTEPEVDQSLEIAKPETSYFQTMESPSTKR 555

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  332 bits (852), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/522 (35%), Positives = 294/522 (56%), Gaps = 18/522 (3%)

Query: 27  VTPKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLA 85
           + P +GES   Y  + LN+ELLERG R+   +LES+  QLTQ  YELIKT +LT ETL  
Sbjct: 100 ILPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQ 159

Query: 86  VTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLH 145
           ++D      AE K LFL+R+YYVD++  VRD + +D I CEP+ +Y+++++ HL+N HL 
Sbjct: 160 ISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLR 219

Query: 146 WRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVE 205
            + LH FL S ++N +   +    ++CS+CN + ++KP  ++K  + Y  LLP+ERIH+E
Sbjct: 220 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 279

Query: 206 IFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFL 265
           +F+P+G  + IE KY +VL CRDY S F+WL PL    F+ L+P ++   LS  R+PIF+
Sbjct: 280 VFEPYG-GKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFV 338

Query: 266 ETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGM 325
            ++TLD+ D++D+CE IA KY L IGLGL +S+ F+  GI  ++Y L + K++C  DWG 
Sbjct: 339 TSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGK 398

Query: 326 CLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTGG 385
           CL+YG Y  N   N R       +L +EV     KF+ KRE++I   +A N+ T+    G
Sbjct: 399 CLRYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKG 458

Query: 386 MVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNG 445
           ++Y+E+ N+  ++ + +       +          G    E+E+ +   +          
Sbjct: 459 LIYLEDVNTFALVNEGE-----SSNNNENLNNTNIGNDNFEEEVQKQFDLTEQNYIDEYD 513

Query: 446 DMLHKTADS-------TPKVKRTSSLSRASSKRTGERASLSDTITPTKKVKKVGENRSRL 498
           D+ H +++        TP+   + ++     + T E   L D  T  ++ +    N + +
Sbjct: 514 DLAHDSSEGEYEPSTLTPEENTSHNVEEERIESTSETTDL-DGNTKEERDESEERNLNSV 572

Query: 499 SGSESVEQGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTAR 540
               +V    +EAN D    S EI  P TS++ T     T R
Sbjct: 573 EAVNAVTAPQTEANGDR---SVEITSPETSYYQTEELPSTKR 611

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  328 bits (841), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 164/382 (42%), Positives = 242/382 (63%), Gaps = 6/382 (1%)

Query: 12  PKSKDVCSKPTNNDYVTPKLGESQVT-YSTDLNVELLERGGRDFIKYLESVKGQLTQAQY 70
           PK K V  K  N +++ P + +  V+     +N+ LLE+G  + +++  +V GQLTQ  Y
Sbjct: 24  PKRKKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIY 83

Query: 71  ELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYV-DSDQIVRDHKRDDTIVCEPEL 129
           ELI++DTL++  L         S +E +Y +L+ RY+V + + +V D KRDD IVCEP  
Sbjct: 84  ELIRSDTLSIANLERCHKWKGES-SEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPAS 142

Query: 130 MYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKH 189
           M+ L++  HL NNH+    +HR L   Y+NITRD++     YCS+CNP  + KPF K +H
Sbjct: 143 MFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRH 202

Query: 190 TNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVP 249
            N Y  LLPLER+H+E+F+PF   E I+ ++SH+LY RDY SR+VW+ PL     + ++ 
Sbjct: 203 KNVYWELLPLERVHIEVFEPFDG-EKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIR 261

Query: 250 QLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMK 309
            ++ FLL LPR+PIFLE+TT+DR+ +FD+C  IA  Y L +GLG+ NS  F+ NGI+ MK
Sbjct: 262 AMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMK 321

Query: 310 YLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKII 369
            LL ++K++C +DW +CLKYG +H N   N    G   DLL   V  C +KF  KR  +I
Sbjct: 322 ELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVI 381

Query: 370 HELFAHNVVTLKDTGGMVYVEN 391
            +  +  VV L +  G++++EN
Sbjct: 382 LDTPSQQVVHLGE--GVLFLEN 401

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  329 bits (844), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 235/366 (64%), Gaps = 7/366 (1%)

Query: 26  YVTPKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLL 84
           Y+ P +GES + Y   +++V+LL+RG   F+ +  S+ GQL +  YELI+T +LT ETL 
Sbjct: 91  YLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA 150

Query: 85  AVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHL 144
           A        +A  +    KRRY  D++  VRD  R + IVC+P L+YE++++ HL+N+H 
Sbjct: 151 A---NFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHA 207

Query: 145 HWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHV 204
            +R+ H  L S Y+NITRDF+    ++CS CNP + V P  KFKH N Y+G+LPLER+H+
Sbjct: 208 QYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHI 267

Query: 205 EIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIF 264
           EIF+PF   + IE KYSHV+YCRDY SR++ L PL    F+ LV  + + L +LPR+PIF
Sbjct: 268 EIFEPFNGKK-IEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIF 326

Query: 265 LETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWG 324
           +ET +L+ QD FD+ E I  KYQ+ +GLG+  +  F+  G+++MK LL+ ++K+C  DW 
Sbjct: 327 IETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWT 386

Query: 325 MCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG 384
           MCLKYG ++ NT +N R  G   DLL   V     K   K E+II  L   N+V + +  
Sbjct: 387 MCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGN-- 444

Query: 385 GMVYVE 390
           G +Y+E
Sbjct: 445 GSIYLE 450

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  323 bits (828), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/524 (35%), Positives = 291/524 (55%), Gaps = 16/524 (3%)

Query: 27  VTPKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLA 85
           + P +GES   Y  + LN+ELLERG R+   +LES+  QLTQ  YELIKT +LT +TL  
Sbjct: 50  ILPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQ 109

Query: 86  VTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLH 145
           ++D      AE K LFL+R+YYVD++  VRD + +D I CEP+ +Y+++++ HL+N HL 
Sbjct: 110 ISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLR 169

Query: 146 WRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVE 205
            + LH FL S ++N +   +    ++CS+CN + ++KP  ++K  + Y  LLP+ERIH+E
Sbjct: 170 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 229

Query: 206 IFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFL 265
           +F+PF T   IE KY +VL CRDY S F+WL PL    F+ L+P ++   LS  R+PIF+
Sbjct: 230 VFEPF-TGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFV 288

Query: 266 ETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGM 325
            ++TLD+ D++D+CE IA KY L IGLGL +S+ F+  GI  ++Y L + K++C  DWG 
Sbjct: 289 TSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGK 348

Query: 326 CLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTGG 385
           CL+YG Y  N   N R       +L +EV     KF+ KRE++I   ++ N+  +    G
Sbjct: 349 CLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKG 408

Query: 386 MVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNG 445
           ++Y+E+ N+  +       + N  +     P    G    E+E+ +   +          
Sbjct: 409 LIYLEDVNTFALAN----EAENNGNNNRNHPDNNFGNDDFEEEVQKQFDLTEQNYIDEYD 464

Query: 446 DMLHKTADSTPKVKRTSSLSRAS----SKRTGERASLSDTITPTKK-VKKVGENRSRLSG 500
           D+ H +++   +    +   +AS     KR G  +  +D    TK+ V +  E    +  
Sbjct: 465 DLAHDSSEGEFEPNTLTPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHNIEE 524

Query: 501 SESVEQGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTARADEN 544
           ++   Q + +      D S EI  P TS++ T       R   N
Sbjct: 525 TDGTRQADPQV-----DQSVEITRPDTSYYQTAASPSIKRQKLN 563

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  314 bits (804), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 157/377 (41%), Positives = 234/377 (62%), Gaps = 4/377 (1%)

Query: 40  TDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLAVTDGLIPSNAEAKY 99
           + LN EL  RG +D  K+  ++ G L+Q  Y+LI TD LT + + +       + +  KY
Sbjct: 75  SGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKV-SREKVKWANKSNEKY 133

Query: 100 LFLKRRYYV-DSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYS 158
            FLK RYYV D    VRD + DD I+C P  + E+++  HL+N H   + +HR L  +Y+
Sbjct: 134 YFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYA 193

Query: 159 NITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEE 218
           NI+R   ++   YCS CNP E VKP  K K    Y+GLLP ERIH+EIFKPFG ++LIE 
Sbjct: 194 NISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEG 253

Query: 219 KYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDM 278
            YSH+LY RDY+SR+VWL PL    F+EL   L  +  ++ + PI++E++T++R D+  M
Sbjct: 254 TYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAM 313

Query: 279 CEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAY 338
            + IA KY L IG+G+ NSS+F+ NG+E MK LL  ++ +C  DWGMCLKYG   +N   
Sbjct: 314 VQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLK 373

Query: 339 NPRIMGFSNDLLCNE-VSSCGKKFKLKREKIIHELFAHNVVTLKDTGGMVYVE-NENSVF 396
           N +++G   +LL N  +S C  K+K K+  +I E F HN++ L +    +Y+E N  S  
Sbjct: 374 NRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDNLTSTP 433

Query: 397 IMEDEDLISVNQDSQES 413
           +++++++  V  +  E+
Sbjct: 434 VIDEKNIEPVGYEYYEN 450

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  306 bits (785), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 228/369 (61%), Gaps = 4/369 (1%)

Query: 26  YVTPKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLL 84
           Y+ P +GE    Y   D+++  ++RG R+F ++ +++ GQL ++ YELIKT++LT ETL 
Sbjct: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141

Query: 85  AVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHL 144
           A    +    A ++ +FL RRY +D    VRD  R + +VCEP  +Y++I++ HL+N+H 
Sbjct: 142 ATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201

Query: 145 HWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHV 204
             RK H+ L   YSNITR FV+   ++CS CNP +E  PF K+KH N ++GLLPLER+ V
Sbjct: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261

Query: 205 EIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIF 264
           E+F+PF  ++L   KY  +LY RDY SRF+W+ PL    F  LV  +++ + S+ R+PIF
Sbjct: 262 EVFEPFPGEKL-GGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIF 320

Query: 265 LETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWG 324
            ETTT++ QD FD+ E I  KYQ+ IGLG         NG+ +++ LL  +K++C  DW 
Sbjct: 321 FETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWI 380

Query: 325 MCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG 384
           MCLKYG +  N   N R  G   DLL  ++     K   K E+I+ +L   N+V +    
Sbjct: 381 MCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GR 438

Query: 385 GMVYVENEN 393
           G +Y+E+ N
Sbjct: 439 GCIYLEDRN 447

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  295 bits (756), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 224/365 (61%), Gaps = 3/365 (0%)

Query: 29  PKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLAVT 87
           PK+G +   Y  +  +V  LE G     +YL+S+ G L+Q  YELI+ D L ++TL   T
Sbjct: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT 105

Query: 88  DGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLHWR 147
                 NA AK L+LKRRY +     V D  R++ IV EP+L Y+ I+S H+LN HL ++
Sbjct: 106 -RWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164

Query: 148 KLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVEIF 207
            +H+ LK+ YSN++RD+++M   +CS CNP + +    K  H N Y+  LPLER+ ++IF
Sbjct: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224

Query: 208 KPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFLET 267
           +PF  +E I+ +YSH++Y RDY SRFVW+ PL    F+ L  ++   LL LPR+PI+++T
Sbjct: 225 EPF-ENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDT 283

Query: 268 TTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGMCL 327
           TT++R+DM  +C+ IA KY++++G+G    S FY  G+ R+K LL  NK KC KDW MCL
Sbjct: 284 TTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCL 343

Query: 328 KYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTGGMV 387
           K GSY+ N        G  ++L  +E+      F+ KR +II+ L   N        G+V
Sbjct: 344 KLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLV 403

Query: 388 YVENE 392
           Y ++E
Sbjct: 404 YAQDE 408

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  286 bits (731), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 146/386 (37%), Positives = 222/386 (57%), Gaps = 18/386 (4%)

Query: 24  NDYVTPKLGESQVTY----STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLT 79
           N +V P L E+   Y     + ++V+ L+RG +D  ++ E + G+LTQ  Y L+  + LT
Sbjct: 58  NKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLT 117

Query: 80  LETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHL 139
           +ET++   +   P+ AE KY  L +R+Y D +  +RD K D+ IV EP+ ++ LI++ HL
Sbjct: 118 METVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHL 177

Query: 140 LNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPL 199
            N HL    L + L+  Y+N TRDFVQ    YC+ CNP   +KP  K +H N  + LLPL
Sbjct: 178 KNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPL 237

Query: 200 ERIHVEIFKPFGTDE-------------LIEEKYSHVLYCRDYHSRFVWLSPLTGITFQE 246
           ER+H+E+F PF  +E              IE KYSHV YCRD+ +R+VW  PL  + F+ 
Sbjct: 238 ERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKT 297

Query: 247 LVPQLTEFLLS-LPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGI 305
           LV  +  F ++ L   PIF+E++T+DR D+ ++ E +A KY L +GLG  N + F+  GI
Sbjct: 298 LVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGI 357

Query: 306 ERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKR 365
           +R K  L   K +CA DW MCLK G+Y  N     ++   SN L    +    +  + K+
Sbjct: 358 KRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKK 417

Query: 366 EKIIHELFAHNVVTLKDTGGMVYVEN 391
            K I + F+ N+ T   +GG +++E+
Sbjct: 418 LKYIEQSFSENIKTYPKSGGCIFIEH 443

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  252 bits (643), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 145/387 (37%), Positives = 223/387 (57%), Gaps = 32/387 (8%)

Query: 29  PK-LGESQVTY----STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETL 83
           PK LG S   Y    ++++N+ELLE+G +D  +Y       LTQ   +++ T TL+ E +
Sbjct: 32  PKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENI 91

Query: 84  LAVTDGLIP-SNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNN 142
           +     L   S A  KY F  RRYY++ D  + D ++   I+CEP+ MY+++++ HL   
Sbjct: 92  IKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--- 148

Query: 143 HLHWRKLH------RFLKSQYSNITRDFVQMCARYCSECNPQE--EVKPFTK---FKHTN 191
                KLH        LK  +SN+ R ++  CA+YCS+C P E   +K FT    FK+  
Sbjct: 149 -----KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIR 203

Query: 192 AY---QGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELV 248
                + L P+ERIH+EIF PF  D  IE KY  +LY RDY +R++W   L  +  + + 
Sbjct: 204 NNIIDRPLFPMERIHIEIFNPFD-DLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHIT 262

Query: 249 PQLTEFLLSLP-RLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNS-SHFYKNGIE 306
             LTEF LS+   +PIFL+++T+D  D+FD+CE I+R+Y +++GLG NN   HF+ +GIE
Sbjct: 263 NILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIE 322

Query: 307 RMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLL-CNEVSSCGKKFKLKR 365
             K L+  NK KC K W   L +GS  +N  +N RI+    D++ CN ++   KKF+ +R
Sbjct: 323 MFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRR 382

Query: 366 EKIIHELFAHNVVTLKDTGGMVYVENE 392
            +II +    N V L +   ++++E+E
Sbjct: 383 LRIIKQTITDNYVKLGNVASIIFIEDE 409

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  213 bits (541), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 132/422 (31%), Positives = 224/422 (53%), Gaps = 21/422 (4%)

Query: 24  NDYVTPKLGESQVTYSTD-LNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLET 82
           N  + P +G+    Y+ + L++E  +RG RD   Y  +  G+++Q  Y L K D +T E 
Sbjct: 32  NPKLVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKEN 91

Query: 83  LLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNN 142
           +  +       +   K +++ RRYY D++ ++RD   ++ IV +P   +++I+S HL+N 
Sbjct: 92  IARLYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNK 151

Query: 143 HLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERI 202
           HL   +++R L+  Y+N     ++    YCS CNP  ++ P  + K    ++  LPLERI
Sbjct: 152 HLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPK-PYLFEKALPLERI 210

Query: 203 HVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLP 262
            +EI +PF  +E +E KYS+++  +D+  RF WL PL    F+ +VP + + +LS PR+P
Sbjct: 211 TIEIIEPF-PNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVP 269

Query: 263 IFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKD 322
           I++E+ TLD  D+FD+ E I  KY + IGLG    S   +    R+   L  +  +C  D
Sbjct: 270 IWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQ-ATARINRDLNDHHDECLFD 328

Query: 323 WGMCLKYGSYHNNTAYNP-RIMGFSN---DLLCNEVSSCGKKFKLKREKIIHELFAHNVV 378
           +  CLKYG     T YN  + +GF     D++ +  +    KF+ KR  I+    + +  
Sbjct: 329 FNNCLKYGP----TKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKH--SPSSC 382

Query: 379 TLKDTGGMVYVENENSVFIMED-----EDLISVNQDSQESGTPMATSGGQGVEQEMDEMP 433
            +    G +Y+E+ N   I ED      D +S  +D+++     +T  G G  +E D  P
Sbjct: 383 VMNRGMGTLYLESPNG--IQEDAAASSADELSSAKDAEDEERDNSTREGSGNGEESDTEP 440

Query: 434 SM 435
           ++
Sbjct: 441 AV 442

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  204 bits (520), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 125/397 (31%), Positives = 203/397 (51%), Gaps = 14/397 (3%)

Query: 11  VPKSKDVCSKPTNNDYVTPKLGESQVTYS----TDLNVELLERGGRDFIKYLESVKGQ-L 65
           + +  D+     N+  +   + E  + Y     +D+++E +  G  D ++ LESV    L
Sbjct: 4   LKRKHDMIDDSNNDRIIKVDIPELDILYKIELGSDIDIERINHGRNDHLQ-LESVFSSFL 62

Query: 66  TQAQYELIKTDTLTLETLLAV-----TD-GLIPSNAEAKYLFLKRRYYVDSDQIVRDHKR 119
           TQ  Y LI+      ET         TD G     A  K++ ++ RY ++    + D + 
Sbjct: 63  TQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRN 122

Query: 120 DDTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQE 179
           D  ++  P  +Y+LI+  H LN+HL   K+H  L+ +YSNI+R  V++  + CS CNP+ 
Sbjct: 123 DYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKS 182

Query: 180 EVKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPL 239
             K     +H +  +     E+IHVEIF+PF   +    K+SHV+Y RDY +R+VWL PL
Sbjct: 183 TYKHIEYTRHFSCDKNF-AFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPL 241

Query: 240 TGITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSH 299
             I+ +EL   L   LL   R+PI++E+ TLD  ++  + + I++   L +G+G      
Sbjct: 242 EKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDE 301

Query: 300 FYKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGK 359
           F  +GI  MK L   N++ C  +W   +     H NT YN  I G   +L+  E  +  K
Sbjct: 302 FQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNK 361

Query: 360 KFKLKREKIIHELFAHNVVTLKDTGGMVYVEN-ENSV 395
            +K KR++ I    + N + LK+    +Y E+ ENS+
Sbjct: 362 TYKKKRQRTILLTLSKNTILLKNGKSALYKESTENSI 398

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  200 bits (509), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 117/398 (29%), Positives = 225/398 (56%), Gaps = 18/398 (4%)

Query: 24  NDYVTPKLGES-QVTYSTDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLET 82
           +D+  P +G+  ++ Y + ++ ++L+RG ++ +++  ++K  +T   Y  ++ ++L  + 
Sbjct: 26  DDFFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLED- 84

Query: 83  LLAVTDGLIPSNAE---AKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHL 139
                D  IP++ +   +K ++L+ RY  +SD  + + K +  ++CEP+ +Y+L +  H 
Sbjct: 85  -----DAPIPASLKIKTSKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHF 138

Query: 140 LNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPF-TKFKHTNAYQGLLP 198
           +NNH+   KL+R L  +Y NI    V +  +YCS CN   +++   + +   N Y   LP
Sbjct: 139 MNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLP 198

Query: 199 LERIHVEIFKPFGTDEL-IEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLS 257
           LER+ ++I KPF   ++ I  KYSH+L  RDYHSR+ W+ PL     + +  +L +FL++
Sbjct: 199 LERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVT 258

Query: 258 LPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSH--FYKNGIERMKYL--LQ 313
           LPR PIFL +  +    +  +   I  +Y++ I +G+       F + GI R+ YL  L+
Sbjct: 259 LPRTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLK 318

Query: 314 TNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELF 373
            NK+KC  DW  C++  ++  N  ++     F+N L+  + +   K F+ KR+ ++ +L 
Sbjct: 319 ENKEKCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLL 378

Query: 374 AHNVVTLKDTGGMVYVENENSVFIMEDEDLI-SVNQDS 410
             NV+ + + G ++Y +N NS   ++++D+   VN++S
Sbjct: 379 EENVLKIGECGSIIYFDNNNSGKELDEKDVNGGVNENS 416

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  191 bits (485), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 112/375 (29%), Positives = 207/375 (55%), Gaps = 9/375 (2%)

Query: 22  TNNDYVTPKLGESQVTYSTDL-NVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTL 80
            N  Y+ P++G+   +  T L + +LL++G    I    S    L++  Y+L+K D LT 
Sbjct: 27  ANIKYIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTR 83

Query: 81  ETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLL 140
           + + AV   L   NA  + + LK RYY DS  +V D  + + IV +P   + ++++ HLL
Sbjct: 84  KNV-AVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLL 142

Query: 141 NNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLE 200
           N+HL    ++R L   ++N++  F++    YCS CN  ++     K    +    +L  E
Sbjct: 143 NDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYE 202

Query: 201 RIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPR 260
           R+ +++  PFG  + I+++Y+H+L   D+H++F+W  PL  +  + ++ ++TEF+++LP 
Sbjct: 203 RLILDVVAPFGAKK-IQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPV 261

Query: 261 LPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCA 320
            P+F+ + TL   D+F++C Y+AR+Y ++IGLG  N    Y      +  +L ++K +C 
Sbjct: 262 KPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN-PYVTRILNSHKTECL 320

Query: 321 KDWGMCLKY-GSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVT 379
           K W MCLK+     +N+ ++ R     N  L + ++   KK++ + + II  L + N + 
Sbjct: 321 KSWFMCLKWLADRQSNSKFDIRPPN-KNYGLFSGMTDFLKKYEERSKMIIGRLPSENFIN 379

Query: 380 LKDTGGMVYVENENS 394
           + +    +Y E+E S
Sbjct: 380 IDEGSHFIYSEDEFS 394

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 56/141 (39%), Gaps = 22/141 (15%)

Query: 117 HKRDDTIVCEPELMYELIVSGH--------LLNNHLHWRKLHRFLKSQYSNITRDFVQMC 168
           H +   I C P L++ +I   H         L  H    ++   L ++Y NI++  +   
Sbjct: 148 HNKKKLIWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDV 207

Query: 169 ARYCSECNPQEEVKPFTKFKHTNAYQGLLPL-----ERIHVEIFKPFGTDELIEEK---Y 220
              C +C      KP +  K       +LPL     +R+ V+I        +  +     
Sbjct: 208 VAACPDC------KPLSSKKFNITRVNVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTK 261

Query: 221 SHVLYCRDYHSRFVWLSPLTG 241
           + +LY  DYHS  VWL  L G
Sbjct: 262 NAILYIGDYHSGAVWLFALDG 282

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 16/129 (12%)

Query: 138 HLLNNHLHWRKLHRFLKSQYSNITR----DFVQMCARYCSECNPQEEVK----PFTKFKH 189
           H L  H++ + + + ++S+     R    D+  +    C +C   +  K      ++ K+
Sbjct: 310 HRLFGHINVKDIRKSIESKLITNIRINDVDWSGIDKFQCKDCLAGKITKHKHIVGSRLKY 369

Query: 190 TNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVP 249
             +Y+   P E IH ++F P    ++   KY   +   D ++RF W+ PL       ++P
Sbjct: 370 QKSYE---PFEYIHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKKKDADHILP 424

Query: 250 ---QLTEFL 255
              QL  ++
Sbjct: 425 IFQQLVNYI 433

>SAKL0A02904g Chr1 (263239..267465) [4227 bp, 1408 aa] {ON} similar
           to uniprot|P35187 Saccharomyces cerevisiae YMR190C SGS1
           Nucleolar DNA helicase of the RecQ family, involved in
           maintenance of genome integrity
          Length = 1408

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 257 SLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNK 316
           S  R  +F E     +  +F+MC+ I  K++   G+   +S    KN  E+   L+Q N 
Sbjct: 816 SFNRTNLFYEILKKGKNSIFEMCDTIKSKFRNKTGIIYCHS----KNSCEQTAALMQRNG 871

Query: 317 KKCA 320
            KCA
Sbjct: 872 VKCA 875

>KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON}
           similar to uniprot|P35187 Saccharomyces cerevisiae
           YMR190C SGS1 Nucleolar DNA helicase of the RecQ family,
           involved in maintenance of genome integrity
          Length = 1367

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 257 SLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNK 316
           S  R  +F +    ++  +F MC+ I  K++   G+   +S    KN  E+   L+Q N 
Sbjct: 786 SFNRTNLFYQVLKKEKNSIFQMCDMIRTKFKNQTGIIYCHS----KNSCEQTSALMQKNG 841

Query: 317 KKCA 320
            KCA
Sbjct: 842 VKCA 845

>TBLA0I03100 Chr9 (747292..747897) [606 bp, 201 aa] {ON} 
          Length = 201

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 11/61 (18%)

Query: 382 DTGGMVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLK 441
           D  G +YVEN NS FI  +ED          + + +   G + + + + EMP+  L  L+
Sbjct: 48  DDKGEIYVENLNS-FISSNED----------NASILIAPGYENIPEHVSEMPNTTLASLQ 96

Query: 442 G 442
           G
Sbjct: 97  G 97

>TPHA0A03770 Chr1 (825322..828486) [3165 bp, 1054 aa] {ON} Anc_3.325
            YBL037W
          Length = 1054

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 10/82 (12%)

Query: 467  ASSKRTGERAS---LSDTITPTKKVK----KVGE---NRSRLSGSESVEQGNSEANRDEY 516
             +SK+   R+S   LSD ++  ++++    K GE   N   L G++++E   +  NR  +
Sbjct: 923  TASKQINGRSSILTLSDFVSRWRQLRENMDKEGECQLNHLILKGTKNIETVKNVLNRIGF 982

Query: 517  DLSEEIPGPSTSFFATVNHSRT 538
            D+ ++   PST F +T+ H+++
Sbjct: 983  DIVDQTNIPSTIFLSTIIHTKS 1004

>CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {ON}
           similar to uniprot|P41808 Saccharomyces cerevisiae
           YPR054w SMK1 sporulation-specific MAP kinase or
           uniprot|Q00772 Saccharomyces cerevisiae YHR030c SLT2
           ser/thr
          Length = 432

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 435 MGLTPLKGSNGDMLHKTADSTPKVKRTSSLSRASSKRTGERASLSDTITPTKKVKKVGEN 494
           MGL+ + GSN ++++K   S     + SS    +SKR  + A +    T  K  + + +N
Sbjct: 1   MGLSKILGSNDNIVNKNGSSNTGGSKKSSFFSLNSKRNTDAAGIVPDFTSIKAPRTIYKN 60

Query: 495 RS-RLSGSESVEQ 506
            +  +SG   + Q
Sbjct: 61  ANFSISGKYEIIQ 73

>KNAG0F01640 Chr6 (294524..298645) [4122 bp, 1373 aa] {ON} Anc_6.278
           YMR190C
          Length = 1373

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 257 SLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNK 316
           S  R  +F E     +  ++++C+ I RK++   G+   +S    KN  E+    LQ N+
Sbjct: 812 SFNRTNLFYEVKKKSKNTIYEICDEIKRKFRNQTGIIYCHS----KNSCEQTATQLQRNR 867

Query: 317 KKCA 320
            KCA
Sbjct: 868 IKCA 871

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 129/321 (40%), Gaps = 36/321 (11%)

Query: 246 ELVPQLTEFLLSLPRLPIFLETTTLD-RQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNG 304
           +L  QL++F+ +L  + I ++  T+D R     + + I   Y+   GL +N +       
Sbjct: 117 DLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGL-INGAVIRNSQF 175

Query: 305 IERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLK 364
           +  +  +L        + W   ++  SY          M + N+L  +EV   G KF L 
Sbjct: 176 LVEVTNILSKPTTTFEESWDSLIQNESY----------MLYPNNLGPHEVILKGYKFYLI 225

Query: 365 REKIIHELFAHNVVTLKDTGGMVYVEN----------ENS---VFIMEDEDLISVNQDSQ 411
              +I   +    +  +  G ++ VEN          ENS   + +++ E+   +  D  
Sbjct: 226 ASDVITMAYVQEALE-RGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKI 284

Query: 412 ESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNGDMLHKTADSTPKVKRTSSLSRASSKR 471
           +  T +       V     +    G+ P++   GD++     +  K + +SS S ++ + 
Sbjct: 285 KLHTLVDLVNA--VSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEH 342

Query: 472 TGERASLSDTITPTKK--VKKVGENRSR-LSGSESVEQGNSEANRDEYDLSEEIPGPSTS 528
           T E      T+TP +K  VK+   NR + L        G+      E ++S +   P+ S
Sbjct: 343 TPEH-----TVTPAEKPPVKRRRYNRVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAAS 397

Query: 529 FFATVNHSRTARADENDISIE 549
             A  + +      END S E
Sbjct: 398 DTAKTSITTQINVPENDASQE 418

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 198 PLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFL 255
           P E IH ++F P    ++   KY   +   D ++RF W+ PL       ++P   + +
Sbjct: 290 PFEYIHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKKKDADHILPIFQQLV 345

>Kwal_56.22670 s56 complement(228050..230080) [2031 bp, 676 aa] {ON}
           YGR109W-B - TyB Gag-Pol protein [contig 184] FULL
          Length = 676

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 264 FLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNG-----IERMKYLLQTNKKK 318
           F +T T DR   F    Y     +L I L +++S+H   NG     I+ +  LL+   K+
Sbjct: 371 FPKTITSDRDGRFVSVAYQELANKLGIKLKMSSSNHPQTNGQAERCIQVLNQLLRIYTKE 430

Query: 319 CAKDWGMCLKYGSYHNNTAYNPRI 342
             ++W + L    +  N+ +N  I
Sbjct: 431 YRQEWDIMLPQVEFAYNSTFNIAI 454

>ACR285C Chr3 complement(873065..877036) [3972 bp, 1323 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL051W
           (GAL11)
          Length = 1323

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 61/160 (38%), Gaps = 35/160 (21%)

Query: 3   REIELPTNVPKSKDVCSKPTNNDYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLESVK 62
           R+++LP   PK      +PT  D +  K   S+V  S                  L ++ 
Sbjct: 772 RQVQLPQQTPKI--TLPRPTEQDMMILKRINSEVAKSP---------------LRLSNIT 814

Query: 63  GQLTQAQYELIKTDTLTLETLLAVTDGLIPS------NAEAKYLFLKRRYYVDSDQIVRD 116
            QLT  Q ++IK      + LL+  D  IP+      N E     L+ R        + +
Sbjct: 815 NQLTPEQKQMIKNKLQANQQLLSNVDNFIPTLYLITRNEENVRQLLQIRMLAKE---IME 871

Query: 117 HKRDDTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQ 156
           H      +  P+++ ++I           ++K + F+K Q
Sbjct: 872 HASKGVFIVPPDVVDKVI---------FRYQKYYEFIKEQ 902

>Kwal_23.5250 s23 complement(1075954..1078662) [2709 bp, 902 aa]
           {ON} YGR109W-B - TyB Gag-Pol protein [contig 8] FULL
          Length = 902

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 264 FLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNG-----IERMKYLLQTNKKK 318
           F +T T DR   F    Y     +L I L +++S+H   NG     I+ +  LL+   K+
Sbjct: 597 FPKTITSDRDGRFVSVAYQELANKLGIKLKMSSSNHPQTNGQAERCIQVLNQLLRIYTKE 656

Query: 319 CAKDWGMCLKYGSYHNNTAYNPRI 342
             ++W + L    +  N+ +N  I
Sbjct: 657 YRQEWDIMLPQVEFAYNSTFNIAI 680

>Kwal_26.8300 s26 (729038..731746) [2709 bp, 902 aa] {ON} YGR109W-B
           - TyB Gag-Pol protein [contig 280] FULL
          Length = 902

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 264 FLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNG-----IERMKYLLQTNKKK 318
           F +T T DR   F    Y     +L I L +++S+H   NG     I+ +  LL+   K+
Sbjct: 597 FPKTITSDRDGRFVSVAYQELANKLGIKLKMSSSNHPQTNGQAERCIQVLNQLLRIYTKE 656

Query: 319 CAKDWGMCLKYGSYHNNTAYNPRI 342
             ++W + L    +  N+ +N  I
Sbjct: 657 YRQEWDIMLPQVEFAYNSTFNIAI 680

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,104,219
Number of extensions: 2960912
Number of successful extensions: 10441
Number of sequences better than 10.0: 135
Number of HSP's gapped: 10861
Number of HSP's successfully gapped: 146
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)