Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17006g8.263ON53153128580.0
KLLA0F19162g8.263ON52851921030.0
TDEL0F039008.263ON55948820800.0
YLR089C (ALT1)8.263ON59250720250.0
Suva_10.1738.263ON59248920100.0
Skud_12.1578.263ON59248820070.0
NCAS0B050208.263ON56848820020.0
NDAI0B019908.263ON58848820000.0
Smik_12.1488.263ON59250719890.0
KNAG0G020408.263ON59153019870.0
ZYRO0C01628g8.263ON53448819730.0
Kwal_56.237918.263ON51851419430.0
KLTH0G13662g8.263ON51951519280.0
CAGL0L12254g8.263ON57449919040.0
TPHA0J007508.263ON52248718820.0
KAFR0B027308.263ON53948618590.0
NCAS0B038408.263ON49748718520.0
Ecym_43078.263ON53451118470.0
Kpol_392.58.263ON51248518080.0
KNAG0M012108.263ON52148817850.0
Skud_4.3728.263ON50748917700.0
Smik_4.3578.263ON50748817640.0
YDR111C (ALT2)8.263ON50748817560.0
Suva_2.2718.263ON50748917400.0
AGR085W8.263ON52152217290.0
NDAI0J013608.263ON50149217100.0
KAFR0B05520singletonON51049117050.0
Kpol_543.398.263ON49249016960.0
TBLA0E044408.263ON56248317000.0
KAFR0B055308.263ON51449016850.0
TPHA0A018008.263ON49848916300.0
TBLA0F030608.263ON50049316130.0
TBLA0G01630singletonON50049315440.0
Kwal_34.160181.472ON3791751614e-11
KLLA0F03509g2.252ON3871941251e-06
TPHA0O014501.321ON4431411251e-06
ZYRO0A01672g2.252ON3861521232e-06
KNAG0B053201.321ON4331701223e-06
YGL202W (ARO8)3.511ON5003291224e-06
Suva_6.1361.321ON4441731214e-06
Kpol_278.23.511ON4983301214e-06
ZYRO0G20636g1.321ON4531381205e-06
Kpol_1039.222.252ON3861911196e-06
NDAI0G057601.321ON4481471196e-06
KNAG0B006603.511ON4961251197e-06
Kwal_23.48882.252ON3891671189e-06
YJL060W (BNA3)1.321ON4441451171e-05
KLLA0F10021g3.511ON4971221171e-05
SAKL0F02156g3.511ON4981261171e-05
KLTH0G19646g1.472ON3791391161e-05
TPHA0D033703.511ON4971511161e-05
KNAG0E018502.252ON3841221162e-05
SAKL0D11528g1.472ON3831231162e-05
NDAI0I028303.511ON5001451162e-05
Smik_7.693.511ON5001481152e-05
KLTH0G09614g2.252ON3891241143e-05
TDEL0D019001.321ON4431401143e-05
NDAI0B045502.102ON5651621143e-05
Skud_10.1561.321ON4601421134e-05
Suva_7.613.511ON5001521134e-05
SAKL0E08492g2.252ON3841231125e-05
Kwal_14.25741.321ON4431391116e-05
Skud_7.693.511ON5001451117e-05
KLLA0F01617g1.321ON4442381091e-04
NCAS0E006703.511ON4971451082e-04
NCAS0A092001.321ON4451441082e-04
NCAS0G040501.472ON3841411072e-04
Ecym_32902.252ON3861431072e-04
NCAS0B064402.252ON3851251062e-04
Smik_10.1801.321ON4441421062e-04
NDAI0B037302.252ON3861261053e-04
Kwal_47.189823.511ON4961521054e-04
SAKL0H21824gna 1ON4991251045e-04
KLTH0G02002g3.511ON4961241045e-04
CAGL0G01254g3.511ON5041231027e-04
Kpol_1035.231.321ON4441361027e-04
ADL249W2.252ON3871951019e-04
KAFR0D014203.511ON4921651010.001
CAGL0J05126g1.321ON4333551010.001
TDEL0C040902.252ON3831241000.001
Ecym_62921.321ON4303311000.001
Smik_9.532.252ON388126990.002
YIL116W (HIS5)2.252ON385124990.002
Skud_9.552.252ON385126970.003
Kwal_47.17462na 1ON492128970.003
Suva_9.782.252ON386127960.004
KAFR0J015802.252ON383125960.004
KLTH0E07678gna 1ON492125960.005
KNAG0G005501.472ON387147950.006
ZYRO0C06028g3.511ON496157940.007
AFR548C3.511ON497156940.008
TPHA0F012602.252ON392175930.009
TDEL0D057903.511ON49760930.009
Ecym_7228na 1ON488125930.010
KLTH0H10648g1.321ON44377930.010
CAGL0C01243g2.252ON383122920.010
ZYRO0G05346g2.102ON504140930.010
Kpol_480.11.472ON380161910.014
KLTH0G19624gsingletonON46832900.022
KLTH0B00176g8.204ON44832900.024
AEL170C1.321ON458138900.024
SAKL0D06886g1.321ON44775890.030
TPHA0O015202.102ON50344880.040
SAKL0E12188g2.102ON530174880.043
NCAS0B072202.102ON510162880.045
TDEL0A016008.204ON47532870.048
Skud_8.1982.102ON517173860.062
Smik_8.2182.102ON513338860.063
YHR137W (ARO9)2.102ON513174860.069
KLLA0D11110g2.102ON530163860.073
KAFR0A017101.321ON435169830.13
KAFR0B023808.204ON443182830.14
Kwal_26.77682.475ON422125830.14
KLLA0A04906gna 1ON480138830.15
Ecym_6319singletonON354136820.18
Kpol_1032.398.204ON453190820.21
Kwal_8.5858.204ON44639810.30
Kpol_1035.302.102ON50144800.37
TBLA0B009902.102ON54644790.50
KNAG0G016808.204ON45234790.51
ZYRO0C00858g7.23ON9996720.73
Suva_5.2818.204ON45032770.88
ZYRO0B11088g8.204ON45032761.0
CAGL0G06028g2.102ON53766761.1
CAGL0I06578g8.204ON436178751.2
Smik_5.3198.204ON44333751.5
KLTH0D05478g2.475ON421169732.1
Suva_15.3342.102ON56066732.3
NCAS0A038308.204ON446203732.3
YER152C8.204ON44333732.6
TBLA0I011802.475ON443205732.7
Ecym_55428.204ON44638732.7
ABL038W2.475ON443283722.8
AGR141C8.204ON43832713.9
KLLA0E00969g8.204ON44571714.3
TBLA0B093302.420ON40833704.7
Skud_5.2908.204ON44333705.8
TPHA0D006208.73ON822146706.0
Ecym_56232.353ON75062697.2
NDAI0C059608.204ON47859697.4
Ecym_72884.34ON105795699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17006g
         (531 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...  1105   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   814   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   805   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   784   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   778   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   777   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   775   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   775   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   770   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   769   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   764   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   753   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   747   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   738   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   729   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   720   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   717   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   716   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   701   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   692   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   686   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   684   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   681   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   674   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   670   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   663   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   661   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   657   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   659   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            653   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   632   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   625   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              599   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    67   4e-11
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    53   1e-06
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    53   1e-06
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    52   2e-06
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    52   3e-06
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    52   4e-06
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    51   4e-06
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    51   4e-06
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    51   5e-06
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    50   6e-06
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    50   6e-06
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    50   7e-06
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    50   9e-06
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    50   1e-05
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    50   1e-05
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    50   1e-05
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    49   1e-05
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    49   1e-05
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    49   2e-05
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    49   2e-05
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    49   2e-05
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    49   2e-05
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    49   3e-05
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    49   3e-05
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    49   3e-05
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    48   4e-05
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    48   4e-05
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    48   5e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    47   6e-05
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    47   7e-05
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    47   1e-04
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     46   2e-04
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    46   2e-04
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    46   2e-04
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    46   2e-04
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    45   2e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    45   2e-04
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    45   3e-04
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    45   4e-04
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    45   5e-04
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    45   5e-04
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    44   7e-04
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    44   7e-04
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    44   9e-04
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    44   0.001
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    44   0.001
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    43   0.001
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    43   0.001
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    43   0.002
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    43   0.002
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    42   0.003
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    42   0.003
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    42   0.004
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    42   0.004
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    42   0.005
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       41   0.006
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    41   0.007
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    41   0.008
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    40   0.009
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    40   0.009
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    40   0.010
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    40   0.010
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    40   0.010
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    40   0.010
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    40   0.014
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    39   0.022
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    39   0.024
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    39   0.024
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    39   0.030
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    39   0.040
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    39   0.043
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    39   0.045
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    38   0.048
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    38   0.062
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    38   0.063
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    38   0.069
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    38   0.073
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    37   0.13 
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    37   0.14 
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    37   0.14 
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    37   0.15 
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    36   0.18 
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    36   0.21 
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    36   0.30 
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    35   0.37 
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    35   0.50 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    35   0.51 
ZYRO0C00858g Chr3 complement(66260..66559) [300 bp, 99 aa] {ON} ...    32   0.73 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    34   0.88 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    34   1.0  
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    34   1.1  
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    33   1.2  
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    33   1.5  
KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} simila...    33   2.1  
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    33   2.3  
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     33   2.3  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    33   2.6  
TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {O...    33   2.7  
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    33   2.7  
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    32   2.8  
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    32   3.9  
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    32   4.3  
TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON} Anc_2...    32   4.7  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    32   5.8  
TPHA0D00620 Chr4 complement(115810..118278) [2469 bp, 822 aa] {O...    32   6.0  
Ecym_5623 Chr5 (1254121..1256373) [2253 bp, 750 aa] {ON} similar...    31   7.2  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    31   7.4  
Ecym_7288 Chr7 (604427..607600) [3174 bp, 1057 aa] {ON} similar ...    31   9.0  

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/531 (100%), Positives = 531/531 (100%)

Query: 1   MLTVAIRTPSLRMLRTTTAGNIAKNMPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENV 60
           MLTVAIRTPSLRMLRTTTAGNIAKNMPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENV
Sbjct: 1   MLTVAIRTPSLRMLRTTTAGNIAKNMPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENV 60

Query: 61  LRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLL 120
           LRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLL
Sbjct: 61  LRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLL 120

Query: 121 QNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKR 180
           QNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKR
Sbjct: 121 QNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKR 180

Query: 181 DGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPY 240
           DGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPY
Sbjct: 181 DGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPY 240

Query: 241 YLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKY 300
           YLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKY
Sbjct: 241 YLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKY 300

Query: 301 GIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQR 360
           GIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQR
Sbjct: 301 GIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQR 360

Query: 361 GGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIH 420
           GGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIH
Sbjct: 361 GGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIH 420

Query: 421 DALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQEL 480
           DALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQEL
Sbjct: 421 DALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQEL 480

Query: 481 LEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531
           LEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD
Sbjct: 481 LEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/519 (74%), Positives = 451/519 (86%), Gaps = 6/519 (1%)

Query: 13  MLRTTTAGNIAKNMPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRGKIP 72
           M+R   A  +   MP  T   +   S  V    +PA KLSL+D+NENVL+AKYAVRG+IP
Sbjct: 16  MIRVN-APALKSTMPSVTSLTQLRFSTTV----KPAPKLSLDDVNENVLKAKYAVRGRIP 70

Query: 73  QKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPRE 132
            +AEEL++QL +DP SLPF +II+ANIGNPQQLDQKPLTFYR+VLSLLQ+P++LEE   E
Sbjct: 71  MRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEA-DE 129

Query: 133 QLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIF 192
            L  +YK D+I RA RLLS +GGSVGAYS SQGV G R+TVADFITKRD GE +Y EDI+
Sbjct: 130 ALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIY 189

Query: 193 LTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNP 252
           LTAGASAAVSYILSILC+GP TGVLIPIPQYPLYTASLALNNS  LPYYL EE NWST+P
Sbjct: 190 LTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDP 249

Query: 253 EEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQE 312
           EEIE+VV ++I KG++P CLVVINPGNPTGAILS +SI+KIFEVAAKYGIVVIADEVYQE
Sbjct: 250 EEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQE 309

Query: 313 NVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHD 372
           NVF G++F+SM+KVL++LQ+ +HG++DNIQLASLHSTSKGVSGECGQRGGYMEL+GF+HD
Sbjct: 310 NVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHD 369

Query: 373 VRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYE 432
           +RQVFLKLASISLCPVVTGQALVDLMV PP+PGD SYEQDQ+ER +IHDALD RAS L+E
Sbjct: 370 IRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFE 429

Query: 433 TFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGS 492
           TF+RLEGIEC+KPQGAMYL+P+LDL YK +Q+A+HL + PDEFYC+ LLE TGICTVPGS
Sbjct: 430 TFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGS 489

Query: 493 GFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531
           GFGQVPGTYHLRTTFL PGT+W++ WE+FHK F+++YRD
Sbjct: 490 GFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/488 (76%), Positives = 432/488 (88%), Gaps = 1/488 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F PA+ L++ DLNENVL+AKYAVRG IP +AEEL+ QL RDP SLPFD+I+NANIGNPQQ
Sbjct: 72  FYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQ 131

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQ-IYKPDAIDRAARLLSNIGGSVGAYSHS 163
           L+QKPL+FYRQVLS+LQ P++LE+   E +S+ ++K DAI+RA R+L ++GGSVGAYS S
Sbjct: 132 LNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSS 191

Query: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223
           QGVYG RKTVADFIT+RD GE AY EDIFLTAGASAAVSY+LSILCRG +TGVLIPIPQY
Sbjct: 192 QGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQY 251

Query: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283
           PLYTA+LALNNSH LPYYLDEES WSTN  EIE VVT SI  G+ P  LVVINPGNPTG+
Sbjct: 252 PLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGS 311

Query: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343
           +LS E+IEKIF+VAAKYGIVVIADEVYQEN+F G+EFHSM+KVL+ LQ++H G +DN+QL
Sbjct: 312 VLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQL 371

Query: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403
            SLHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMVCPPK
Sbjct: 372 VSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPK 431

Query: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463
           PGD SYEQD+KER  IH+ LD RA +L++TFN LEGIECQKP+GAMYLFP++ L YKA+Q
Sbjct: 432 PGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQ 491

Query: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523
            A+HL  +PDEFYCQ+LLEATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WIK WE+FHK
Sbjct: 492 AAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHK 551

Query: 524 KFYNEYRD 531
           KFY++YRD
Sbjct: 552 KFYDQYRD 559

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/507 (73%), Positives = 433/507 (85%), Gaps = 8/507 (1%)

Query: 26  MPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARD 85
            PH TL     S+N    +F PA++L+LED+NENVL+AKYAVRG IP +AEELK QL +D
Sbjct: 93  FPHHTL---KTSNN----EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKD 145

Query: 86  PKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAID 144
           P+SLPFDRIINANIGNPQQL QKPLT+YRQVLSLLQ P++L +  ++ + S+++K DAI 
Sbjct: 146 PQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIK 205

Query: 145 RAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYI 204
           RA  L+ +IGGSVGAYS SQGV G RK+VA+FITKRD GE +Y EDIFLTAGASAAV+Y+
Sbjct: 206 RAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYL 265

Query: 205 LSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIA 264
           LSI CRGP+TGVLIPIPQYPLYTA+LALNNS ALPYYLDE S WSTNPEEIE VV  +I 
Sbjct: 266 LSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQ 325

Query: 265 KGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMR 324
             ++P  LVVINPGNPTGA+LSPESI +IFEVAAKYG VVIADEVYQEN+F G +FHSM+
Sbjct: 326 NEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMK 385

Query: 325 KVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASIS 384
           K+L+ LQR+H GKFDN+QLASLHSTSKGVSGECGQRGGYMEL GFSH++RQV LKLASIS
Sbjct: 386 KILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASIS 445

Query: 385 LCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQK 444
           LCPVVTGQALVDLMV PP  G+ S+E DQ ER+ IH+ L  RA  LYETFN LEGIECQK
Sbjct: 446 LCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQK 505

Query: 445 PQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLR 504
           PQGAMYLFP++DL +KAVQ+A HL L+PDEFYC++LLE+TGICTVPGSGFGQ PGTYHLR
Sbjct: 506 PQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLR 565

Query: 505 TTFLAPGTDWIKAWEEFHKKFYNEYRD 531
           TTFLAPG +WIK WE FHK+F+++YRD
Sbjct: 566 TTFLAPGLEWIKKWESFHKEFFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/489 (74%), Positives = 425/489 (86%), Gaps = 1/489 (0%)

Query: 44  KFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQ 103
           +F PA++L+L+D+NENVL+A+YAVRG IP +AEELK QL +DP+SLPF++IINANIGNPQ
Sbjct: 104 EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163

Query: 104 QLDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAIDRAARLLSNIGGSVGAYSH 162
           QL QKPLT+YRQVLSLLQ P++L    +E + S+++K DAI RA  L+ +IGGSVGAYS 
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSS 223

Query: 163 SQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQ 222
           SQGV G RK+VADFITKRDGGE AY EDIFLTAGASAAV+Y+LSI CRGP+TGVLIPIPQ
Sbjct: 224 SQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQ 283

Query: 223 YPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTG 282
           YPLYTA+LALNNS  LPYYLDE S WSTNPEEIE VV  +I   ++P  LVVINPGNPTG
Sbjct: 284 YPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343

Query: 283 AILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQ 342
           A+LSPESI +IFEVAAKYG VVIADEVYQEN+F G EF+SM+KVL+ LQR H GKFDN+Q
Sbjct: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQ 403

Query: 343 LASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPP 402
           LASLHSTSKGVSGECGQRGGYMEL GFSH++RQV LKLASISLCPVVTGQALVDLMV PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 403 KPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAV 462
             G+ S+E DQ ER+ IH+ L+ RA  LYETFN LEGIECQKPQGAMYLFP++D+ +KA+
Sbjct: 464 VEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAI 523

Query: 463 QKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFH 522
           Q+A HL L+PDEFYC++LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG +W+K WE FH
Sbjct: 524 QEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFH 583

Query: 523 KKFYNEYRD 531
           K+F+++YRD
Sbjct: 584 KEFFDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/488 (74%), Positives = 425/488 (87%), Gaps = 1/488 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F PA++L+LED+NENVL+AKYAVRG IP +AEELK QL +DP+SLPFD+IINANIGNPQQ
Sbjct: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAIDRAARLLSNIGGSVGAYSHS 163
           L QKPLT+YRQVLSLLQ P++L +  ++ + S+++K DAI RA  L+ +IGGSVGAYS S
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 224

Query: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223
           QGV G RK+VA+FITKRD GE +Y EDIFLTAGASAAV+Y+LSI CRGP+TGVLIPIPQY
Sbjct: 225 QGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQY 284

Query: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283
           PLYTA+LALNNS ALPYYLDE+S WSTNPEEIE VV  +I   ++P  LVVINPGNPTGA
Sbjct: 285 PLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGA 344

Query: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343
           +LSPES+ +IFEVAAKYG VVIADEVYQEN+F G +FHSM+K+L+ LQR+H GKFDN+QL
Sbjct: 345 VLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQL 404

Query: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403
           ASLHSTSKGVSGECGQRGGYMEL GFSH++RQV LKLASISLCPVVTGQALVDLMV PP 
Sbjct: 405 ASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPV 464

Query: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463
            G+ S+E DQ ER+ IH+ L  RA  LY+TFN LEGIECQKPQGAMYLFP++DL +KAVQ
Sbjct: 465 EGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQ 524

Query: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523
           +A HL L+PDEFYC+ LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG +WIK WE FHK
Sbjct: 525 EARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHK 584

Query: 524 KFYNEYRD 531
           +F+++YRD
Sbjct: 585 EFFDQYRD 592

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/488 (75%), Positives = 419/488 (85%), Gaps = 1/488 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F PAD+L+L +LN+NVL+AKYAVRG IP +AEELK QL  DP SLPFD I+NANIGNPQQ
Sbjct: 81  FLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQ 140

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAIDRAARLLSNIGGSVGAYSHS 163
           L+QKPL+FYRQVLSLLQ P++L++   + + S ++K DA++RA  LL  IGG+VGAYS S
Sbjct: 141 LNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSAS 200

Query: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223
           QGVYG RKTVA+FITKRD GE AY EDIFLTAGASAAV Y+LSILC+GP+TGVLIPIPQY
Sbjct: 201 QGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQY 260

Query: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283
           PLYTASLALNNSHALPYYLDE+S WSTNP+EIE+VV  +  K + P  LVVINPGNPTGA
Sbjct: 261 PLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGA 320

Query: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343
           +LS +SIE IFE+AAKYGIVVIADEVYQENVFN  +FHSM+KVL++LQ+KH G +D +QL
Sbjct: 321 VLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQL 380

Query: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403
           ASLHSTSKGVSGECGQRGGYMEL GF+H+VR V LKLASISLCPVVTGQALVDLMV PPK
Sbjct: 381 ASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPK 440

Query: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463
            GD S+EQDQ ER  I   L  RA  LY+ FN LEGIECQKPQGAMYLFPRLDL +KAVQ
Sbjct: 441 KGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQ 500

Query: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523
           KA+HL +SPDEFYC+ LLEATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WI+ W+ FH+
Sbjct: 501 KAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQ 560

Query: 524 KFYNEYRD 531
            FYN YRD
Sbjct: 561 DFYNTYRD 568

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/488 (74%), Positives = 421/488 (86%), Gaps = 1/488 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F PA++L+L DLNENVL+AKYAVRG IP +AEELK QL  +P +LPF +I+NANIGNPQQ
Sbjct: 101 FAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQ 160

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAIDRAARLLSNIGGSVGAYSHS 163
           L QKPL+FYRQVLS+LQ PD+L+E  +  + +++YK DAIDRA  LLS IGGSVGAYS S
Sbjct: 161 LKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSAS 220

Query: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223
           QGVYG RKTVA+FIT+RDGGE AY EDIFLT        Y+LSILC+GP+TGVLIPIPQY
Sbjct: 221 QGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQY 280

Query: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283
           PLYTA+LALNNSHALPYYLDE+S WSTNP+EIE+VV +++ + + P  LVVINPGNPTGA
Sbjct: 281 PLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGA 340

Query: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343
           +L+ ESIE IFE+AAKYGIVVIADEVYQEN+ +G +F+SM+KVL+ LQ+ H GKFDN+QL
Sbjct: 341 VLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQL 400

Query: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403
           ASLHSTSKGVSGECGQRGGYMEL+GF+H+VR+V LKLASISLCPVVTGQALVDLMV PPK
Sbjct: 401 ASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPK 460

Query: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463
            GDASYEQDQ ER  I   L  RAS LYETF  LEGIECQKPQGAMYLFP+LDL +KAVQ
Sbjct: 461 KGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQ 520

Query: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523
           +A+HL ++PDEFYC+ LL+ATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WIK WE FHK
Sbjct: 521 EAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHK 580

Query: 524 KFYNEYRD 531
           +FY+ YRD
Sbjct: 581 EFYDNYRD 588

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/507 (72%), Positives = 430/507 (84%), Gaps = 8/507 (1%)

Query: 26  MPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARD 85
            PH TL     S+N    +F PA++L+L+D+NENVL+AKYAVRG IP +AEELK QL +D
Sbjct: 93  FPHHTL---KTSNN----EFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKD 145

Query: 86  PKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAID 144
           P+SLPF++IINANIGNPQQL QKPLT+YRQVLSLLQ P++L +  ++ + S+++K DAI 
Sbjct: 146 PQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIK 205

Query: 145 RAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYI 204
           RA  L+  IGGSVGAYS SQGV G R++VA+FITKRD GE +Y EDIFLTAGASAAV+Y+
Sbjct: 206 RAKSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYL 265

Query: 205 LSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIA 264
           LSI CRGP+TGVLIPIPQYPLYTA+LALNNS ALPYYLDE S WSTNPEEIE VV  +I 
Sbjct: 266 LSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIE 325

Query: 265 KGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMR 324
             ++   LVVINPGNPTGA+LSPESI +IFEVAAKYG VVIADEVYQEN+F G +FHSM+
Sbjct: 326 NEIKSTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMK 385

Query: 325 KVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASIS 384
           K+L+ LQR+H GKFDN+QLASLHSTSKGVSGECGQRGGYMEL GFSH++RQV LKLASIS
Sbjct: 386 KILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASIS 445

Query: 385 LCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQK 444
           LCPVVTGQALVDLMV PP  G+ S+E DQ ER+ IH+ L  RA  LY+TFN LEGIECQK
Sbjct: 446 LCPVVTGQALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQK 505

Query: 445 PQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLR 504
           PQGAMYLFP++DL ++AVQ+A HL L+PDEFYC++LLE+TGICTVPGSGFGQ PGTYHLR
Sbjct: 506 PQGAMYLFPKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLR 565

Query: 505 TTFLAPGTDWIKAWEEFHKKFYNEYRD 531
           TTFLAPG +WIK WE FHK+F++ YRD
Sbjct: 566 TTFLAPGLEWIKKWETFHKEFFDHYRD 592

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/530 (69%), Positives = 440/530 (83%), Gaps = 8/530 (1%)

Query: 9   PSLRMLRTTTAGNIAKNMPHSTLFLRSFSSNFVP----YKFQPADKLSLEDLNENVLRAK 64
           PSL + R  +A    K MPH+    R  + + +     YKF PA ++ + DLNENVL+AK
Sbjct: 63  PSLIISRKFSASENIK-MPHAVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKAK 121

Query: 65  YAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPD 124
           YAVRG IP +AE+L++QL  DP+SLPFD+IINANIGNPQQL+QKPL+FYRQVLSLLQ P+
Sbjct: 122 YAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFPE 181

Query: 125 MLEEIPRE--QLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDG 182
           +L  +       + +YK DA+ RA +LL +IGGSVGAYS SQGV G RKTVADFIT+RD 
Sbjct: 182 LLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDN 241

Query: 183 GEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYL 242
            E AY EDIFLTAGASAAVSY+LSI C+G +TGVLIPIPQYPLYTA+LALNNSH LPYYL
Sbjct: 242 NEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYL 301

Query: 243 DEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGI 302
           DE+S WSTN +EI+ VV ++I + ++P  LVVINPGNPTGA+LS ++I +IFE+AAKYGI
Sbjct: 302 DEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSEKAIAEIFEIAAKYGI 361

Query: 303 VVIADEVYQENVFN-GAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRG 361
           VVIADEVYQEN+F+   +FHSM+KVL+ LQ++H GKFD +QLASLHSTSKGVSGECGQRG
Sbjct: 362 VVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRG 421

Query: 362 GYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHD 421
           G+MEL GFSH++RQV LKLASISLCPVVTGQALVDLMV PP+ G+ SYE DQ ERS IH 
Sbjct: 422 GFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHS 481

Query: 422 ALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELL 481
            L  RA+ L+ETFNRLEGI+CQKPQGAMYLFPRL+L +KAVQKA+H+ ++ DEFYC+ELL
Sbjct: 482 ELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKELL 541

Query: 482 EATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531
           E TGICTVPGSGFGQVPGTYHLRTTFLAPGT+WI  WE+FHK+FYN+YRD
Sbjct: 542 ENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/488 (74%), Positives = 417/488 (85%), Gaps = 5/488 (1%)

Query: 47  PADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLD 106
           PA+KL L ++NENVL+AKYAVRG IP  A EL  +L +DP SLPFD I++ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 107 QKPLTFYRQVLSLLQNPDMLEEIPREQL---SQIYKPDAIDRAARLLSNIGGSVGAYSHS 163
           QKPLTFYRQVLSLLQ P +LEE   EQ+   S++Y+ DAI RA RLL++IG SVGAYS S
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEE--NEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166

Query: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223
           QG+ G R+TVA FIT+RDGGE+AYAEDIFLTAGAS+AVSY+LSILC+G +TGVLIPIPQY
Sbjct: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226

Query: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283
           PLYTASLALNNSH LPYYLDE+S WSTNP EIE VV N+I + ++P  LVVINPGNPTGA
Sbjct: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286

Query: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343
           +LS E I +IF +AAKYGIVVIADEVYQENVF+GAEFHSM+K+L+ LQ+ + G FDN+QL
Sbjct: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346

Query: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403
           ASLHSTSKGVSGECGQRGGYME+ GF++D+RQV LKLASISLCPVVTGQALVDLMV PPK
Sbjct: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406

Query: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463
           PGD SYE DQ+ER  IH+AL  RA  L+ TFN LEGIECQKP+GAMYLFPRL L +KA+Q
Sbjct: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466

Query: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523
            AEH  ++PD FYC++LLEATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WI+ WE FHK
Sbjct: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526

Query: 524 KFYNEYRD 531
            FY EYRD
Sbjct: 527 AFYEEYRD 534

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/514 (69%), Positives = 431/514 (83%), Gaps = 5/514 (0%)

Query: 22  IAKNMPHSTLFLRSFSSN---FVPYKFQP-ADKLSLEDLNENVLRAKYAVRGKIPQKAEE 77
           I ++MPHS L LR  S+       Y  +P   K +L+D+NE VL AKYAVRG IP +AEE
Sbjct: 6   IIRSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEE 65

Query: 78  LKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQI 137
           LK +L  +P SLPFD+IINANIGNPQQLDQKPLTFYRQVL+LLQNPD++ ++   +L + 
Sbjct: 66  LKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKF 125

Query: 138 YKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGA 197
           +KPDA++RA ++L  +GGSVGAYS+SQGV GFR++VA+FI +RDG E A A+DIFLT GA
Sbjct: 126 FKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGA 184

Query: 198 SAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEK 257
           S AVSYILS+ C GP+ G LIPIPQYPLYTASLALNNSHALPYYLDEES WS + E+IEK
Sbjct: 185 SGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEK 244

Query: 258 VVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNG 317
           VV +SI KG+ P CLVVINPGNPTGA+L+ ++IE + +VAAKY +V+IADEVYQEN FN 
Sbjct: 245 VVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFND 304

Query: 318 AEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVF 377
           AEF SM+KVL+ LQ+   GK+DN+QLASLHSTSKGVSGECGQRGGYMEL+GFS +V+QVF
Sbjct: 305 AEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVF 364

Query: 378 LKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRL 437
           LKLASISLCPVVTGQAL+DLMV PPK GDASYEQD++ER +IHDAL  R+ +LY+ F  +
Sbjct: 365 LKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSM 424

Query: 438 EGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQV 497
           EG+ CQ+PQGAMYLFP+L+LS KA+ KAE   L+PDE+YC+ELLEATGICTVPGSGFGQV
Sbjct: 425 EGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQV 484

Query: 498 PGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531
           PGT+HLRTTFLAPGT+WI +W++FH+KF  ++RD
Sbjct: 485 PGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/515 (68%), Positives = 431/515 (83%), Gaps = 5/515 (0%)

Query: 21  NIAKNMPHSTLFLRSFSSNFVPYK--FQPA--DKLSLEDLNENVLRAKYAVRGKIPQKAE 76
            + + MPHS L LR  S+         Q A   K +L D+N+ VL AKYAVRG IP +AE
Sbjct: 6   QLTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAE 65

Query: 77  ELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQ 136
           EL+++L  +P SLPF++IINANIGNPQQLDQKPLTFYRQVLSLLQNP ++E +P  +L +
Sbjct: 66  ELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELHK 125

Query: 137 IYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAG 196
           ++KPDA++RA ++L  +GGSVGAYS SQGV GFR++VA+FI +RDG E A A DIFLTAG
Sbjct: 126 LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAG 184

Query: 197 ASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIE 256
           AS+AVS ILS+ C G + G LIPIPQYPLYTA+LALN++HALPYYLDE S WS + E++E
Sbjct: 185 ASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVE 244

Query: 257 KVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFN 316
           +VV ++I KGV P CLVVINPGNPTGAILSPE+IEKI  VAAKY +VVIADEVYQEN F+
Sbjct: 245 QVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFD 304

Query: 317 GAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQV 376
            A+F SM+KVL+ LQ+   GK+DN+QLASLHSTSKGVSGECGQRGGYMEL+GFS +V+QV
Sbjct: 305 DADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQV 364

Query: 377 FLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNR 436
           FLKLASISLCPVVTGQALVDLMV PPK GDASYE D++ER+ IH++L  ++++LYETF  
Sbjct: 365 FLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQS 424

Query: 437 LEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQ 496
           LEG+ CQKPQGAMYLFP+LDLS KA++KAE L ++PDE+YC+ELLEATGICTVPGSGF Q
Sbjct: 425 LEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQ 484

Query: 497 VPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531
           VPGTYHLRTTFLAPGT+W+ +W++FH+KF +E+RD
Sbjct: 485 VPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/499 (69%), Positives = 415/499 (83%), Gaps = 3/499 (0%)

Query: 33  LRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFD 92
           +   S N +P  F PA++ +L+D+NE VL AKYAVRG IP +AEELK QL  +P SLPF+
Sbjct: 79  IHHHSHNNLP--FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFN 136

Query: 93  RIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSN 152
            IINANIGNPQQL QKPL+FYRQVLSLLQ P+++  +     + I K DAIDRA RLL +
Sbjct: 137 DIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-KQDAIDRAKRLLDD 195

Query: 153 IGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGP 212
           IGGSVGAYS SQGV G RKTVADFIT RD G  AY EDIFLTAGAS+AV Y+LSI CRG 
Sbjct: 196 IGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGE 255

Query: 213 QTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCL 272
           +TGVLIPIPQYPLYTA+LAL NSHALPYYL+EE+ WST+PEE+E ++ +SI   ++P  L
Sbjct: 256 ETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVL 315

Query: 273 VVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQR 332
           VVINPGNPTGA+LS E+IE+IF +AAKYGI+VIADEVYQENVF   +FHSM+KVL+ LQ 
Sbjct: 316 VVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQM 375

Query: 333 KHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQ 392
           K  G +DN+QLASLHSTSKGVSGECGQRGGYMEL+GF+HD+RQV LKLASISLCPVVTGQ
Sbjct: 376 KQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQ 435

Query: 393 ALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLF 452
           ALVDLMVCPP+ G+ SYEQDQ+ER  IH  L  RA++L++ F +L+GI CQKPQGAMYLF
Sbjct: 436 ALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLF 495

Query: 453 PRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGT 512
           P+L+L YKA+Q+A H  +SPDEFYC+ LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGT
Sbjct: 496 PKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGT 555

Query: 513 DWIKAWEEFHKKFYNEYRD 531
            WI+ W +FH++FYN++++
Sbjct: 556 KWIEDWVDFHQEFYNKFKN 574

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/487 (71%), Positives = 418/487 (85%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F+PADKL++ DLNENVL+AKYAVRGKIP +AE LK QL  +P SLPF ++INANIGNPQQ
Sbjct: 36  FKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQ 95

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQ 164
           L+QKPLTFYRQVLSLLQ P +L+E        +YK DAI+RA R+L++IG SVG+YS SQ
Sbjct: 96  LNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIGSSVGSYSSSQ 155

Query: 165 GVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYP 224
           GV+G RKTVA++I++RDGGE+AYAEDIFLTAGAS+AVSY+L+ILC+G ++GVLIPIPQYP
Sbjct: 156 GVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYP 215

Query: 225 LYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAI 284
           LYTA+LALNN++ALPYYL+E S WSTN EEIE VV N+I + + P+ LVVINPGNPTGAI
Sbjct: 216 LYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAI 275

Query: 285 LSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLA 344
           LS ESIEKIF+VAA +GIVVIADEVYQEN+F G EFHSM+KVL+DLQR+  GK++N+QLA
Sbjct: 276 LSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLA 335

Query: 345 SLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKP 404
           SLHSTSKGVSGECGQRGGYMEL GFS +++   LKL SISLCPVVTGQALVDLM CPPK 
Sbjct: 336 SLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKK 395

Query: 405 GDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQK 464
           G+ASYEQDQ ERS IH  L  RA+ L++ FN +EG+ CQKPQG+MYLFP++D+ +KA++K
Sbjct: 396 GEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEK 455

Query: 465 AEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKK 524
           A+ L ++PDE YC ELLEATGICTVPGSGFGQ PGT+HLRTTFLAPGT WI  W EFH+ 
Sbjct: 456 AQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQI 515

Query: 525 FYNEYRD 531
           F N+YRD
Sbjct: 516 FCNKYRD 522

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/486 (71%), Positives = 412/486 (84%), Gaps = 1/486 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F+PA +L++ DLNENVL+AKYAVRGKIP +AEELK QLA  P SLPFD+IINANIGNPQQ
Sbjct: 52  FKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQ 111

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEI-PREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHS 163
           L Q+PL+FYRQVLSLLQ P +L  I  +   S +YK DAI RA ++L +IGGSVGAYS S
Sbjct: 112 LQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSES 171

Query: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223
           QGVYG R+TVA+FIT+RDGGE AY EDIFLTAGASAAV+Y+LSILC+G +TGVLIPIPQY
Sbjct: 172 QGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQY 231

Query: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283
           PLYTA+LALNNSHALPY+LDE + WS NP EIE V+  ++   ++P  LVVINPGNPTGA
Sbjct: 232 PLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGA 291

Query: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343
           +LS E+I  I E+AAKYGIVVIADEVYQEN+F+G +FHS++ VL+ LQR+  GKFDN+QL
Sbjct: 292 VLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQL 351

Query: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403
           ASLHSTSKGVSGECGQRGGYME++GF+H+VRQV LKLASISLCPVVTGQALVDLMV PPK
Sbjct: 352 ASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPK 411

Query: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463
            G+ S+  DQ +R  IH  L  RA +L++TFN L+GIECQKP GAMYLFP+L+L Y+A+Q
Sbjct: 412 RGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQ 471

Query: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523
           +A+ L LSPDEFYC+ELLE TGICTVPGSGFGQV GTYHLRTTFLAPG +WI +W++FH 
Sbjct: 472 EAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHI 531

Query: 524 KFYNEY 529
           +F  +Y
Sbjct: 532 EFMEKY 537

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/487 (68%), Positives = 406/487 (83%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           FQPA KLSL+D+NENV+ AK+A+RG I  KAE+L+ QL ++P  LPFD I  ANIGNPQ+
Sbjct: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQ 164
           L+QKPLTF RQV+S+LQ P++L         +I+  D+ DRA RLL +IGGSVGAYS SQ
Sbjct: 71  LNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQ 130

Query: 165 GVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYP 224
           GVYG RKT A++ITKRDGGE +Y EDIFLT GA++A SY+LS+LCRGPQTGVLIPIPQYP
Sbjct: 131 GVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYP 190

Query: 225 LYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAI 284
           LYTA+LALN S  +PYYLDEES WSTN  EIEK+V +SI KG++P  +VVINPGNPTGA+
Sbjct: 191 LYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAV 250

Query: 285 LSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLA 344
           LS  +I KIF++AAKYGIVV+ADEVYQEN+F+G +FHS +KVL+ LQ+++ GKFDNIQLA
Sbjct: 251 LSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLA 310

Query: 345 SLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKP 404
           S+HSTSKGV GECGQRGGYMEL+GF+ +VRQ+ LKLA +++C VVTGQA+VDLM+ PPK 
Sbjct: 311 SMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKK 370

Query: 405 GDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQK 464
           GDASYE D+KER EI DA+  RA  LY  F++L+GIECQKPQGAMYL+P L LS KA+ K
Sbjct: 371 GDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAK 430

Query: 465 AEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKK 524
           AE L+L+PDEFYC ELL+ATGICTVPGSGFGQ  GTYHLRTTFLAPG +WI  WE+FHK 
Sbjct: 431 AESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKH 490

Query: 525 FYNEYRD 531
           FY +Y+D
Sbjct: 491 FYEKYQD 497

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/511 (65%), Positives = 413/511 (80%), Gaps = 2/511 (0%)

Query: 21  NIAKNMPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKN 80
           ++   +PH+T+ LRS SS     +F+P D L LEDLN NVL AKYAVRGKIP +A EL+ 
Sbjct: 26  DVLHGLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELER 85

Query: 81  QLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKP 140
           QL+RDP SLPF +II ANIGNPQQL QKPL+F R+VLSLL++P++L+ +P E L+ IYKP
Sbjct: 86  QLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQ-MPMEVLNLIYKP 144

Query: 141 DAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAA 200
           DA+ RA R++ ++  S+GAYSHSQGV GFRKTVA++++ RDG E A AEDIFLT GAS  
Sbjct: 145 DAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNG 203

Query: 201 VSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVT 260
            S ++ +LC+G ++GVLIPIPQYPLYTA++ LNN+ ALPYYLDEES WS N +++E+++ 
Sbjct: 204 ASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIII 263

Query: 261 NSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEF 320
            SI KGV+P CLVVINPGNPTGAIL  ES+E+IF +AAKY IVVIADEVYQENVF G +F
Sbjct: 264 ESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKF 323

Query: 321 HSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKL 380
           +SM+KVL+ LQR++   F N+QL SLHSTSKG+SGECGQRGGYMEL+GFS D+R+V LK+
Sbjct: 324 YSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKM 383

Query: 381 ASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGI 440
           ASI LC  V GQALVDLM+  PKPGD SYE+D  ERS I +AL  R+  L+ETFN LEG+
Sbjct: 384 ASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGV 443

Query: 441 ECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGT 500
           EC+KPQG+MYLFPRL L  KA++ AE L + PDEFYC ELL +TGICTVPGSGFGQ P T
Sbjct: 444 ECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDT 503

Query: 501 YHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531
            HLRTTFL PGT+WI++WE FHK FY++YRD
Sbjct: 504 CHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/485 (68%), Positives = 402/485 (82%), Gaps = 7/485 (1%)

Query: 47  PADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLD 106
           PA KL ++DLN+NVL+AKYAVRG IP +AEELK  L    K LPFD +INANIGNPQQL 
Sbjct: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAGQK-LPFDTVINANIGNPQQLK 93

Query: 107 QKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGV 166
           QKPLTFYRQVLS+LQ P++LE       S I+K DAI+RA +LL  IG SVG+YS SQG+
Sbjct: 94  QKPLTFYRQVLSILQYPELLE-----SGSNIFKKDAIERARKLLKEIG-SVGSYSSSQGI 147

Query: 167 YGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLY 226
              RKTVA+FITKRD GE +   DIFLTAGAS+AV Y+LSILC+  ++GVLIPIPQYPLY
Sbjct: 148 PAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPLY 207

Query: 227 TASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILS 286
           TA+LALNN+HALPYYLDE   WST+  EIE+V+ +S+ KG++P  LV+INPGNPTG+ILS
Sbjct: 208 TATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILS 267

Query: 287 PESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASL 346
            ES+EKI EVAA +GIV+IADEVYQENVFN A+FHSM+KVL++LQ+   G++D +QLASL
Sbjct: 268 VESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASL 327

Query: 347 HSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGD 406
           HSTSKGVSGECGQRGGYMEL GF+ +++QV LKL SISLCPVVTGQALVDLMV PP+ GD
Sbjct: 328 HSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGD 387

Query: 407 ASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAE 466
            SYEQDQ ERS I + L  RA +L+E FN +EG+ CQKP+GAMYLFP++DL +K +QK++
Sbjct: 388 ESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQ 447

Query: 467 HLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFY 526
            L ++PDEFYC+ LLEATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WI  W +FH +FY
Sbjct: 448 ELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFY 507

Query: 527 NEYRD 531
           ++YRD
Sbjct: 508 DKYRD 512

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/488 (67%), Positives = 396/488 (81%), Gaps = 1/488 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F+PA KL  +DLN+N++ A+YAVRG IP KAEEL+ QL++ P  LPF+ I  ANIGNPQQ
Sbjct: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQ 164
           LDQKPLTF RQV+S+LQ P +L+   +   S  YK DA  RAA LL  IGGSVGAYS +Q
Sbjct: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQ 153

Query: 165 GVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYP 224
           GVYG R++VADFIT+RD GE A  +DIFLT GAS A +Y+LSILCR   TG++IPIPQYP
Sbjct: 154 GVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYP 213

Query: 225 LYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAI 284
           LYTAS+ + NS  LPYYLDEES WST  EEIE+ V +SI +GV P+ +VVINPGNPTGA+
Sbjct: 214 LYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAV 273

Query: 285 LSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKH-HGKFDNIQL 343
           LS ++I +I  +AAKYGIVV+ADEVYQ N++ G +FHSM+KVL+ LQR H +G++DN+QL
Sbjct: 274 LSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQL 333

Query: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403
           AS+HSTSKGVSGECGQRGGYMEL+GFS++VRQV LKLASIS+C VVTGQALVDLM+ PP+
Sbjct: 334 ASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPR 393

Query: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463
            GD SYE D +ER EIH+ +  R  +LY+TF +LEGIECQ+PQGAMYLFP+L LS KA++
Sbjct: 394 EGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIE 453

Query: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523
           +A+ L L PDEFYC  LL+ TGICTVPGSGFGQ  GTYH+RTTFLAPGT WIK WE FHK
Sbjct: 454 EAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHK 513

Query: 524 KFYNEYRD 531
            FY++YRD
Sbjct: 514 AFYDKYRD 521

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/489 (66%), Positives = 398/489 (81%), Gaps = 3/489 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F+PA K++ +DLN +V +A+YAVRG IP +A+ELK +L ++P  LPFD IINANIGNPQQ
Sbjct: 20  FKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQ 79

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS--QIYKPDAIDRAARLLSNIGGSVGAYSH 162
           LDQKPLTF RQVLS+L+ P++L+ +  E+L+   ++  DA+ RA  LL +IGGSVGAYSH
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILQ-VDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138

Query: 163 SQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQ 222
           SQGV G R+TVADFIT RDGGE A  EDI+LT GAS+A + +LS+LC+  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQ 198

Query: 223 YPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTG 282
           YPLYTAS +L N+  LPYYLDEE NWST  +EIEKVV +++ KG+ P  L+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258

Query: 283 AILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQ 342
           A+L+ E+I +I  +AAKYGI VI+DEVYQENVFN  +FHSM+KVL+ LQ  + GKFDN+Q
Sbjct: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318

Query: 343 LASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPP 402
           LASLHS SKG  GECGQRGGYME++GFS D+R    KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378

Query: 403 KPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAV 462
           +PGD SYEQD++ERS+I + +  RA++LYETFN LEGIECQ PQGAMYLFPRL L  KA 
Sbjct: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438

Query: 463 QKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFH 522
           +++E L + PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT WI+ W+ FH
Sbjct: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498

Query: 523 KKFYNEYRD 531
           + F+NEYRD
Sbjct: 499 QSFFNEYRD 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/488 (65%), Positives = 395/488 (80%), Gaps = 1/488 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F+PA K++ +DLN  V +A+YAVRG IP +A+ELK +L R P  LPFD IINANIGNPQQ
Sbjct: 20  FKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQ 79

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS-QIYKPDAIDRAARLLSNIGGSVGAYSHS 163
           LDQKPLTF RQVLS+L+ P++L   P +  S  +++ DA+ RA  LL +IGGS+GAYSHS
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSHS 139

Query: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223
           QGV G R++VA+FITKRD GE A  E+I+LT GAS+A + +LS+LC+  QTG+LIPIPQY
Sbjct: 140 QGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPIPQY 199

Query: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283
           PLYTAS +L N+  LPYYLDE SNWST  +EIEKVV +++ KG++P  L+VINPGNPTGA
Sbjct: 200 PLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGA 259

Query: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343
           +LS ++I KI  +AAKYGI +I+DEVYQENVFNG +FHSM+KVL+ LQR + GKFDN+QL
Sbjct: 260 VLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQL 319

Query: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403
           ASLHS SKG  GECGQRGGYME++GFS D+R    KL SIS+C VVTGQA+VDLMV PP+
Sbjct: 320 ASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQ 379

Query: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463
           PGD SY+QD  ER +I   +  RA++L+ETFN LEGIECQKPQGAMYLFPRL L  KA++
Sbjct: 380 PGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKALR 439

Query: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523
           ++E L + PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT WI+ W+ FH+
Sbjct: 440 ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFHQ 499

Query: 524 KFYNEYRD 531
            F+N+YRD
Sbjct: 500 DFFNKYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/488 (65%), Positives = 395/488 (80%), Gaps = 1/488 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F+PA K++ +DLN  V +A+YAVRG IP +A+ELK +L ++P+ LPFD IINANIGNPQQ
Sbjct: 20  FKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQ 79

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS-QIYKPDAIDRAARLLSNIGGSVGAYSHS 163
           LDQKPLTF RQVL++L+ P++L     E  S  ++  DA++RA RLL++IGGS+GAYSHS
Sbjct: 80  LDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHS 139

Query: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223
           QGV G R+TVADFIT+RDGGE A  EDI+LT GAS+A + +LS+LC+  QTG+LIPIPQY
Sbjct: 140 QGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQY 199

Query: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283
           PLYTAS +L N+  LPYYLDEESNWSTN +EIEKVV +++ K + P  L+VINPGNPTGA
Sbjct: 200 PLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGA 259

Query: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343
           +LS E+I +I  +AAKYGI +I+DEVYQEN+FN  +FHSM+KVL+ LQ  + GKFDN+QL
Sbjct: 260 VLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQL 319

Query: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403
           ASLHS SKG   ECGQRGGYME++GFS ++R    KL SIS+C VVTGQA+VDLMV PP+
Sbjct: 320 ASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQ 379

Query: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463
           PGD SYEQD  ER +I   +  RA++LYETF  LEGIECQKPQGAMYLFPRL L  KA+ 
Sbjct: 380 PGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALC 439

Query: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523
           ++E L + PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT WI+ W+EFH+
Sbjct: 440 ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQ 499

Query: 524 KFYNEYRD 531
            F+++YR+
Sbjct: 500 DFFSKYRN 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/489 (63%), Positives = 395/489 (80%), Gaps = 3/489 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F+PA KL+ +DLN +V +A+YAVRG IP +AEELK +L R   SLPF+ IINANIGNPQQ
Sbjct: 20  FKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQ 79

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS--QIYKPDAIDRAARLLSNIGGSVGAYSH 162
           LDQKPLTF RQVLS+L+ P++L  +  ++L+   ++  DA+ RA RLL +IGGSVGAYSH
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILR-VDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138

Query: 163 SQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQ 222
           SQGV G R+TVADFIT+RDGGE A  EDI+LT GAS+A + +LS+LC+  QTG+L+PIPQ
Sbjct: 139 SQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQ 198

Query: 223 YPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTG 282
           YPLYTAS +L N+  LPYYLDEE++WST  +EIE+VV +++ KG+ P  LVVINPGNPTG
Sbjct: 199 YPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTG 258

Query: 283 AILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQ 342
           A+L+  +I KI  +AAKYGI +I+DEVYQEN+F   +FHSM+K+L+ LQ  H GKFDN+Q
Sbjct: 259 AVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQ 318

Query: 343 LASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPP 402
           LASLHS SKG  GECGQRGGYME++GFS D+R    KL SIS+C V TGQA++DLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPP 378

Query: 403 KPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAV 462
           +PGD SY+QD+KER +I++ +  RA++LYETFN LEGI+CQKPQGAMYLFP+L L  KA+
Sbjct: 379 QPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKAL 438

Query: 463 QKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFH 522
           +++E L++ PD  YC  LLE+TGICTVPGSGFGQ  GTYH+RTTFL PGT WI+ W +FH
Sbjct: 439 RESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFH 498

Query: 523 KKFYNEYRD 531
           + F+N+YRD
Sbjct: 499 QDFFNKYRD 507

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/522 (61%), Positives = 408/522 (78%), Gaps = 2/522 (0%)

Query: 10  SLRMLRTTTAGNIAKNMPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRG 69
           ++ MLR  ++G     +    L  R  SS     +F PA+ ++L D+NENV++AKYAVRG
Sbjct: 2   AIGMLRRNSSGTAVSVLQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVRG 61

Query: 70  KIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEI 129
           KIP +AEEL+ +L   P SLPF +II ANIGNPQQL QKPLTFYRQV+SL+QNP +LE +
Sbjct: 62  KIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLE-M 120

Query: 130 PREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAE 189
           P E L Q +K D + RA R+L + GGSVGAYS SQGV G+R+TVA FI +RDG   A  +
Sbjct: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDG-IPANPD 179

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249
           +++LTAGAS+AVS +LS  C+GP+TGVLIPIPQYPLYTA++  NN+ ALPYYL+E   WS
Sbjct: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239

Query: 250 TNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEV 309
           TNP+E+E+V+ +S  + + PKCLVVINPGNPTG++LS + +E I  +AAKYGIVVIADEV
Sbjct: 240 TNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEV 299

Query: 310 YQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGF 369
           YQ+NVF  A+FHSMRKVLK+LQ +    + N+QLASLHS SKG+SGECGQRGGYMEL+GF
Sbjct: 300 YQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGF 359

Query: 370 SHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASM 429
             ++R+VF+KLASISLCPVVTGQALVDLMV PP  GD SYEQ  +E   I+  L+ R+ +
Sbjct: 360 REELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQL 419

Query: 430 LYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTV 489
           L++TF  LEGIEC  PQGA+YLFP+L L  KA++ A+ L +  DE YC ELL+ TGICTV
Sbjct: 420 LWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTV 479

Query: 490 PGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531
           PG+GFGQ+PGTYH+RTTFL PGT WI++W++FHKKFY++YRD
Sbjct: 480 PGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/492 (63%), Positives = 391/492 (79%), Gaps = 7/492 (1%)

Query: 43  YKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNP 102
           + F+PA KLS++DLN NV++A++AVRG IP KA+EL+ QL ++P SLPF+ I  ANIGNP
Sbjct: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70

Query: 103 QQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQ----IYKPDAIDRAARLLSNIGGSVG 158
           Q+L QKPLTF RQV+S+LQ P++L    R +L+     IY  D+ DRA +LL+ IGGSVG
Sbjct: 71  QELHQKPLTFARQVVSILQYPELLNR--RNELTSTTPPIYNNDSFDRAEKLLNEIGGSVG 128

Query: 159 AYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLI 218
           AYS SQGVYG RKT+A++IT+RD GE A   DIF+T GA+AA SY+LSIL  GPQTGVL+
Sbjct: 129 AYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLL 188

Query: 219 PIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVT-NSIAKGVEPKCLVVINP 277
           PIPQYPLYTA LAL+N+  LPYYL+EES WS +  EIEK +  N++ KG++PK +V+INP
Sbjct: 189 PIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINP 248

Query: 278 GNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGK 337
           GNPTG+ILS +S+ KIF +AAKYGIV+IADEVYQEN+FNG +FHS +KVL+ LQ++   +
Sbjct: 249 GNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQ 308

Query: 338 FDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDL 397
           ++N+QLASLHSTSKG+ GECGQRGGYME++GF++DVR + LKLA I +CPVVTGQA++DL
Sbjct: 309 YNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDL 368

Query: 398 MVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDL 457
           M+ PPK GD SY+ D  ER +IH+ +  RA  LY+ F+ +EGI+CQKPQGAMYLFPRL L
Sbjct: 369 MILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLL 428

Query: 458 SYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKA 517
           S K + +A+   + PDEFYC ELL  TGICTVPGSGFGQ P TYHLRTTFLAPG  WI  
Sbjct: 429 STKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINK 488

Query: 518 WEEFHKKFYNEY 529
           WE+FHK F   Y
Sbjct: 489 WEKFHKAFLKRY 500

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/491 (64%), Positives = 393/491 (80%), Gaps = 5/491 (1%)

Query: 43  YKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQL--ARDPKSLPFDRIINANIG 100
           + F+PA K+S+ DLN+ ++ A+YAVRG I  +AEEL+ +L     P S PF+RII ANIG
Sbjct: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81

Query: 101 NPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQ-IYKPDAIDRAARLLSNIGGSVGA 159
           NPQQLDQKPLTF RQV+S+L+ P +L+      LSQ IYK DA++RA  L S IG SVGA
Sbjct: 82  NPQQLDQKPLTFSRQVMSILEYPGLLK-FKDVLLSQGIYKKDALERAELLQSQIGASVGA 140

Query: 160 YSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIP 219
           YS +QGVYG R+T A FI+KRD  E A A+DIFLT GAS AV+Y++  LC+   TG+LIP
Sbjct: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200

Query: 220 IPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGN 279
           IPQYPLYTAS+ ++N+  LPYYLDEES WST  EEIE  V N+I  G++P  +VVINPGN
Sbjct: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260

Query: 280 PTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFD 339
           PTGA+LS + I++I  VAAKYGIV+IADEVYQ+N+FNG EFHSM+K+L+ LQ+K+ GK+D
Sbjct: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYD 319

Query: 340 NIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMV 399
           N+QLASLHSTSKGVSGECGQRGGYME++GFS +VR + LKLASI++C VVTGQALVDLMV
Sbjct: 320 NVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMV 379

Query: 400 CPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSY 459
            PP  GD SYE+DQ+ER+EIH  L  RA  LY+TF+ LEGIECQKPQGAMYLFPRL L  
Sbjct: 380 DPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPD 439

Query: 460 KAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWE 519
           +A+++A+ L +  DEFYC +LLE TGICTVPGSGFGQ  GTYH+RTTFL+PGT+WI  W+
Sbjct: 440 RAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWK 499

Query: 520 EFHKKFYNEYR 530
           +FH+KF  EY+
Sbjct: 500 KFHEKFMKEYQ 510

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/490 (64%), Positives = 389/490 (79%), Gaps = 6/490 (1%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F PA+KLS+ DLN++ + A YAVRG IP +AE+L  Q+  DP SLPFD+II ANIGNPQQ
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPR--EQLSQ--IYKPDAIDRAARLLSNIGGSVGAY 160
           + QKPLTF RQVLS+L+ P++L + P   E+L Q  +Y+ D I+RA ++L +IGGSVGAY
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILND-PELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121

Query: 161 SHSQGVYGFRKTVADFITKRDGGEE-AYAEDIFLTAGASAAVSYILSILCRGPQTGVLIP 219
           S SQGV GFR+TVADFI KRDG ++ A   DIFLT GAS+AV Y+LSILC GP+ GVLIP
Sbjct: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181

Query: 220 IPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGN 279
           IPQYPLYTA+L L+NS A+PYYL E ++WSTN +EIE  +  S+A GV+P  +V+INPGN
Sbjct: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241

Query: 280 PTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFD 339
           PTGAILS   +  I  ++AKYGI +IADEVYQEN+F G EFHSMRKVL +LQ +  G +D
Sbjct: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301

Query: 340 NIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMV 399
           N+QLASLHSTSKG  GECGQRGGYMEL+GF  +V  + LKLASIS+C VVTGQAL+DL+ 
Sbjct: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361

Query: 400 CPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSY 459
           CPP+PGDASY+ DQ+ER++I   L  RA  LY  F  LEG+ECQ+PQGAMYLFP+L L  
Sbjct: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421

Query: 460 KAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWE 519
           KA++KA  L + PDE+YC+ELL+ATGICTVPGSGFGQ PGTYHLRTTFL PGT+WI+ W 
Sbjct: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481

Query: 520 EFHKKFYNEY 529
           EFH++FY  +
Sbjct: 482 EFHQQFYERF 491

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/483 (63%), Positives = 390/483 (80%), Gaps = 1/483 (0%)

Query: 48  ADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQ 107
           A++L  EDLN NV++AKYAVRG IP  A++LK QL + P +LPF+ +IN+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 108 KPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVY 167
           KPL+F RQVLS+L+ P +L+       S  Y PD+I+RA  LL++IG S+GAYS+SQGV+
Sbjct: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVH 199

Query: 168 GFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYT 227
           G R+TVADFIT RD GE AY +DIFLTAGAS+AVS ILSILC+G QTGVLIPIPQYPLYT
Sbjct: 200 GIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLYT 259

Query: 228 ASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSP 287
           A+L LN++ ALPYYLDE + WST+  EI KV  +S+  G++P CLVVINPGNPTG++L+ 
Sbjct: 260 ATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTV 319

Query: 288 ESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLH 347
           E+I+ +F+VAAKYG+VVIADEVYQ+N+F G+EFHSM+K+L+ LQ++   K+DNIQLASLH
Sbjct: 320 EAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLH 379

Query: 348 STSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDA 407
           S SKG+ GECG RGGY E +GF+ +V+QV  KL+SISLC  V GQALVDLM CPPK G+ 
Sbjct: 380 SCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEP 439

Query: 408 SYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEH 467
           SYE DQ ER  I      R++ LYE FN LEG+ CQKPQGAMY+FP + L + A++ A++
Sbjct: 440 SYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQN 499

Query: 468 LSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYN 527
           L ++PDEFYC+ELL+ATGICTVPGSGFGQ PGTYH+RTTFLAPG +W+K WE+FH +F+ 
Sbjct: 500 LDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFE 559

Query: 528 EYR 530
           +YR
Sbjct: 560 KYR 562

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/490 (63%), Positives = 389/490 (79%), Gaps = 3/490 (0%)

Query: 43  YKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARD--PKSLPFDRIINANIG 100
           + F+PA K++L+DLN+NVL+++YAVRG IP++AEEL+ +L  +    SL F+ I++ANIG
Sbjct: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85

Query: 101 NPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAY 160
           NPQQLDQKPLTF RQV+S+LQ P++L +      + I+K DA++RA  LL +IGGSVGAY
Sbjct: 86  NPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 161 SHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPI 220
           S SQGVYG R+TVA++IT RD GE A  +DIFLT GAS A SY+LS+LC+   TGVLIPI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 221 PQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNP 280
           PQYPLYTA++ L ++  LPYYL+EES WSTN  EIEKVV ++IA  V+P  +VVINPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 281 TGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDN 340
           TG++LS + I  I  + AKYGIV+IADEVYQEN+F+G EFHSM+KVL+ LQ+++ GK+D 
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324

Query: 341 IQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVC 400
           +QLASLHSTSKGVSGECGQRGGYMEL+GF  ++RQ  LKLASISLC V+TGQALVDLMV 
Sbjct: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 401 PPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYK 460
           PPK GD SYE D  ER  IH+ L  RA  LY  F +L+G+ECQKPQGAMYLFP+L     
Sbjct: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 461 AVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEE 520
            + +A + ++SPDEFYC  LLEATGICTVPGSGFGQ  GTYHLRTTFLAPG  W + W+ 
Sbjct: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 521 FHKKFYNEYR 530
           FH++F+++Y+
Sbjct: 505 FHEEFFSKYQ 514

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/489 (60%), Positives = 373/489 (76%), Gaps = 3/489 (0%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F P  K++L+DLN  +++ +YAVRG IP +AEELK QL +DPKSLPF++IINANIGNPQQ
Sbjct: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS---QIYKPDAIDRAARLLSNIGGSVGAYS 161
           L QKPL+F R+VLS+LQ PD+LE+  + Q     ++Y+ D + RA +LL  IGGSVGAYS
Sbjct: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128

Query: 162 HSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIP 221
            SQGV G ++TVAD+ITKRD GE AY EDIFLT GAS+AVS+IL + C GP TGVLIPIP
Sbjct: 129 LSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIP 188

Query: 222 QYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPT 281
           QYPLYTA++ L  + A+ YYL+EE NWS N  E+E  +  SI  G++P  +V+INPGNPT
Sbjct: 189 QYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPT 248

Query: 282 GAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNI 341
           G+IL+ + I  I  ++AKYG+++IADEVYQENVF+G EFHS++KVL+ LQRK+ G ++ +
Sbjct: 249 GSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETV 308

Query: 342 QLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCP 401
           QLASLHSTSKG+ GECGQRGGYMEL+G + DVR   +KL SIS+C VVTGQAL+D++V P
Sbjct: 309 QLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSP 368

Query: 402 PKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKA 461
           P+PGD SYE DQ ER+ I + L +R+  L++ F  LEG+EC +PQGAMYLFP+     K 
Sbjct: 369 PRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKF 428

Query: 462 VQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEF 521
           +  A+ L    D  YC+ELLE TGICTVPGSGFGQ P TYHLRTTFL PG  WI  W +F
Sbjct: 429 IDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKF 488

Query: 522 HKKFYNEYR 530
           H +F   YR
Sbjct: 489 HTEFCERYR 497

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/493 (61%), Positives = 379/493 (76%), Gaps = 7/493 (1%)

Query: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104
           F PA K SL D+NE++L+A+YA+RG IP +AEEL  QL  + KSLPF +I+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQ 164
           LDQ+PLTF RQV+SL+Q PD+L+        +IY  D+I+RA +LL++IGGSVGAYS SQ
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQ 127

Query: 165 GVYGFRKTVADFITKRDGGEE-------AYAEDIFLTAGASAAVSYILSILCRGPQTGVL 217
           GV   RK VA FI KRD   +         A ++FLTAGAS AV +IL +  +    GVL
Sbjct: 128 GVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVL 187

Query: 218 IPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINP 277
           +PIPQYPLYTA++ L  S  LPYYL+E +NWST+P++IE++V ++I + ++P  LVVINP
Sbjct: 188 LPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINP 247

Query: 278 GNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGK 337
           GNPTGAIL+ +SI  I ++AA+YGIV+IADEVYQENV+   EFHS +KVL +L++ +  K
Sbjct: 248 GNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSK 307

Query: 338 FDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDL 397
           +DN+QLASLHS SKGV+GECGQRGGYME+ GFS+DV++V LK+ASIS+C VVTGQ LVDL
Sbjct: 308 YDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDL 367

Query: 398 MVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDL 457
           MV PP+PGD SYE DQ ERS IH  L  +++ LY+ F RL GI CQKPQGAMYLFPRL L
Sbjct: 368 MVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHL 427

Query: 458 SYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKA 517
           S  A+  A  L+L PDEFYC +LLE TGICTVPGSGFGQ PGTYHLRTTFL PG +WI +
Sbjct: 428 SENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINS 487

Query: 518 WEEFHKKFYNEYR 530
           WE+FH +F  +Y+
Sbjct: 488 WEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/493 (57%), Positives = 368/493 (74%), Gaps = 9/493 (1%)

Query: 47  PADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLD 106
           PA K SL D+++++L  +YA+RG IP +A+EL+ QL   P  LPF +II ANIGNPQQL+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 107 QKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGV 166
           Q+PLTF RQVLSL++ P+++        ++IY PDAI RA  +L++IGGSVGAYS SQG+
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQGI 127

Query: 167 YGFRKTVADFITKRDGGE---------EAYAEDIFLTAGASAAVSYILSILCRGPQTGVL 217
              RK VA  I +RD  E            A +IFLT GA+ AVSYIL +  +    GVL
Sbjct: 128 LSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGVL 187

Query: 218 IPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINP 277
           +PIPQYPLYTA++ L NS  LPYYL+E+ NWST+PEEIE ++ ++I++ ++P  LV+INP
Sbjct: 188 LPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIINP 247

Query: 278 GNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGK 337
           GNPTGAILS ESI +I  +AAKYGIV+IADEVYQ N++   +FHS +K+L  L+ ++  K
Sbjct: 248 GNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPKK 307

Query: 338 FDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDL 397
           +DN+QLASLHS SKGV+GECGQRGGY ELLGFS +++++ LKLASI +C VVTGQ LVDL
Sbjct: 308 YDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVDL 367

Query: 398 MVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDL 457
           M  PP+ GD SY+ DQ+ER+ I   L  +++ LY+ F+RL GI CQKPQGAMYLFPRL L
Sbjct: 368 MSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLHL 427

Query: 458 SYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKA 517
           +   + +A+  +L PDEFYC +LLE TGICTVPGSGFGQ  GTYH+RTTFL  G +WIK 
Sbjct: 428 TSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIKL 487

Query: 518 WEEFHKKFYNEYR 530
           WE+FH +F N+Y+
Sbjct: 488 WEKFHLEFMNQYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 83/175 (47%), Gaps = 31/175 (17%)

Query: 159 AYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAA---VSYILS-----ILCR 210
            Y   QG +  RK +A+  +  D       E++ LT GA AA     Y L+      +C 
Sbjct: 54  TYGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAANFLTHYTLAGKGDHFICI 111

Query: 211 GPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPK 270
            P    L  IPQ  ++ A + L        +L +E+N+  N  E+E+++  +       K
Sbjct: 112 SPTYQQLSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERMIKPN------TK 156

Query: 271 CLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRK 325
           C+V+  P NP  +++  E++ +I E+A K+GIVV  DEVY         FHS  K
Sbjct: 157 CIVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVY------SPLFHSCEK 205

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 91/194 (46%), Gaps = 22/194 (11%)

Query: 169 FRKTVADF-----ITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223
           F+K ++D+     I K    +   A+++ L  G+  ++  ++   C   +  +LI    Y
Sbjct: 63  FKKLLSDYRNKTSIFKDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATY 122

Query: 224 PLYTASLALNNSH--ALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPT 281
            +YT    +N+     +P  L EE  +  + E+I + + N  +     K + + +PGNPT
Sbjct: 123 GMYTICSQVNDVEYVTVPLLLSEEDKFQIDEEKILETLQNDPS----IKLVFITSPGNPT 178

Query: 282 GAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNI 341
           G  +    IEKI     + G+VV+ DE Y + V  G++  S+  +          K++NI
Sbjct: 179 GTFIDVNRIEKILS-QWQTGLVVV-DEAYIDFV-EGSDKGSLAPL--------ATKYENI 227

Query: 342 QLASLHSTSKGVSG 355
            +    S S G++G
Sbjct: 228 AVLQTLSKSFGLAG 241

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 73/141 (51%), Gaps = 16/141 (11%)

Query: 189 EDIFLTAGASAAV-SYILSILCRGPQTGVLIP-----IPQYPLYTASLA---LNNSHALP 239
           E++ +T GA+  + + ++ IL +  +  V  P     IP   L    +    +N    L 
Sbjct: 115 ENVLVTTGANEGILACLMGILNQNDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLD 174

Query: 240 YYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAK 299
             + + + W+ + E+ E V+TN      + K +++  P NP G + + E +++I ++  K
Sbjct: 175 KRVTKGTEWTLDFEQFENVITN------KTKAIIINTPHNPIGKVFTREELKRIGDICVK 228

Query: 300 YGIVVIADEVYQENVFNGAEF 320
           + +++I+DEVY +N++   EF
Sbjct: 229 HNVIIISDEVY-DNLYFVDEF 248

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 73/152 (48%), Gaps = 18/152 (11%)

Query: 168 GFRKTVADFITKRDGGEEAY--------AEDIFLTAGASAAVSYILSILCRGPQTGVLIP 219
            F+  +A+F   R+G    Y        AE++ L  G+  ++  I+   C   +  +L+ 
Sbjct: 61  AFKTAMANF---RNGENHQYKDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVL 117

Query: 220 IPQYPLYTASLALNNSHALPY-YLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPG 278
            P Y +Y+    +N+   +    +  ++++  N +E+ K   N  +     K + + +PG
Sbjct: 118 PPTYSMYSVCAHINDVEIVKCPLITSDNSFQANTDEVIKTAQNDPSI----KLIFITSPG 173

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           NPTGA +    IEKI +   + G+VV+ DE Y
Sbjct: 174 NPTGAKVETSRIEKILQNWDR-GMVVV-DEAY 203

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 81/170 (47%), Gaps = 17/170 (10%)

Query: 160 YSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAV-SYILSILCRGPQTGVLI 218
           YS ++G     K +AD  T    G++  A++I +  GA+ A+ S ++ +L +G +  V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPL-YGQQLSADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 219 PIPQYPLYTASLA--------LNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPK 270
           P     +    LA        +N    L   +   + W  + + +EK + +        K
Sbjct: 136 PFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTINS------RTK 189

Query: 271 CLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEF 320
           C+++  P NP G + + E + ++ ++     IV+I+DEVY E+++   EF
Sbjct: 190 CVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVY-EHLYFSDEF 238

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 129/329 (39%), Gaps = 42/329 (12%)

Query: 190 DIFLTAGASAAVSYILSILC-RGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNW 248
           D+  TAG + A    L + C RG    +L+    +    AS         P  +D +   
Sbjct: 134 DVLATAGNTNAWESTLRVFCNRG--DVILVEAHSFSSSLASAEAQGVITFPVPIDADG-- 189

Query: 249 STNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIAD 307
              PE++ KV+ N      +PK L  I  G NPTG  ++    E I+++A KY  +++ D
Sbjct: 190 -IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVED 248

Query: 308 EVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQ-----LASLHST--SKGVSGECGQR 360
           E Y         F  M   +KDL+ +   +    Q     L SL +T  S    G   + 
Sbjct: 249 EPYY--------FLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTEGRVIRM 300

Query: 361 GGYMEL------LGF---SHDVRQVFLKLASISL-CPVVTGQALVDLMVCPPKPGDASY- 409
             + ++      LG+   S  + + +L L  +++  P    Q LV+  +   + G   Y 
Sbjct: 301 DSFSKVLAPGTRLGWITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLS--RWGQKGYL 358

Query: 410 EQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLS 469
           +     R E     D     LY+   + +      P   M+    +D S     K ++ S
Sbjct: 359 DWLLGLRHEYTLKRDCAIDALYKYLPQSDAFVINPPIAGMFFTVNIDASVHPEFKTKYNS 418

Query: 470 LSPDEFYCQELLE----ATGICTVPGSGF 494
              D +  ++ L       G+  VPGS F
Sbjct: 419 ---DPYQLEQSLYHKVVERGVLVVPGSWF 444

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 83/173 (47%), Gaps = 20/173 (11%)

Query: 157 VGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAV-SYILSILCRGPQTG 215
           V  YS ++G      ++ D  T     +E  AE++ +T GA+  + S ++ +L  G +  
Sbjct: 85  VNQYSPTRGRPSLINSLIDLYTPI-YNKELKAENVVVTTGANEGILSCLMGLLNSGDE-- 141

Query: 216 VLIPIPQYPLYTASLALNNSHAL------PYYLDEESN----WSTNPEEIEKVVTNSIAK 265
           V++  P +  Y  ++ L     +      P  LD+ +     W+ + E+ EK +T+    
Sbjct: 142 VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITS---- 197

Query: 266 GVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGA 318
             + K +++  P NP G + + + +  +  +  K+ +V+I+DEVY+   F  +
Sbjct: 198 --KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEHLYFTDS 248

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 138/330 (41%), Gaps = 44/330 (13%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL---PYYLDEES 246
           DI LT G +      L + C     G +I + +   +++SLA   +  +   P  +DE  
Sbjct: 132 DIILTTGNTNGWESTLRVFC---NKGDVI-LAEAHSFSSSLASAEAQGITTFPIPIDEHG 187

Query: 247 NWSTNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVI 305
                PE++E+++ N      +PK L  I  G NPTG  L+ E   +I+ +A K+  ++I
Sbjct: 188 ---IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLII 244

Query: 306 ADEVYQENVFNGAEFHS---MRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGEC----- 357
            DE Y        E+ +    RK ++D+ +  H +F    L SL  T   V  E      
Sbjct: 245 EDEPYY--FLQMGEYIADLDERKKVQDVPKPTHDQF----LGSLAKTFLSVDTEGRVIRM 298

Query: 358 ---------GQRGGYMELLGFSHDVRQVFLKLASISLCPVVTG--QALVDLMVCPPKPGD 406
                    G R G+   L  S  + Q ++ L  +++    +G  Q+LV+ ++   + G 
Sbjct: 299 DSFSKVLAPGSRLGW---LTGSKKLLQPYISLHEMTVQ-AASGFTQSLVNGLLQ--RWGQ 352

Query: 407 ASY-EQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLS-YKAVQK 464
             Y +     R E     D     LYE   + E  +   P   M+    +D S +   + 
Sbjct: 353 DGYIDWLIGLRHEYTLKRDNAIDALYEYAPKHEAFKINPPIAGMFFTINIDASIHPEFET 412

Query: 465 AEHLSLSPDEFYCQELLEATGICTVPGSGF 494
               + +  E Y  + +  +G+  VPG+ F
Sbjct: 413 KFQSNPAMVEQYIYDKVVRSGVLVVPGAWF 442

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 67/138 (48%), Gaps = 15/138 (10%)

Query: 183 GEEAYAEDIFLTAGASAAV-SYILSILCRGPQTGVLIP-----IPQYPLYTASLA---LN 233
           G+E   E++ +T GA+  + S ++ IL  G +  V  P     IP   L    +    +N
Sbjct: 117 GQELKDENVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPIN 176

Query: 234 NSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKI 293
               +   + E  +W+ + EE+ K  T+      + K L++  P NP G + + E + KI
Sbjct: 177 PPKDMDQRIVEGKDWTIDYEELAKAFTS------KTKALILNTPHNPIGKVFTKEELTKI 230

Query: 294 FEVAAKYGIVVIADEVYQ 311
             +  +  +V+I+DEVY+
Sbjct: 231 GNLCVENNVVIISDEVYE 248

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 87/191 (45%), Gaps = 18/191 (9%)

Query: 169 FRKTVADFITKRD---GGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPL 225
           F+  +A F  + D   G E    +++ L  G+   +  ++   CR     +L   P Y +
Sbjct: 62  FKTLLAGFRNRLDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSM 121

Query: 226 YTASLALNNSHALPY-YLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAI 284
           Y+    +N+   +    + E++++  N  E+   + N      + K L + +PGNPTG +
Sbjct: 122 YSVCANINDVEIVECPLITEDNSFQMNVPEVLSTLKND----PKIKLLFITSPGNPTGKL 177

Query: 285 LSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLA 344
           ++ + IE I E     G+VV+ DE Y +        +SM K++         K+ N+ + 
Sbjct: 178 VNKKDIEFILENWTN-GLVVV-DEAYIDFADAEGTTYSMAKLVT--------KYPNLTVL 227

Query: 345 SLHSTSKGVSG 355
              S S G++G
Sbjct: 228 QTLSKSFGLAG 238

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 73/147 (49%), Gaps = 19/147 (12%)

Query: 183 GEEAYAEDIFLTAGASAAV-SYILSILCRGPQTGVLIPIPQYPLYTASLAL--------- 232
           G+E   E+I +T GA+  + S ++ +L  G +  V++  P +  Y +++ L         
Sbjct: 114 GKELKQENITITTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVP 171

Query: 233 -NNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIE 291
            N    L   + E + W+ + E+    +T       + K ++V +P NP G + + E + 
Sbjct: 172 INPPKDLDQRITEGTEWTIDFEQFRNAITP------KTKAVIVNSPHNPIGKVFTKEELT 225

Query: 292 KIFEVAAKYGIVVIADEVYQENVFNGA 318
           K+ E+  +  +++I+DEVY+   FN +
Sbjct: 226 KLGEICVENNVIIISDEVYEFLYFNDS 252

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 11/125 (8%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL---PYYLDEES 246
           D+  T G + A    L + C     G +I + +   +++ LA   +  +   P  +DE  
Sbjct: 132 DVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 247 NWSTNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVI 305
                PE++E+++ N      +PK L  I  G NPTG+ LS +  EKI++VA K+  ++I
Sbjct: 188 ---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 306 ADEVY 310
            DE Y
Sbjct: 245 EDEPY 249

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 76/167 (45%), Gaps = 16/167 (9%)

Query: 189 EDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNW 248
           E++ L  G+   +  ++   C   +  +LI  P Y +Y+    +N+   +   L  E N 
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDN- 146

Query: 249 STNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADE 308
            +   + EKV+  ++      K + + +PGNPTGA++ PE+IEK+     + G VV+ DE
Sbjct: 147 -SFQMDTEKVI-ETLQNDPSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGFVVV-DE 202

Query: 309 VYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSG 355
            Y +    G     +             K+ N+ +    S S G++G
Sbjct: 203 AYIDFCTTGGSVAPLV-----------NKYPNLAVLQTLSKSFGLAG 238

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 72/145 (49%), Gaps = 19/145 (13%)

Query: 185 EAYAEDIFLTAGASAAV-SYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL----- 238
           E  AE++ +T GA+  + S ++ +L  G +  V++  P +  Y  ++ L     +     
Sbjct: 112 ELKAENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPIN 169

Query: 239 -PYYLDEESN----WSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKI 293
            P  LD+ +     W+ + E+ EK +T+      + K +++  P NP G + + E +  +
Sbjct: 170 PPKELDQRNTRGEEWTIDFEQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTL 223

Query: 294 FEVAAKYGIVVIADEVYQENVFNGA 318
             +  K+ +V+I+DEVY+   F  +
Sbjct: 224 GNICVKHNVVIISDEVYEHLYFTDS 248

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249
           D+  T G + A   +L I C    T +L     +    ++      +  P  LDE     
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT-ILAEQFAFSSSISAAEAQGVNVFPIPLDEHG--- 189

Query: 250 TNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADE 308
             P ++E ++ N      +PK L  +  G NPTG+ LS +  E+I+ +A K+  ++I DE
Sbjct: 190 IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIEDE 249

Query: 309 VY 310
            Y
Sbjct: 250 PY 251

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (47%), Gaps = 6/126 (4%)

Query: 187 YAE-DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEE 245
           YA+ D+  TAG + A    L + C    T +L     +     +      +  P  LDE 
Sbjct: 131 YADWDVLATAGNTNAWESTLRVFCNRGDT-ILAEAYSFSSSLYAAEAQGVNVFPVPLDE- 188

Query: 246 SNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVV 304
             +   PE++E ++ N   +  +PK L  I  G NPTG+ LS +   KI+ +A K+  ++
Sbjct: 189 --FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFII 246

Query: 305 IADEVY 310
           I DE Y
Sbjct: 247 IEDEPY 252

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 71/139 (51%), Gaps = 11/139 (7%)

Query: 175 DFITKRDGGEEA--YAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLAL 232
           D + K    +E    A+++ +T GA  A ++++     GP   ++   P Y   ++  ++
Sbjct: 66  DLVAKIHSSDEIQLTADNVLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSM 124

Query: 233 NNSHALPYYLDEESNWSTNPEEIE-KVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIE 291
             +     +L+ E  ++ N ++++ KV  N+       K +V+ NP NP G+++S E + 
Sbjct: 125 FGADVELLHLEAEDGYTPNIQKLKSKVRANT-------KYIVLNNPNNPLGSVISTEKMT 177

Query: 292 KIFEVAAKYGIVVIADEVY 310
           +I + A +  I ++ DEVY
Sbjct: 178 EIIDYAERNEIFIVCDEVY 196

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 70/151 (46%), Gaps = 20/151 (13%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL---PYYLDEES 246
           D  LT G +      L I C     G +I + +   +++SLA   +  +   P  +D + 
Sbjct: 132 DSILTTGNTNGWESTLRIFCN---KGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDSDG 187

Query: 247 NWSTNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVI 305
                PE++E ++ N      +PK L  I  G NPTG+ LS E  E I+++A K+  ++I
Sbjct: 188 ---IIPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIII 244

Query: 306 ADEVYQENVFNGAEFHSMRKVLKDL-QRKHH 335
            DE Y         F      LKDL QRK +
Sbjct: 245 EDEPYY--------FLQTGPYLKDLEQRKKY 267

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPY-YLDEESNW 248
           +I L  G+  ++  I+   C   +  +L+  P Y +Y+    +N+   +    + E++++
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 249 STNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADE 308
             + +++  ++ N      E K L + +PGNPTGA +    IEK+ +   + G+VV+ DE
Sbjct: 149 QMDSDKVLDILNND----QEIKLLFITSPGNPTGAQIETARIEKVLQNWDR-GLVVV-DE 202

Query: 309 VY 310
            Y
Sbjct: 203 AY 204

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 66/123 (53%), Gaps = 7/123 (5%)

Query: 189 EDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNW 248
           +++ +T GA  A ++++S    GP   V+   P Y   ++   +  +      L+ E+++
Sbjct: 82  DNVLITNGAIGA-NFLVSYTLAGPGDHVICVDPTYQQLSSVPKMFGAEVELLELNRENDF 140

Query: 249 STNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADE 308
             +  +++     S+ KG   KC+V+ NP NP G+++   ++E+I  +A K  I VI DE
Sbjct: 141 IPDIGKLK-----SMIKG-NTKCIVLNNPNNPLGSVIPTATLEEIAALARKNEIRVICDE 194

Query: 309 VYQ 311
           VY+
Sbjct: 195 VYR 197

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249
           DI  TAG + A    L + C     G +I + +   +++ LA   +  +  +     +  
Sbjct: 133 DIIATAGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSCLAAAQAQGITTFPIPIDDNG 188

Query: 250 TNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADE 308
             PE++EK++ N      +PK L  I  G NPTG  L    +E+I+ +A K+  +++ D 
Sbjct: 189 IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 309 VYQENVFNGAEFHSMRKVLKDLQRK 333
            Y         F  M K +KD+  +
Sbjct: 249 PYY--------FLQMDKYVKDVNER 265

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 19/148 (12%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL---PYYLDEES 246
           D+F TAG + A    L + C     G +I + +   +++SLA   +  +   P  +D + 
Sbjct: 134 DVFATAGNTNAWESTLRLFC---NRGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 247 NWSTNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVI 305
                PE++ K++ N      +PK L  I  G NPTG  ++    E I+++A K+  +++
Sbjct: 190 ---IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIV 246

Query: 306 ADEVYQENVFNGAEFHSMRKVLKDLQRK 333
            DE Y         F  M   +KDL+ +
Sbjct: 247 EDEPYY--------FLQMNPYIKDLKER 266

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 7/124 (5%)

Query: 188 AEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPY-YLDEES 246
           A+++ L  G+  ++  ++   C   +  +LI  P Y +Y+    +N+   +    + E++
Sbjct: 87  ADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDN 146

Query: 247 NWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIA 306
           ++  N ++    V  ++      K   V +PGNPTGA++   SIEKI     + GIV I 
Sbjct: 147 SFQMNTDK----VIETLQGDSNIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGIVAI- 200

Query: 307 DEVY 310
           DE Y
Sbjct: 201 DEAY 204

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 67/140 (47%), Gaps = 15/140 (10%)

Query: 185 EAYAEDIFLTAGASAAV-SYILSILCRGPQTGVLIP-----IPQYPLYTASLA---LNNS 235
           E  AE++ +T GA+  + S ++ IL  G +  V  P     IP   L    +    +N  
Sbjct: 111 ELKAENVTVTTGANEGILSCLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPP 170

Query: 236 HALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFE 295
             +   + + + W+ + E+    +T+      + K +++  P NP G + + E + +I E
Sbjct: 171 KDMDQRVVKGTEWTVDYEQFANAITD------KTKAVIINTPHNPIGKVFTREELTRIGE 224

Query: 296 VAAKYGIVVIADEVYQENVF 315
           +  K  +V+I+DEVY+   F
Sbjct: 225 ICVKKNVVIISDEVYEHLYF 244

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 74/162 (45%), Gaps = 14/162 (8%)

Query: 160 YSHSQGVYGFRKTVADFITKRDG----GEEAYAEDIFLTAGASAAVSYILSILCRGPQTG 215
           YS +QG+      +  FITK +      E  Y  DI L  G+S ++  +   LC    T 
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLY--DIMLANGSSDSMFKVFETLCDESTTV 194

Query: 216 VLIPIPQYPLYTASLALNNSHALPYYLD-EESNWSTNPEEIEKVVTNSIAKG-----VEP 269
           ++      P+ +  +A   +  +P  L+    +   + E +E ++ N   K       +P
Sbjct: 195 LMEEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLSKP 253

Query: 270 KCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           K L  I+ G NP G  LS E   KI+ +A ++ ++++ D+ Y
Sbjct: 254 KILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 70/142 (49%), Gaps = 19/142 (13%)

Query: 188 AEDIFLTAGASAAV-SYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL------PY 240
           AE++ +T GA+  + S ++ +L  G +  V++  P +  Y  ++ L     +      P 
Sbjct: 131 AENVTVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPK 188

Query: 241 YLDEESN----WSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEV 296
            LD+ +     W+ + E+ E  +T+      + K +++  P NP G + + E +  +  +
Sbjct: 189 ELDQRNTKGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNI 242

Query: 297 AAKYGIVVIADEVYQENVFNGA 318
             K+ +V+I+DEVY+   F  +
Sbjct: 243 CVKHNVVIISDEVYEHLFFTDS 264

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 19/152 (12%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSH---ALPYYLDEES 246
           D+  TAG + A    L + C     G +I + +   +++SLA   +    A P  +D + 
Sbjct: 134 DVVATAGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSSLAAAEAQGIIAFPVPIDADG 189

Query: 247 NWSTNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVI 305
                PE++ K++ N      +PK L  I  G NPTG  ++    E I+++A K+  +++
Sbjct: 190 ---IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIV 246

Query: 306 ADEVYQENVFNGAEFHSMRKVLKDLQRKHHGK 337
            DE Y         F  M   +KDL+ +   +
Sbjct: 247 EDEPYY--------FLQMNAYIKDLKEREKAQ 270

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 5/123 (4%)

Query: 188 AEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESN 247
           AE+I L  G+  ++  ++ + C   +  ++I  P Y +Y+    +N+   +   L  E N
Sbjct: 87  AENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDN 146

Query: 248 WSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIAD 307
             +   +  KV+  ++A+    K + + +PGNPT A++    IEK+       G +V+ D
Sbjct: 147 --SFQMDTSKVL-ETLAQDPTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGLVVVD 201

Query: 308 EVY 310
           E Y
Sbjct: 202 EAY 204

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 70/139 (50%), Gaps = 19/139 (13%)

Query: 188 AEDIFLTAGASAAV-SYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHA--LPYYLDE 244
           A ++ +T GA+  + S ++ +L   P   V++  P +  Y +++ +       +P +  +
Sbjct: 114 ASNVQVTTGANEGILSCLVGLL--NPGDEVIVFEPFFDQYISNIQIPGGKVTYVPMHPPK 171

Query: 245 ESN--------WSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEV 296
           E N        W+ N +E+E  +T       + K L++  P NP G + + E + +I E+
Sbjct: 172 EMNVRNTKGTEWTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEI 225

Query: 297 AAKYGIVVIADEVYQENVF 315
             K+ +V+I+DEVY+   F
Sbjct: 226 CVKHNVVIISDEVYEHLYF 244

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249
           D+  TAG +      L + C     G +I + +   +++SLA   +  +  +        
Sbjct: 134 DVLATAGNTNGWESTLRVFC---NRGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 250 TNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADE 308
             PE++ K++ N  A   +PK L  I  G NPTG  ++    E I+++A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 309 VYQENVFNGAEFHSMRKVLKDLQRK 333
            Y         F  M   +KDL+ +
Sbjct: 250 PYY--------FLQMNPYIKDLKER 266

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 104/238 (43%), Gaps = 55/238 (23%)

Query: 270 KCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKD 329
           KC+++  P NP G + + E + ++ ++  K  I +I+DEVY E+++ G EF  +  + K+
Sbjct: 200 KCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISKE 258

Query: 330 LQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYM-----ELLGFSHDVRQVFLKLASIS 384
           +         ++ L S+ S  K  +   G R G++     ELL +   V +   ++   S
Sbjct: 259 I--------GDLTL-SVGSAGKSFAA-TGWRIGWVVSRNAELLSY---VSKAHTRICFSS 305

Query: 385 LCPVVTGQA-LVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQ 443
             P     A  +D+ +      +  +E  ++E  E       + ++L   F+ L G+   
Sbjct: 306 PSPFQEACAHSIDIGL-----HNGYFENMREEYKE-------KFAILTRVFDEL-GLPYT 352

Query: 444 KPQGAMYL--------------FPR--------LDLSYKAVQKAEHLSLSPDEFYCQE 479
           KP G  ++              FPR          LSY  V +   +++ P EFY +E
Sbjct: 353 KPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFKLSYWLVNELGVVAIPPTEFYIKE 410

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 65/145 (44%), Gaps = 13/145 (8%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249
           D+  TAG + A    L + C     G +I + +   +++ LA   +  +  +     +  
Sbjct: 133 DVVATAGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSCLAAAQAQGITTFPVPIDDKG 188

Query: 250 TNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADE 308
             P ++E ++ N      +PK L  I  G NPTG  L+ E   +IF +A K+  ++I D 
Sbjct: 189 IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 309 VYQENVFNGAEFHSMRKVLKDLQRK 333
            Y         F  M K  +DLQ++
Sbjct: 249 PYY--------FLQMDKYERDLQKR 265

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 70/144 (48%), Gaps = 19/144 (13%)

Query: 183 GEEAYAEDIFLTAGASAAV-SYILSILCRGPQTGVLIPIPQYPLYTASLAL--------- 232
           G E   E++ +T GA+  + S ++ +L  G +  V++  P +  Y +++ L         
Sbjct: 111 GSELKQENVTITTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVP 168

Query: 233 -NNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIE 291
            N    L   + E + W+ + E+ +  +T+      + K +++  P NP G + + E + 
Sbjct: 169 INPPKELDQRVTEGTEWTVDMEQFKNAITS------KTKAVIINTPHNPIGKVFTREELL 222

Query: 292 KIFEVAAKYGIVVIADEVYQENVF 315
           +I  +  +  +++I+DEVY+   F
Sbjct: 223 QIGNICVEKNVIIISDEVYEHLYF 246

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 67/141 (47%), Gaps = 13/141 (9%)

Query: 183 GEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYL 242
           G E   +++ +T GA AA ++++     GP   V+   P Y    +   +  +      L
Sbjct: 73  GPEFNKDNVLVTNGAIAA-NFLIYYTLVGPGDHVICVDPTYAQLYSVPKMFGAEVSLLKL 131

Query: 243 DEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGI 302
            +E  +  N E ++K++ ++       K +++ NP NP G+ +S E++  I ++  +  I
Sbjct: 132 QKEDGFIPNIETLKKMIKSNT------KLIIINNPNNPLGSAISTETLNDICQLCEENNI 185

Query: 303 VVIADEVYQENVFNGAEFHSM 323
            +  DEVY+        FHSM
Sbjct: 186 YLHCDEVYK------PIFHSM 200

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 9/143 (6%)

Query: 169 FRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTA 228
           +R   + F  K +G      ++I L  G+   V  ++   C      VL+  P Y +Y+ 
Sbjct: 70  YRNNTSAF--KSEGLAPISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSV 127

Query: 229 SLALNNSHALPY-YLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSP 287
              +N++  +    + E++++  + + + + ++N  +     K L +  PGNPTGA +S 
Sbjct: 128 FAMINDTEVVECPLITEDNSFDMDLDNVLETLSNDDSI----KLLFITTPGNPTGASIST 183

Query: 288 ESIEKIFEVAAKYGIVVIADEVY 310
           + IE +    +  GIVV+ DE Y
Sbjct: 184 QKIEMLLNNWSA-GIVVV-DEAY 204

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 189 EDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESN- 247
           E++ L  G+  ++  I+   C   +  +L+  P Y +Y+    +N+   +   L  E N 
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 248 WSTNPEEIEKVVTNSIAKGVEP--KCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVI 305
           +  N +++  ++ N      +P  K + + +PGNPTG  +  + IEK+ +     G+VV+
Sbjct: 148 FQLNSDKVLDILKN------DPLIKLVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVVV 200

Query: 306 ADEVY 310
            DE Y
Sbjct: 201 -DEAY 204

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 69/142 (48%), Gaps = 19/142 (13%)

Query: 188 AEDIFLTAGASAAV-SYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL------PY 240
            E++ +T GA+  + S ++ +L  G +  V++  P +  Y +++ L     +      P 
Sbjct: 115 TENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELCGGKVVYVPINPPK 172

Query: 241 YLDEESN----WSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEV 296
            LD  +     W+ + E+ EK +T       + K +++  P NP G + + E +  +  +
Sbjct: 173 ELDLRNTRGEEWTIDFEQFEKAITP------KTKAVIINTPHNPIGKVFTREELTTLGNI 226

Query: 297 AAKYGIVVIADEVYQENVFNGA 318
             K+ +++I+DEVY+   F  +
Sbjct: 227 CVKHNVIIISDEVYEHLYFTDS 248

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 188 AEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESN 247
           +E++ L  G+  ++  I+   C   +  +L+  P Y +Y+    +N+   +   L  ++N
Sbjct: 88  SENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNN 147

Query: 248 -WSTNPEEIEKVVTNSIAKGVEP--KCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVV 304
            +  + E +  V+ N      +P  K L + +PGNPTGA +  E IE + +     G+VV
Sbjct: 148 SFQMDTESVLTVLQN------DPLIKLLFITSPGNPTGARIETERIETVLQNWTD-GLVV 200

Query: 305 IADEVY 310
           + DE Y
Sbjct: 201 V-DEAY 205

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 64/152 (42%), Gaps = 17/152 (11%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNS--HALPYYLDEESN 247
           ++  T G + +    L I C     G  I   QY   ++  A      +  P  LD +  
Sbjct: 135 NVLATTGNTGSWESTLRIFC---NRGDTILAEQYTFSSSVYAAEAQGINVFPVPLDADG- 190

Query: 248 WSTNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIA 306
               PE +E ++ N      +PK L  I  G NPTG+ LS +   +I+ +A K+ +++I 
Sbjct: 191 --LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIE 248

Query: 307 DEVYQENVFNGAEFHSMRKVLKDLQRKHHGKF 338
           DE Y         F  M    KD+ ++    F
Sbjct: 249 DEPYY--------FLQMDAYQKDVSQRKETHF 272

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 8/125 (6%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249
           DI  T G++ A    L I C    T +L    +   Y++S+   ++  L        N  
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 250 TNPEEIEKVVTNSIAK--GVE-PKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVI 305
             PE++E++++N   +  G+  PK L  I  G NPTG  LS      I+ +A KY I+++
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 306 ADEVY 310
            D+ Y
Sbjct: 249 EDDPY 253

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (45%), Gaps = 9/124 (7%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLAL--NNSHALPYYLDEESN 247
           D+  T G + +    L I C     G  I   +Y   ++  A      +  P  LD +  
Sbjct: 135 DVLATIGNTGSWESTLRIFC---NRGDTILAEKYTFSSSVYAAEAQGVNVFPVPLDADG- 190

Query: 248 WSTNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIA 306
               PE +E ++ N   +  +PK L  I  G NPTG+ LS +  ++I+ +A K+  ++I 
Sbjct: 191 --LIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIE 248

Query: 307 DEVY 310
           DE Y
Sbjct: 249 DEPY 252

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 190 DIFLTAGASAAVSYILSILC-RGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNW 248
           D+  T G + A    L + C RG      + + +   +++SLA   +  +  +       
Sbjct: 132 DVVATTGNTNAWESTLRVFCNRGD-----VILAEAHSFSSSLASAEAQGIITFPVPIDAH 186

Query: 249 STNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIAD 307
              PE++E ++ N      +PK L  I  G NPTG+ L+ E  ++I+ +A K+  ++I D
Sbjct: 187 GIIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIED 246

Query: 308 EVY 310
           E Y
Sbjct: 247 EPY 249

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 64/136 (47%), Gaps = 15/136 (11%)

Query: 189 EDIFLTAGASAAV-SYILSILCRGPQTGVLIP-----IPQYPLYTASLA---LNNSHALP 239
           E++ +T GA+  + S ++ I+  G +  V  P     IP   L    +    +N    L 
Sbjct: 116 ENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELD 175

Query: 240 YYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAK 299
             + + + W+ + +E  + +T       + K +++  P NP G + + E + K+  +  +
Sbjct: 176 NRVTKGTEWTVDFDEFTRAITP------KTKAVIINTPHNPIGKVFTREELTKLGNICVE 229

Query: 300 YGIVVIADEVYQENVF 315
             +++IADEVY+   F
Sbjct: 230 NNVIIIADEVYEHLYF 245

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 84/195 (43%), Gaps = 21/195 (10%)

Query: 169 FRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTA 228
           +R   + F  + +G     A++I L  G+  ++  I+   C   +  V++  P Y +Y  
Sbjct: 70  YRNAASAF--REEGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKV 127

Query: 229 SLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPE 288
              +N+   +   L    N S   +E   +   ++ K +  K + + +PGNPTGA +   
Sbjct: 128 CADINDVGYVEVPLISSDN-SFQIDEDRILEQLNLDKSI--KVVFITSPGNPTGACIEVG 184

Query: 289 SIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHS 348
            +EK+       GIVV+ DE Y        +F + +  L  L  KH        L  L +
Sbjct: 185 RVEKLLR-NWTAGIVVV-DEAY-------IDFSADKPSLSPLVNKHP------NLVVLQT 229

Query: 349 TSKGVSGECGQRGGY 363
            SK  SG  G R G+
Sbjct: 230 LSKA-SGLAGIRLGF 243

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 77/165 (46%), Gaps = 20/165 (12%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL---PYYLDEES 246
           ++ +TAG ++A    L I C    T     + +   +++SL+   +  +   P  +D++ 
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT----ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG 187

Query: 247 NWSTNPEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVI 305
                PE++  ++ N   +  +PK L  I  G NPTG+ L  E   +++++A K+  +++
Sbjct: 188 ---IIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIV 244

Query: 306 ADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQ-LASLHST 349
            DE Y         F  M   +KD   +   K  + + LASL  T
Sbjct: 245 EDEPYY--------FLQMEDYVKDPSLRKEVKLSHDEFLASLDQT 281

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/355 (19%), Positives = 145/355 (40%), Gaps = 50/355 (14%)

Query: 157 VGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAV-SYILSILCRGPQTG 215
           V  YS ++G     K++ + + K   G+    +++ +T GA+  + S ++ IL  G +  
Sbjct: 74  VNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDEVI 132

Query: 216 VLIPIPQYPLYTASLALNNSHALPYYLDEE--------SNWSTNPEEIEKVVTNSIAKGV 267
           V  P     +    L       +P +  +E          W  + + +EK   N      
Sbjct: 133 VFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNN------ 186

Query: 268 EPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVL 327
           + K +++  P NP G + + + + K+ ++  ++  VVI+DEVY E+++    F  +  + 
Sbjct: 187 KTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVY-EHLYFTESFPRIANIN 245

Query: 328 KDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYM-----ELLGFSHDVRQVFLKLAS 382
           +D+         N+ L ++ S  K  +   G R G++     +LL +   V +   ++  
Sbjct: 246 EDIA--------NLTL-TVGSAGKSFAA-TGWRIGWIISKNDQLLNY---VSKAHTRICF 292

Query: 383 ISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIEC 442
            S  P+    A           G   +        ++ +    +  +L   F++L G+  
Sbjct: 293 ASPSPLQEACA-----------GSIEHALKIDYFPKMREEYRKKFEILTTAFDKL-GLNY 340

Query: 443 QKPQGAMYL---FPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGF 494
            +P+G  ++   F ++ +    V   E L  + D      L+   GI  +P + F
Sbjct: 341 TQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 60/124 (48%), Gaps = 7/124 (5%)

Query: 188 AEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESN 247
           AE++ L  G+  ++  I+   C   +  ++   P Y +Y+   ++N+   +   L    N
Sbjct: 84  AENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPLVTSDN 143

Query: 248 -WSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIA 306
            +  + E     V +++ K    K + + +PGNPTGA +    IEKI +     GI+V+ 
Sbjct: 144 SFQVDTE----AVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQGILVV- 197

Query: 307 DEVY 310
           DE Y
Sbjct: 198 DEAY 201

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/331 (20%), Positives = 130/331 (39%), Gaps = 75/331 (22%)

Query: 189 EDIFLTAGA-SAAVSYILSILCRGPQTGVLIPIPQYPLYTASLA--------LNNSHALP 239
           E+I +T GA  A +  +++++  G +  V+ P     ++   +A        L N +   
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 240 YYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAK 299
             + E ++W  + E +    T+      + K +++ NP NP G + + + + ++  +   
Sbjct: 159 KRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 300 YGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGE--- 356
            G  +IADEVY+   F       +  + + + +K              + + G +G+   
Sbjct: 213 NGAYIIADEVYEFLQFTPNPLSRISNLSEAIAQK--------------TITIGSAGKIFR 258

Query: 357 -CGQRGGYM-----ELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYE 410
             G R G+M     EL+     V  V +   S S+  V +G  +   + C          
Sbjct: 259 VTGWRVGWMISKNRELVEKVTAV-HVRMGFCSPSISQVASGLGIQRALEC---------- 307

Query: 411 QDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYL--------------FPR-- 454
                   + +  D + S++Y+  + L G+   KPQGA ++              FP   
Sbjct: 308 ---GYFLSMPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPEDYQFPEYL 363

Query: 455 ------LDLSYKAVQKAEHLSLSPDEFYCQE 479
                   +SY   Q+   L L   EFYC+E
Sbjct: 364 KNRARDFFISYWLTQEFCILLLPCSEFYCEE 394

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 188 AEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESN 247
           A+++ L  G+  ++  I+   C   +  +L+  P Y +Y+    +N+   +   L    N
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDN 146

Query: 248 -WSTNPEEIEKVVTNSIAKGVEP--KCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVV 304
            +  N E +  ++ N      +P  K +   +PGNPTGA +    IE++ +     GIVV
Sbjct: 147 SFQMNTEAVLTILNN------DPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNGIVV 199

Query: 305 IADEVY 310
           + DE Y
Sbjct: 200 V-DEAY 204

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 60/124 (48%), Gaps = 7/124 (5%)

Query: 188 AEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLD-EES 246
           A+++ L  G+  ++  I+   C   +  +L+  P Y +Y+    +N+   +   L   + 
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDG 146

Query: 247 NWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIA 306
           ++  + E +  ++ N        K + V +PGNPTGA +    IEK+ +     G+VV+ 
Sbjct: 147 SFQMDTEAVLTILKNDSL----IKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVVV- 200

Query: 307 DEVY 310
           DE Y
Sbjct: 201 DEAY 204

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 188 AEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESN 247
           A+++ L  G+  ++  I+   C   +  +L+  P Y +Y+    +N+   +   L    N
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDN 146

Query: 248 -WSTNPEEIEKVVTNSIAKGVEP--KCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVV 304
            +  + E    ++ N      +P  K + V +PGNPTGA +    IEKI +   + G+VV
Sbjct: 147 SFQMDTEAALTILKN------DPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVV 199

Query: 305 IADEVY 310
           + DE Y
Sbjct: 200 V-DEAY 204

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL---PYYLDEES 246
           DI  T G++      L I C     G  + + +Y  Y++S+   ++  L   P  LD E 
Sbjct: 132 DIITTTGSTQGWDASLRIFC---NKGDTVLLEEY-TYSSSVEAADAQGLNCIPMPLDGEG 187

Query: 247 NWSTNPEEIEKVVTN--SIAKGVE-PKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGI 302
                PE++E+++ N   +   +  PK L  I  G NPTG  LS      I+ +A KY +
Sbjct: 188 ---IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDM 244

Query: 303 VVIADEVY 310
           ++I DE Y
Sbjct: 245 IIIEDEPY 252

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 64/127 (50%), Gaps = 13/127 (10%)

Query: 188 AEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL--PYYLDEE 245
           A+++ L  G+  ++  I+   C   +  +L+  P Y +Y+    +N+   +  P  + + 
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDN 146

Query: 246 SNWSTNPEEIEKVVTNSIAKGVEP--KCLVVINPGNPTGAILSPESIEKIFEVAAKYGIV 303
           S +  + E +  ++ N      +P  K + V +PGNPTGA +    IE++ +   + G+V
Sbjct: 147 S-FQMDVEAVLTILEN------DPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLV 198

Query: 304 VIADEVY 310
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 189 EDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPY-YLDEESN 247
           E+  L  G+  ++  I+   C   +  +L+  P Y +Y+    +N+   +    + E+++
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNS 146

Query: 248 WSTNPEEIEKVVTNSIAKGVEP--KCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVI 305
           +  +  EI  ++ N      +P  K + + +PGNPTGA +  + IE + +     G+V++
Sbjct: 147 FQIDATEILNILAN------DPLIKLVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLVIV 199

Query: 306 ADEVY 310
            DE Y
Sbjct: 200 -DEAY 203

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 55/125 (44%), Gaps = 8/125 (6%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249
           DI  T G++      L I C    T VL+    Y     +      + +P  LD E    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEDYTYSSSVEAADAQGLNCVPMPLDGEG--- 187

Query: 250 TNPEEIEKVVTNSIAKGVE---PKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVI 305
             P ++E+++ N  +   E   PK L  I  G NPTG  LS      I+ +A +Y I++I
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 306 ADEVY 310
            D+ Y
Sbjct: 248 EDDPY 252

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 67/147 (45%), Gaps = 9/147 (6%)

Query: 167 YGFRKTVADFITKRDG--GEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYP 224
           YG  K   D  T   G  G +  A+++ +T GA  A +++L     G    V+   P Y 
Sbjct: 56  YGAIKGSKDLRTLIAGLYGVQFSADNVLVTNGAIGA-NFLLYYTLVGKGDHVICVHPTYS 114

Query: 225 LYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAI 284
              +   +  +      L E+ ++  N + ++K + ++       K +++ NP NP G +
Sbjct: 115 QLYSVPKMFGAEVTLLELSEKDSFLPNLDTLKKAIKSN------TKLIIINNPNNPLGCV 168

Query: 285 LSPESIEKIFEVAAKYGIVVIADEVYQ 311
           +S E +  I E+  +  + +  DEVY+
Sbjct: 169 ISDELLTSICELCKEKNVYLHCDEVYR 195

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 16/157 (10%)

Query: 160 YSHSQGVYGFRKTVADFITKR--DGGEEAYAE-DIFLTAGASAAVSYILSILCRGPQTGV 216
           Y HS G    +  + DF+     +  +  YA+ ++  + G + A    L I C     G 
Sbjct: 102 YGHSNG----QPELLDFLRGHTTEIHDMKYADWEVIASVGNTNAWESTLRIFC---DRGD 154

Query: 217 LIPIPQYPLYT--ASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVV 274
           ++   +Y   +  A+        +P  +D    +   PE++E ++ N      +PK L  
Sbjct: 155 VVLFEEYSFSSCLAACEAQGVTTIPIPIDA---FGIVPEKLEDLLDNWTPNAPKPKLLYT 211

Query: 275 INPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           I  G NPTG  L  +  E I+ +A K+  +++ DE Y
Sbjct: 212 IPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEPY 248

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 70/156 (44%), Gaps = 18/156 (11%)

Query: 167 YGFRK---TVADFI---TKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPI 220
           YGF +    + DF+   T+R    +    D+  T G ++A    L + C     G  I  
Sbjct: 103 YGFSQGQPELMDFVREHTRRLHRMQYADWDVLATVGNTSAWESTLRVFC---NRGDTILA 159

Query: 221 PQYPLYTASLAL--NNSHALPYYLDEESNWSTNPEEIEKVVTN--SIAKGV-EPKCLVVI 275
            +Y   ++ +A       A P  LDE       PE + +++ N      GV  PK L  +
Sbjct: 160 EEYTFSSSLVAAEAQGVRAYPVPLDENG---MVPERLGELLDNWERWHDGVPRPKLLYTV 216

Query: 276 NPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
             G NPTG  LS +  + ++ +A ++ ++++ DE Y
Sbjct: 217 PTGQNPTGTCLSNDRRQAVYRLAQQHDLLIVEDEPY 252

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 80/175 (45%), Gaps = 23/175 (13%)

Query: 189 EDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHAL--PYYLDEES 246
           +++ L  G+   +  ++   C+     +++  P Y +Y+    +N+   +  P  +++ S
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 247 NWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIA 306
                   +E +  + + +      L + +PGNPTG I++ + I  + E   K G+VV+ 
Sbjct: 145 FQMDVKRTLETLKKDDLIR-----LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV- 197

Query: 307 DEVYQE--NVFN----GAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSG 355
           DE Y +    FN      E+ S+ K++         K+ N+ +    S S G++G
Sbjct: 198 DEAYVDFSTYFNEETKKTEYFSVAKLVT--------KYPNLTVLQTLSKSFGLAG 244

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 252 PEEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           PE++EK++         PK L  I  G NPTG  L+ +  ++I+ +A K+  ++I DE Y
Sbjct: 189 PEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249
           D+ +TAG++ A    L + C  P   VL+   +   Y++S+    +  +     E     
Sbjct: 129 DVLITAGSTQAWDASLRLFCN-PGDSVLL---ESWTYSSSVEAAEAQGMYCVGVEIDGHG 184

Query: 250 TNPEEIEKVVTN--SIAKGVE-PKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVI 305
             PE++E ++ N   +  G   PK L VI  G NP G  L+ E    I+ +  KY +V+I
Sbjct: 185 VVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMVLI 244

Query: 306 ADEVY 310
            D+ Y
Sbjct: 245 EDDPY 249

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 244 EESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIV 303
           E + W+ + +E+   +T         K L++  P NP G + + E + +I ++  +  +V
Sbjct: 179 EGTEWTVDYDELRAAITPKT------KALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 304 VIADEVYQENVFNGAEF 320
           +I+DEVY E+++   EF
Sbjct: 233 IISDEVY-EHLYFTPEF 248

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 189 EDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNW 248
           +++ L  G+  ++  ++   C   +  +L   P Y +Y+    +N+   L   L  E N 
Sbjct: 87  DNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDN- 145

Query: 249 STNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADE 308
           S  P+  +KV++  ++     K + + +PGNPTGA +    I KI E  +  G  V+ DE
Sbjct: 146 SFQPDS-QKVIS-ILSSDPLIKLVFLTSPGNPTGAKIDSNIIIKILE--SWDGGFVVVDE 201

Query: 309 VY 310
            Y
Sbjct: 202 AY 203

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 59/140 (42%), Gaps = 31/140 (22%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYL------- 242
           ++ +  G+S A+  +  +LC    T +L      P+  +++ L  +  +P  +       
Sbjct: 123 NVCMANGSSDAMYKVFEVLCDEDSTVMLEEFTFSPV-ISNIKLQGASVVPVKMQLSADPE 181

Query: 243 ----------DEESNWSTNP-EEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESI 290
                     D   NWS  P + + K           PK L  +  G NPTG  LSP   
Sbjct: 182 QQGIDVDRLADLLDNWSVGPYKHLNK-----------PKALYTVATGQNPTGMTLSPTKR 230

Query: 291 EKIFEVAAKYGIVVIADEVY 310
            +I+E+A K+  +++ D+ Y
Sbjct: 231 RRIYEIAQKHDFLIVEDDPY 250

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 74/161 (45%), Gaps = 28/161 (17%)

Query: 159 AYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAA---VSYIL-----SILCR 210
           +Y   +G    R ++A        G +   +DI LT GA  A     Y L      ++C 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGANFLAFYTLVGAGDHVICV 108

Query: 211 GPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPK 270
            P    L  +P+  ++ A + L         L +E ++  N + ++ ++ N+       K
Sbjct: 109 EPTYSQLYSVPE--MFGAEVDL-------LTLKKEDDFLPNLQTLKSMIKNN------TK 153

Query: 271 CLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQ 311
            +++ NP NP G+++  + +++I ++  +  I + +DEVY+
Sbjct: 154 LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           NPTGAI S  S  K+ E+A KY I++I+D+VY
Sbjct: 198 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           NPTGAI S  S  K+ E+A KY I++I+D+VY
Sbjct: 199 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 62/138 (44%), Gaps = 17/138 (12%)

Query: 188 AEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNS----------HA 237
           AE++ +T GA+  +   L+ L   P   V++  P +  Y  ++ L               
Sbjct: 129 AENVQVTTGANEGIFACLAGLV-NPGDEVIVFEPFFDQYIPNIELLGGVVRYVPIRPPAE 187

Query: 238 LPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVA 297
           L   + E + W  + + + + +        + K +++ +P NP G + + E + K+  + 
Sbjct: 188 LSKRVTEGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNIC 241

Query: 298 AKYGIVVIADEVYQENVF 315
            + GI +I+DEVY+   F
Sbjct: 242 VEKGIYIISDEVYEHLYF 259

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 42/75 (56%), Gaps = 7/75 (9%)

Query: 246 SNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVI 305
           + W+ + +E+   +T       + K L++  P NP G + + E + +I  +  +  +V+I
Sbjct: 185 TEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNICVENNVVII 238

Query: 306 ADEVYQENVFNGAEF 320
           +DEVY E+++  +EF
Sbjct: 239 SDEVY-EHLYFTSEF 252

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 268 EPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           +PK L  I  G NPTG  LS E   KI+E+  K+ I+++ D+ Y
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPY 251

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 73/174 (41%), Gaps = 40/174 (22%)

Query: 160 YSHSQGVYGFRKTVADF---ITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGV 216
           YS ++G+     +V +F   I KR         D+ L  G+S ++  I   LC     GV
Sbjct: 132 YSETRGL----PSVVEFSKKIVKRFNPPAYDNWDVLLANGSSDSLFKIFETLC---DEGV 184

Query: 217 LIPIPQYPL------YTAS------LALNNSHA-------LPYYLDEESNWSTNPEEIEK 257
            + + ++         TAS      + +  +H        + Y  D   NW   P +   
Sbjct: 185 TVLMEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQGIDVQYLCDLLENWEVGPYK--- 241

Query: 258 VVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
                ++K   P+ L  I  G NPTG  LSPE  + I+E+A  +  +++ D+ Y
Sbjct: 242 ----HLSK---PRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPY 288

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 77/162 (47%), Gaps = 15/162 (9%)

Query: 160 YSHSQGVYGFRKTVADFITKRDGGEEAYAE---DIFLTAGASAAVSYILSILCRGPQTGV 216
           YS ++G+      +  FI K  G    Y +   ++ L  G+S ++  +   LC    T +
Sbjct: 109 YSETRGLNPLLDFIRYFI-KWIGNSPPYEDSLWEVMLANGSSDSMFKVFETLCDESDTVL 167

Query: 217 LIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKV--VTNSIAKG-----VEP 269
           +      P+ +  +A   +  +P  ++   N+     +I+ +  + N+  +G      +P
Sbjct: 168 MEEFTFVPVISNVMA-TGAKCIPIKVN--LNYEDQGIDIDYLSNLLNNWKEGPYKHLSKP 224

Query: 270 KCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           K L  I+ G NP G  LS E  EKI+++A ++ ++++ D+ Y
Sbjct: 225 KILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPY 266

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 23/32 (71%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           NPTG   S E+  K+ E+A KY +++IAD+VY
Sbjct: 202 NPTGTTYSTETKLKLIEIARKYDMLIIADDVY 233

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 33/173 (19%)

Query: 160 YSHSQGVYGFRKTVADFITKRD----GGEEAYAEDIFLTAGASAAVSYILSILCRGPQTG 215
           Y+ S+G     + V D +++ +      E     D+ L+ G++ ++  +   +C    T 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 216 VLIPIPQYPLYTASLALNNSHALP----YYLDEES-------------NWSTNPEEIEKV 258
           VLI    +    +++    +  +P      LD +S             NWST P +    
Sbjct: 161 VLIEEFTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQLLDNWSTGPYK---- 216

Query: 259 VTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
               +AK   P+ L  I  G NPTG  +     EKI+ +A K+  +++ D+ Y
Sbjct: 217 ---HLAK---PRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPY 263

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 70/338 (20%), Positives = 137/338 (40%), Gaps = 48/338 (14%)

Query: 160 YSHSQGVYGFRKTVADFITKRD----GGEEAYAEDIFLTAGASAAVSYILSILCRGPQTG 215
           Y+ ++G+      V D + + +      E     D+ L+ G++ ++  +   +C    T 
Sbjct: 102 YAETKGLPPLLHFVKDMVCRINRPVFSDETESNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 216 VLIPIPQYPLYTASLALNNSHALPYYLD---EESNWSTNPEEIEKVVTNSIAKGVE---- 268
           V+I    +    +++    +  +P  +D   +      + E++ +++ N      +    
Sbjct: 161 VMIEEFTFTPAMSNVEATGAKVIPIKMDLTFDRERQGIDVEDLTRLLDNWSTGPYKHLNK 220

Query: 269 PKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVYQ-------------ENV 314
           PK L  I  G NPTG  +     EKI+++A K+  +++ D+ Y              EN 
Sbjct: 221 PKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPYGYMYFPSYNPQNPLENP 280

Query: 315 FNGAEFHSMRKVLKDLQRKHHGKFD-NIQLASLHSTSKGVSGECGQRGGYMELLGFSHDV 373
           ++ ++  ++ + L D   K     D + ++  L + SK  +   G R  ++    F   +
Sbjct: 281 YDSSDL-TIERYLNDFLMKSFLTLDTDARVIRLETFSKIFAP--GLRLSFIVANKF---L 334

Query: 374 RQVFLKLASISL-CPVVTGQALV---------DLMVCPPKPGDASYEQDQKERSEIHDAL 423
            Q  L LA I+   P  T QA+V           M       DA +E   K   +I    
Sbjct: 335 LQKILDLADITTRAPSGTSQAIVYSTIKAMAESEMSSSVSFRDAMFESWIKWIMQIASKY 394

Query: 424 DARASM----LYETFNRLEG-IECQKPQGAMYLFPRLD 456
           + R ++    LYET +   G     +P   M++  +LD
Sbjct: 395 NHRKNVTLKALYETESYQAGHFTVMEPSAGMFIIIKLD 432

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 75/174 (43%), Gaps = 35/174 (20%)

Query: 160 YSHSQGVYGFRKTVADFITKRD----GGEEAYAEDIFLTAGASAAVSYILSILCRGPQTG 215
           Y+ ++G+      V DF+++ +      E     D+ L+ G++ ++  +   +C    T 
Sbjct: 102 YAETKGLPPLLHFVKDFVSRINRPAFSDETESNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 216 VLIPIPQYPLYTASLALNNSHALPYYL----DEES-------------NWSTNP-EEIEK 257
           V+I    +    +++    +  +P  +    D ES             NWST P +++ K
Sbjct: 161 VMIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQLLDNWSTGPYKDLNK 220

Query: 258 VVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
                      P+ L  I  G NPTG  +     EKI+++A ++  +++ D+ Y
Sbjct: 221 -----------PRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPY 263

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 76/163 (46%), Gaps = 18/163 (11%)

Query: 160 YSHSQG---VYGFRKTVADFITKRDGGEEAYAE-DIFLTAGASAAVSYILSILCRGPQTG 215
           YS ++G   +  F K +  ++ K      AY   D+ L  G+S ++S + + L     T 
Sbjct: 131 YSDTKGFPQLIDFSKKLVSYLNK-----PAYDNWDVMLANGSSDSLSKVFTTLTDEDVT- 184

Query: 216 VLIPIPQYPLYTASLALNNSHALPYYLD---EESNWSTNPEEIEKVVTN----SIAKGVE 268
           VL+    +    +++  N    +P  +D   + S    N E +++++ N      +   +
Sbjct: 185 VLMEEFTFTPTISNVTANGGIPIPLKVDITDDASQQGINVEYMDQLLENWSTGEYSHLSK 244

Query: 269 PKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           P+ L  I  G NPTG     E  +KI+++  K+ I+++ D+ Y
Sbjct: 245 PRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHDIIIVEDDPY 287

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 69/169 (40%), Gaps = 18/169 (10%)

Query: 157 VGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGV 216
           V  YS ++G      ++  F T     +   A     T    A  S ++ +L  G +  V
Sbjct: 76  VNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIFSILIGLLNPGDE--V 133

Query: 217 LIPIPQYPLYTASLALNNSHAL------PYYLDEE----SNWSTNPEEIEKVVTNSIAKG 266
           ++  P +  Y  ++ L+    +      P  LD        W  + + ++       A  
Sbjct: 134 IVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQIDWDSLQA------AMN 187

Query: 267 VEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVF 315
            + K +++  P NP G + +   + ++ ++  K  +V+I+DEVY+   F
Sbjct: 188 SKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYF 236

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 70/182 (38%), Gaps = 30/182 (16%)

Query: 159 AYSHSQGVYGFRKTVADFITKR------DGGEEAYAEDIFLTAGASAAVSYILSILCRGP 212
            Y  ++G +  R T+  F  +       + G  +  E + LT+GAS  V  IL + C  P
Sbjct: 52  TYGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNIL-LQCTLP 110

Query: 213 QTG----VLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVT--NSIAKG 266
                    I  P Y L          H     ++E    S + + +E  +   +SI   
Sbjct: 111 HNNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAELDSIKAD 170

Query: 267 VEPKCLV-----------------VINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEV 309
           V  +C+                  V    NP+G   S  +  ++ E+A KY I++I D+V
Sbjct: 171 VGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDV 230

Query: 310 YQ 311
           Y 
Sbjct: 231 YD 232

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 54/125 (43%), Gaps = 18/125 (14%)

Query: 195 AGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYY-------LDEESN 247
            GA A  S +LS+        V IP P +P +      N    + YY       LD E  
Sbjct: 122 TGALAVASKLLSLFM---SRSVWIPNPSWPNHANVFQNNGFKEINYYSYYKDGSLDIEG- 177

Query: 248 WSTNPEEIEKVVTNSIAKGVEPKCLVV-INPGNPTGAILSPESIEKIFEVAAKYGIVVIA 306
           W      I+ +  ++  +G +P+C+V+     NPTG   S E  ++I +   +  ++ I 
Sbjct: 178 W------IQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKEQWQRILDKIHELNLIPII 231

Query: 307 DEVYQ 311
           D  YQ
Sbjct: 232 DMAYQ 236

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 63/138 (45%), Gaps = 10/138 (7%)

Query: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249
           D+  TAG++ A    L + C   +T   + + +Y  Y++SL    +  L     +     
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET---VLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 250 TNPEEIEKVVTNS--IAKGVEPKCLVVI-NPGNPTGAILSPESIEKIFEVAAKYGIVVIA 306
              +++ +++ +     +G  PK L  I N  NPTG  L  E   ++  +A++Y  ++I 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 307 DEVY---QENVFNGAEFH 321
           D+ Y   Q N F   E +
Sbjct: 244 DDPYYFLQMNEFGAPELN 261

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 62/136 (45%), Gaps = 15/136 (11%)

Query: 189 EDIFLTAGASAAV-SYILSILCRGPQTGVLIPIPQYPLYTASL--------ALNNSHALP 239
           E+I +T GA+  + + ++S+L  G +  VL P     +Y   +         L     L 
Sbjct: 100 ENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDLK 159

Query: 240 YYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAK 299
               + S W+ + ++    ++       + K +++ +P NPTG + + E +  +  +  +
Sbjct: 160 TRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICVE 213

Query: 300 YGIVVIADEVYQENVF 315
             + +I+DEVY+   F
Sbjct: 214 KNVYIISDEVYENLYF 229

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 75/190 (39%), Gaps = 41/190 (21%)

Query: 159 AYSHSQGVYGFRKTVADFITK------RDGGEEAYAEDIFLTAGASAAVSYILSILCRG- 211
            Y  ++G    R  + +F+ +      RD    +  E + LT+GAS  V   L+IL +  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGV---LNILLQAT 106

Query: 212 -PQTGV----LIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIE---------- 256
            P TGV     I  P Y L                +DE+   S + E +E          
Sbjct: 107 LPHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESID 166

Query: 257 -----------KVVTNSI----AKGVEPKCLVVI-NPGNPTGAILSPESIEKIFEVAAKY 300
                       ++ N I     K V    + VI    NP+G   + E+  K+ E+A KY
Sbjct: 167 PNPVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKY 226

Query: 301 GIVVIADEVY 310
            +++I D+VY
Sbjct: 227 DMLIITDDVY 236

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNG 317
           NP+GA  S E   K+ ++A +Y I++I+D+VY    F+G
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHG 238

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 268 EPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           +P  L  I  G NPTG  LS E   KI+++  K+ I+++ D+ Y
Sbjct: 208 KPTVLYTIATGQNPTGMTLSMEKRRKIYKICQKHDIIIVEDDPY 251

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 268 EPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
            P  L  I+ G NPTG  +S E+  +I+++A KY  +++ D+ Y
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 278 GNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQ 311
            NP+G   S E+ +K+ ++A KY +++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>ZYRO0C00858g Chr3 complement(66260..66559) [300 bp, 99 aa] {ON}
           similar to uniprot|P39724 Saccharomyces cerevisiae
           YAL046C Hypothetical ORF
          Length = 99

 Score = 32.3 bits (72), Expect = 0.73,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 23/96 (23%)

Query: 248 WSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIAD 307
           +S  PEE  K+V + +AK +EPK L V++     G++               + I VI+D
Sbjct: 22  YSQTPEE--KLVYDKLAKALEPKSLQVVDVSGGCGSM---------------FAISVISD 64

Query: 308 EVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343
           +      F G       K++ +L + H   +  +QL
Sbjct: 65  K------FQGLPMVKQHKIVNELLKDHIKSWHGLQL 94

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           NP+G   S E+  ++ E+A KY ++VI D+VY
Sbjct: 203 NPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 23/32 (71%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           NP+G   + E+  ++ E+A KY ++++AD+VY
Sbjct: 205 NPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 13/66 (19%)

Query: 247 NWSTNP-EEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVV 304
           NWS+ P + + K           P+ L  I  G NPTG  +  E+  KI+E+A K+  ++
Sbjct: 229 NWSSGPYKHLNK-----------PRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLI 277

Query: 305 IADEVY 310
           + D+ Y
Sbjct: 278 LEDDPY 283

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 74/178 (41%), Gaps = 30/178 (16%)

Query: 159 AYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRG--PQTG- 215
            Y   +G    R+ + DF   R  G ++  E + L++G+S      LS+L     P T  
Sbjct: 52  TYGPDEGALWVRQQICDF-NNRLFGSDSKPEFLNLSSGSSYGC---LSVLLHTTLPHTNF 107

Query: 216 ---VLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEI-------EKVVTNS--- 262
                I  P Y L           +    +DEE   S N E++       E++  NS   
Sbjct: 108 TRQAFIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGD 167

Query: 263 ---IAKGVEP-----KCLVVINP--GNPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
              I    +P     K ++   P   NP+G   S E+  K+ E+A +Y +++I D+VY
Sbjct: 168 VSIIQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVY 225

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 278 GNPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
            NP+G   S E+  ++ ++A KY ++VI+D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q01802 Saccharomyces cerevisiae YKL106W AAT1
           Mitochondrial aspartate aminotransferase catalyzes the
           conversion of oxaloacetate to aspartate in aspartate and
           asparagine biosynthesis
          Length = 421

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 66/169 (39%), Gaps = 26/169 (15%)

Query: 159 AYSHSQGVYGFRKTVADFITKR---DGGEEAYAEDIFLT-----AGASAAVSYILSILCR 210
           +Y   +G   F+  V  F+ K    +G E      I         GA A  S +LS+   
Sbjct: 78  SYLPIEGCPDFQSNVLQFLYKESCPEGAEFLSKNRISFVQTLSGTGALAVASKLLSLFM- 136

Query: 211 GPQTGVLIPIPQYPLYTASLALNNSHALPYY-------LDEESNWSTNPEEIEKVVTNSI 263
                V IP P +P +      N    + YY       LD +S W    +++E+ V +  
Sbjct: 137 --SKAVWIPNPSWPNHANVFQNNGFKRINYYTYYRDGGLDVDS-WL---QDLEQAVRDGD 190

Query: 264 AKGVEPKCLVV-INPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQ 311
                P+C+V+     NPTG   S E    I +   +  ++ I D  YQ
Sbjct: 191 G---SPQCIVLHACCHNPTGVDPSLEQWRTILDKINELNLIPIIDMAYQ 236

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 13/66 (19%)

Query: 247 NWSTNP-EEIEKVVTNSIAKGVEPKCLVVINPG-NPTGAILSPESIEKIFEVAAKYGIVV 304
           NWST P   + K           P+ L  I  G NPTG  +     EKI+E+A ++  ++
Sbjct: 257 NWSTGPYRHLNK-----------PRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLI 305

Query: 305 IADEVY 310
           + D+ Y
Sbjct: 306 VEDDPY 311

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 84/203 (41%), Gaps = 28/203 (13%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVYQ----ENVFNGAEFHSMRKVLKDLQRKH 334
           NP+G   S ++  K+ E+A +Y +++I+D+VY     E   +       R V  D +   
Sbjct: 199 NPSGNTYSLKTKLKLIELARRYDMLIISDDVYDLLDYEQFLDVLPHVPKRFVHLDRETST 258

Query: 335 HGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASIS------LCPV 388
           H +       S  + SK ++   G R GY E +  +  V Q+    A+ S      L  +
Sbjct: 259 HPENSFGNTLSNATFSKIIA--PGLRFGYTESIS-NKLVLQLSRGGANTSGGTPSQLNSM 315

Query: 389 VTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRL--EGIECQKPQ 446
           + G  L + +V              K    +      R+ ++YE+  R      +CQ  +
Sbjct: 316 IVGTMLKNGLV-------------DKVLHNLRQTYKERSVVMYESIKRWLPRKTQCQLQK 362

Query: 447 GAMYLFPRLDLSYKAVQKAEHLS 469
           G  + +  L L Y AV+  + L+
Sbjct: 363 GGYFTWITLPLGYDAVEIGKMLN 385

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 278 GNPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
            NP+G   S E+  ++ ++A KY +++I D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {ON}
           Anc_2.475 YKL106W
          Length = 443

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 83/205 (40%), Gaps = 20/205 (9%)

Query: 168 GFRKTVADFITKRDGGEEAYAEDIFL-------TAGASAAVSYILSILCRGPQTGVLIPI 220
            +R  V +F+   DG  E   E I+        T   + A+S     L       ++IP 
Sbjct: 97  NYRNKVLNFLF-HDGCPEIGPEIIYQDRVSFVQTLSGTGALSVTARFLSNFISDSIIIPQ 155

Query: 221 PQYPLYTASLALN---NSHALPYYLDEE---SNWSTNPEEIEKVVTNSIAKGVEPKCLVV 274
             +  +      N   N    PYY +E+    +W  +   I+K     +    +P C+++
Sbjct: 156 LSWANHANVFKNNGFRNISYYPYYSNEKIVLKDWLNHLINIQKT-DREVTSNSKPSCILL 214

Query: 275 -INPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQ--ENVFNGAEFHSMRKVLKDLQ 331
                NPTG   + E  ++I +      ++ I D  YQ  E+     + + +RKVL   +
Sbjct: 215 HACCHNPTGLDPTKEQWDQILDTIYDLNLIPIIDMAYQGLESGDVLKDSYLLRKVLN--K 272

Query: 332 RKHHGKFDNIQLASLHSTSKGVSGE 356
           +++    + I L    + + G+ GE
Sbjct: 273 KRYKNWKNGIYLCQSFAKNMGLYGE 297

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFN 316
           NP+G   S  +  K+ E+A KY I++I+D+VY   V++
Sbjct: 199 NPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVYD 236

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 108/283 (38%), Gaps = 29/283 (10%)

Query: 103 QQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLS-QIYKPD--------AIDRAARLLSNI 153
           Q L + P     Q+L L +  +      +  L+  IYK D        ++ RA  ++   
Sbjct: 36  QALGRVPEAMPDQILGLTERFNQDRNPHKVNLTVGIYKDDNGEVTSFPSVARAQLMVEGQ 95

Query: 154 GGSVGAYSHSQGVYGFRKTVADFITKRDG--GEEAYAE---DIFLTAGASAAVSYILSIL 208
            G   AY    G   +   V+DF+       G E  A        T   + A+S     L
Sbjct: 96  RGGRLAYLPIAGCPSYGARVSDFLYSECAPQGREFLASGCVSFMQTLSGTGALSLASLFL 155

Query: 209 CRGPQTGVLIPIPQYPLYTASLALNNSHALP---YYLDEESNWSTNPEEIEKVVTNSIAK 265
                  + +P P +  +     LN    +    YY D   +  +   ++E+    + A 
Sbjct: 156 SNFISKTIWVPQPSWANHMNIFKLNGFEEVRRYRYYEDGAVDVDSWLAQLER----AAAD 211

Query: 266 GVEPKCLVV-INPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMR 324
              P+C+++     NPTG   + E   +I  V    G+V I D  YQ     G E   +R
Sbjct: 212 RPYPQCILLHACCHNPTGVDPTREQWSRILSVINGLGMVPIVDMAYQ-----GLESGDLR 266

Query: 325 KVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELL 367
                L+     ++DN  L   HS +K + G  G+R G + ++
Sbjct: 267 ADAYLLRMCLEHRWDN-GLYVCHSFAKNM-GLYGERVGSLSVV 307

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 24/32 (75%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
           NP+G+  S E+  ++ E+A +Y +++I+D++Y
Sbjct: 191 NPSGSTYSLETRTRLVELARRYDMLLISDDIY 222

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 241 YLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVI-NPGNPTGAILSPESIEKIFEVAAK 299
           Y D  SN   N  E++ +   +  K V    + ++    NP G   S E+  K+ E+A K
Sbjct: 160 YFDSISN--DNSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARK 217

Query: 300 YGIVVIADEVY 310
           + +++++D+VY
Sbjct: 218 HDMLIVSDDVY 228

>TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON}
           Anc_2.420 YLR027C
          Length = 408

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 279 NPTGAILSPESIEKIFEVAAKYGIVVIADEVYQ 311
           NPTG   +PE  E++ +  AKY  + + D  YQ
Sbjct: 186 NPTGMDPTPEEWEQVLDAMAKYHHIALFDSAYQ 218

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 278 GNPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310
            NP+G   S E+  ++ ++A +Y ++VI D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARQYDMLVITDDVY 227

>TPHA0D00620 Chr4 complement(115810..118278) [2469 bp, 822 aa] {ON}
           Anc_8.73 YFL003C
          Length = 822

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 62/146 (42%), Gaps = 29/146 (19%)

Query: 121 QNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKR 180
           +N D L EI R  L ++   D +   ++LLSN   S+        +   +++++  +T R
Sbjct: 316 KNTDSLSEI-RNSLKKLQDLDKL--FSKLLSNQKSSISPEQKINYILSLKESISIILTLR 372

Query: 181 DGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPY 240
                                + I+ ++ +      +  I + PL T    L NS     
Sbjct: 373 ---------------------TEIIKLVPKSKILNEIKEILENPLVTELFTLFNS----- 406

Query: 241 YLDEESNWSTNPEEIEKVVTNSIAKG 266
           Y++E++ W+T+P E++   T +I  G
Sbjct: 407 YINEDARWATSPYELQNQRTYAIKSG 432

>Ecym_5623 Chr5 (1254121..1256373) [2253 bp, 750 aa] {ON} similar to
           Ashbya gossypii AFL187C
          Length = 750

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 187 YAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPL---YTASLALNNSHALPYYLD 243
           Y  DI  + G    +   LS+ C G Q   L P+  YPL    ++S+ +NNS  LP Y  
Sbjct: 129 YLPDIGDSTGGWCLIEGELSVACTGSQNCQL-PLRCYPLAEKSSSSIYVNNSLLLPGYAP 187

Query: 244 EE 245
           EE
Sbjct: 188 EE 189

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%)

Query: 253 EEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQ 311
           E I +   NS+ K  +     V +  NP+G   S ++  K+ ++A  Y I++I D+VY+
Sbjct: 200 ECIRRPNANSMKKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE 258

>Ecym_7288 Chr7 (604427..607600) [3174 bp, 1057 aa] {ON} similar to
           Ashbya gossypii AGL039W
          Length = 1057

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 37/95 (38%), Gaps = 7/95 (7%)

Query: 362 GYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMV-------CPPKPGDASYEQDQK 414
           G  ++L     ++  F KL  + + PV+ G  L  ++          P PG A    D  
Sbjct: 564 GKYKVLSLQIPIKNEFAKLPDLKINPVLRGSFLTSILNLKFLKEPTDPIPGGAVVFNDSN 623

Query: 415 ERSEIHDALDARASMLYETFNRLEGIECQKPQGAM 449
              E +D LD     L E  N +  +EC   Q  M
Sbjct: 624 FFDEENDILDYALLPLDEVSNIIRDLECSSFQSDM 658

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,747,489
Number of extensions: 2477614
Number of successful extensions: 7163
Number of sequences better than 10.0: 148
Number of HSP's gapped: 7297
Number of HSP's successfully gapped: 148
Length of query: 531
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 417
Effective length of database: 40,409,475
Effective search space: 16850751075
Effective search space used: 16850751075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)