Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16984g8.264ON43543520880.0
KLTH0G13640g8.264ON41443611961e-162
Kwal_56.237828.264ON41443911211e-151
AGR084C8.264ON42741410991e-147
Ecym_43068.264ON43441610371e-138
TDEL0F039108.264ON42941610041e-133
ZYRO0C01606g8.264ON43244210011e-132
KLLA0F19184g8.264ON5124139861e-129
NCAS0B050308.264ON4334489581e-126
NDAI0B020008.264ON4334529361e-123
YLR090W (XDJ1)8.264ON4594308311e-106
Kpol_543.408.264ON4144048061e-103
Skud_12.1588.264ON4554278031e-102
Suva_10.1748.264ON4564248011e-102
Smik_12.1498.264ON4604317991e-102
TPHA0A017908.264ON4394537851e-100
KNAG0G020508.264ON4324197169e-90
CAGL0L12276g8.264ON4524396552e-80
KNAG0I019002.243ON4093905232e-61
KAFR0J009402.243ON4113755199e-61
CAGL0J09966g2.243ON4073745182e-60
ADL257C2.243ON4103905153e-60
TBLA0E038102.243ON4103775093e-59
Ecym_32812.243ON4093765084e-59
KLLA0F03333g2.243ON4093745068e-59
Kwal_23.48302.243ON4113775042e-58
Smik_14.2632.243ON4093765033e-58
Kpol_1003.122.243ON4083755014e-58
YNL064C (YDJ1)2.243ON4093764999e-58
SAKL0E08734g2.243ON4113774972e-57
NDAI0D010302.243ON4113944963e-57
Skud_14.2682.243ON4103774936e-57
TPHA0C031102.243ON4073754929e-57
ZYRO0A01496g2.243ON4123794912e-56
KLTH0G09394g2.243ON4113774866e-56
Suva_14.2772.243ON4093764851e-55
NCAS0G030002.243ON4103744659e-53
TDEL0C046002.243ON4113764651e-52
KLTH0G08756g2.218ON4624024251e-46
Kwal_23.30612.218ON4584104182e-45
TDEL0C043502.218ON4624083812e-40
KNAG0M020202.218ON4603683788e-40
Ecym_62368.730ON3743583684e-39
AER427W2.218ON4703753691e-38
KAFR0A041608.730ON3783613605e-38
KNAG0G028808.730ON3783843598e-38
CAGL0F03729g8.730ON3613563571e-37
SAKL0H05258g8.730ON3683613534e-37
KLLA0E07899g2.218ON4954653596e-37
TDEL0B037908.730ON3733573474e-36
SAKL0E09306g2.218ON4613773453e-35
NDAI0E008708.730ON3763553404e-35
KLLA0C07260g8.730ON3683573395e-35
ZYRO0A06226g8.730ON3773703371e-34
Smik_13.4228.730ON3783573352e-34
CAGL0J10296g2.218ON4794613351e-33
NCAS0B005308.730ON3753663282e-33
KLTH0D12496g8.730ON3753563238e-33
YMR214W (SCJ1)8.730ON3773563202e-32
Skud_13.3838.730ON3753553202e-32
Suva_13.3978.730ON3753543193e-32
TPHA0G006308.730ON3933653091e-30
NCAS0G028502.218ON4944003052e-29
AER346W8.730ON3673552604e-24
Ecym_53842.218ON5032462628e-24
TPHA0D005508.61ON4864412538e-23
Skud_14.2532.218ON5323352503e-22
ZYRO0C15048g2.218ON4912482475e-22
TBLA0B034908.730ON3842352439e-22
KAFR0C031608.61ON4983662423e-21
CAGL0J04224g8.61ON5224022397e-21
Kwal_26.90248.730ON3752302332e-20
Smik_14.2492.218ON5332672362e-20
Kpol_1064.408.730ON3872332323e-20
Kpol_1002.1222.218ON5033102334e-20
KNAG0G011308.61ON5004312325e-20
NDAI0G032808.61ON5523942291e-19
YFL016C (MDJ1)8.61ON5114062281e-19
YNL077W (APJ1)2.218ON5282552272e-19
Suva_14.2622.218ON5362542238e-19
TBLA0E036602.218ON4482542165e-18
Suva_6.448.61ON5074092158e-18
ZYRO0F03652g8.61ON4623082149e-18
TPHA0C029802.218ON5542292122e-17
NDAI0F024502.218ON5302911989e-16
TDEL0C008708.61ON4702161952e-15
Kpol_1011.98.61ON4952741863e-14
NDAI0C026101.398ON340691834e-14
NCAS0C039508.61ON5192461846e-14
ZYRO0E04598g1.398ON357691817e-14
AAL008W1.398ON349691809e-14
NDAI0G042501.398ON363691809e-14
Kwal_0.2071.398ON353691809e-14
KLLA0D04818g1.398ON354691801e-13
KAFR0H031501.398ON359691791e-13
Smik_6.638.61ON5102691792e-13
KLTH0H12100g1.398ON350691763e-13
CAGL0H03707g1.398ON349691754e-13
TPHA0B037601.398ON355691754e-13
Skud_6.568.61ON5172341774e-13
NCAS0G036101.398ON327691745e-13
KNAG0I007407.157ON425691755e-13
TBLA0C014801.398ON353691745e-13
Ecym_43727.217ON579671757e-13
TBLA0D026008.61ON5102681741e-12
YNL007C (SIS1)1.398ON352691711e-12
Smik_14.3211.398ON366691711e-12
TDEL0B059601.398ON369691711e-12
KAFR0L007407.217ON364691702e-12
KNAG0H016801.398ON363691702e-12
SAKL0D08778g1.398ON348691702e-12
Skud_14.3201.398ON368691692e-12
AFR507W8.61ON4742511712e-12
Suva_14.3411.398ON359691692e-12
TDEL0H022907.217ON387691693e-12
Ecym_12921.398ON347691673e-12
TBLA0E024907.217ON366661684e-12
Kpol_457.151.398ON357691674e-12
KLTH0A03740g7.217ON395691675e-12
Skud_14.1102.15ON596661686e-12
KLLA0E04423g7.217ON428691676e-12
Kwal_47.181337.217ON393691666e-12
Suva_14.1162.15ON600661669e-12
YNL227C (JJJ1)2.15ON590661661e-11
TPHA0C012607.217ON380691651e-11
ZYRO0D16390g7.217ON398691641e-11
NCAS0C048901.398ON367691622e-11
CAGL0J02750g7.217ON382691622e-11
NDAI0E045607.217ON394691622e-11
KNAG0L013307.217ON396691613e-11
Skud_5.1587.217ON391691613e-11
Suva_5.1507.217ON391691604e-11
NCAS0E029307.217ON387691595e-11
Smik_14.1062.15ON593661606e-11
NCAS0A132107.157ON414691596e-11
TBLA0J018707.157ON470691589e-11
CAGL0L00957g7.217ON373671561e-10
YIR004W (DJP1)7.157ON432691571e-10
Smik_5.1737.217ON391691561e-10
NDAI0A028207.157ON482691561e-10
Ecym_14508.61ON4922841562e-10
NDAI0F038002.15ON638661562e-10
Kpol_1070.227.217ON380691542e-10
YER048C (CAJ1)7.217ON391691542e-10
CAGL0J07370g2.15ON623661552e-10
KLTH0F13398g7.157ON419691533e-10
KLLA0D13464g7.157ON433691533e-10
TBLA0D042407.217ON389661524e-10
KNAG0F008602.15ON626641534e-10
ADR015W7.157ON436691524e-10
SAKL0F04444g7.157ON429691525e-10
Kwal_55.209657.157ON421691515e-10
ZYRO0F15400g2.15ON525691526e-10
SAKL0F08052g7.217ON393691516e-10
Skud_9.1817.157ON421691516e-10
Ecym_44697.157ON433691516e-10
Kpol_1072.48.698ON661691526e-10
Kpol_529.212.15ON622661517e-10
KLTH0B08338g2.15ON590661518e-10
KAFR0H023108.698ON655691501e-09
CAGL0J01936g7.157ON425661491e-09
KLTH0A02882g8.61ON4732181491e-09
ABL194C2.15ON552691501e-09
KLLA0D19602g2.15ON620661482e-09
TDEL0E005002.15ON581661472e-09
KNAG0I008602.350ON219671422e-09
SAKL0E14234g2.15ON678661472e-09
Kwal_23.44202.15ON592661472e-09
KAFR0B047807.157ON423671462e-09
Kwal_47.179578.61ON4782681463e-09
Suva_6.1481.297ON642671473e-09
TBLA0G001702.15ON659661463e-09
Suva_9.2137.157ON431691453e-09
Smik_10.1681.297ON649671463e-09
NCAS0G013602.15ON616661463e-09
KAFR0A079502.15ON551661463e-09
YJL073W (JEM1)1.297ON645671463e-09
KLLA0C02981g1.113ON162691373e-09
KNAG0J018408.698ON650691455e-09
YJR097W (JJJ3)1.113ON172641365e-09
Smik_9.2037.157ON432691435e-09
KLTH0F09944g2.350ON233651395e-09
Ecym_56262.350ON243651395e-09
Smik_15.4378.698ON663691446e-09
Kwal_23.3578singletonOFF85621306e-09
TBLA0A011007.157ON434691436e-09
TDEL0G028002.350ON225651378e-09
NDAI0D005001.113ON190701351e-08
Suva_8.3038.698ON664691421e-08
KLLA0E01629g2.350ON231661361e-08
TDEL0H032107.157ON411691401e-08
KAFR0C024507.217ON373671391e-08
Skud_15.4208.698ON665691402e-08
ZYRO0D10934g8.698ON663661402e-08
TPHA0L007907.157ON446691392e-08
YMR161W (HLJ1)2.350ON224661342e-08
NCAS0C012208.698ON669691392e-08
YOR254C (SEC63)8.698ON663691392e-08
CAGL0H02827g1.297ON656671383e-08
Skud_13.3232.350ON224661333e-08
SAKL0E06050g2.350ON232661333e-08
TDEL0C058801.113ON159681303e-08
NCAS0I028301.185ON491681373e-08
Suva_12.1851.113ON168641294e-08
Smik_10.3851.113ON172641304e-08
TDEL0A064308.698ON666691375e-08
TBLA0B037308.698ON693691365e-08
ZYRO0G03850g7.157ON418671355e-08
CAGL0G07469g8.698ON668691366e-08
TPHA0A028101.185ON492681356e-08
ADR124C1.297ON611671356e-08
Smik_13.3612.350ON224661306e-08
Skud_10.3191.113ON168641277e-08
Kwal_33.135331.113ON161651269e-08
SAKL0B01276gna 1ON292551311e-07
SAKL0H05984g8.698ON658661341e-07
NCAS0D009602.350ON224651281e-07
NDAI0H031802.350ON229651281e-07
CAGL0C04565g1.113ON175681261e-07
AFL190C2.350ON235651281e-07
KLLA0C09823g8.698ON669691321e-07
Skud_10.1691.297ON644671322e-07
TPHA0O019402.15ON598661322e-07
TPHA0G014808.698ON660701312e-07
KLLA0D06402g1.297ON631671312e-07
Suva_13.3402.350ON225661272e-07
TPHA0C045902.350ON233651262e-07
KLTH0H10032g1.297ON607661303e-07
Kwal_14.24521.297ON607661293e-07
ZYRO0F15972g1.113ON162681223e-07
Kpol_1027.131.297ON641661294e-07
KNAG0B052401.297ON668661285e-07
Kpol_526.62.350ON228651245e-07
Ecym_23748.698ON661691276e-07
CAGL0H04499g2.350ON232651237e-07
KLLA0D07656g8.61ON4712851267e-07
SAKL0C05456g1.185ON583671268e-07
YJL162C (JJJ2)1.185ON583671269e-07
TDEL0C036801.185ON556671269e-07
ZYRO0A07502g2.350ON238661229e-07
TBLA0C027201.297ON715671251e-06
NCAS0A093201.297ON635671242e-06
Kpol_499.307.157ON408691232e-06
SAKL0D06226g1.297ON615671232e-06
TBLA0B093802.350ON227651192e-06
KAFR0A016201.297ON665661223e-06
ADL111W7.217ON578691213e-06
Smik_10.681.185ON560671213e-06
KAFR0F018101.185ON555681213e-06
KLTH0F04906g1.185ON590671214e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16984g
         (435 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   808   0.0  
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   465   e-162
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   436   e-151
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   427   e-147
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   404   e-138
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   391   e-133
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   390   e-132
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   384   e-129
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    373   e-126
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    365   e-123
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   324   e-106
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   315   e-103
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   313   e-102
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   313   e-102
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   312   e-102
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   306   e-100
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   280   9e-90
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   256   2e-80
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   206   2e-61
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   204   9e-61
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   204   2e-60
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   202   3e-60
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   200   3e-59
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   200   4e-59
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   199   8e-59
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   198   2e-58
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   198   3e-58
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   197   4e-58
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   196   9e-58
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   196   2e-57
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   195   3e-57
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   194   6e-57
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   194   9e-57
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   193   2e-56
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   191   6e-56
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   191   1e-55
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   183   9e-53
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   183   1e-52
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   168   1e-46
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   165   2e-45
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   151   2e-40
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   150   8e-40
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   146   4e-39
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   146   1e-38
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   143   5e-38
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   142   8e-38
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   142   1e-37
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   140   4e-37
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   142   6e-37
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   138   4e-36
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   137   3e-35
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   135   4e-35
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   135   5e-35
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   134   1e-34
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   133   2e-34
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   133   1e-33
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      130   2e-33
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   129   8e-33
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   127   2e-32
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   127   2e-32
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   127   3e-32
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   123   1e-30
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    122   2e-29
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...   104   4e-24
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   105   8e-24
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...   102   8e-23
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...   100   3e-22
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   100   5e-22
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    98   9e-22
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    98   3e-21
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    97   7e-21
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    94   2e-20
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    96   2e-20
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    94   3e-20
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    94   4e-20
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    94   5e-20
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    93   1e-19
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    92   1e-19
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    92   2e-19
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    91   8e-19
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    88   5e-18
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    87   8e-18
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    87   9e-18
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    86   2e-17
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    81   9e-16
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    80   2e-15
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    76   3e-14
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               75   4e-14
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    75   6e-14
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    74   7e-14
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    74   9e-14
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    74   9e-14
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    74   9e-14
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    74   1e-13
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    74   1e-13
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    74   2e-13
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    72   3e-13
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    72   4e-13
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    72   4e-13
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    73   4e-13
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      72   5e-13
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    72   5e-13
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    72   5e-13
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    72   7e-13
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    72   1e-12
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    70   1e-12
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    70   1e-12
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    70   1e-12
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    70   2e-12
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    70   2e-12
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    70   2e-12
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    70   2e-12
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    70   2e-12
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    70   2e-12
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    70   3e-12
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    69   3e-12
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    69   4e-12
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    69   4e-12
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    69   5e-12
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    69   6e-12
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    69   6e-12
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    69   6e-12
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    69   9e-12
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    69   1e-11
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    68   1e-11
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    68   1e-11
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     67   2e-11
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    67   2e-11
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             67   2e-11
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    67   3e-11
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    67   3e-11
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    66   4e-11
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     66   5e-11
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    66   6e-11
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    66   6e-11
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    65   9e-11
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    65   1e-10
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    65   1e-10
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    65   1e-10
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    65   1e-10
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    65   2e-10
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      65   2e-10
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    64   2e-10
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    64   2e-10
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    64   2e-10
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    64   3e-10
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    64   3e-10
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    63   4e-10
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    64   4e-10
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    63   4e-10
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    63   5e-10
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    63   5e-10
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    63   6e-10
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    63   6e-10
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    63   6e-10
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    63   6e-10
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    63   6e-10
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    63   7e-10
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    63   8e-10
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    62   1e-09
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    62   1e-09
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    62   1e-09
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    62   1e-09
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    62   2e-09
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    61   2e-09
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    59   2e-09
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    61   2e-09
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    61   2e-09
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               61   2e-09
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    61   3e-09
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    61   3e-09
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    61   3e-09
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    60   3e-09
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    61   3e-09
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    61   3e-09
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    61   3e-09
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    61   3e-09
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    57   3e-09
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    60   5e-09
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    57   5e-09
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    60   5e-09
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    58   5e-09
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    58   5e-09
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    60   6e-09
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    55   6e-09
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    60   6e-09
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    57   8e-09
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    57   1e-08
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    59   1e-08
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    57   1e-08
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    59   1e-08
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    58   1e-08
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    59   2e-08
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    59   2e-08
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    58   2e-08
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    56   2e-08
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     58   2e-08
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    58   2e-08
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    58   3e-08
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    56   3e-08
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    56   3e-08
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    55   3e-08
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    57   3e-08
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    54   4e-08
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    55   4e-08
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    57   5e-08
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    57   5e-08
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    57   5e-08
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    57   6e-08
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    57   6e-08
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    57   6e-08
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    55   6e-08
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    54   7e-08
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    53   9e-08
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    55   1e-07
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    56   1e-07
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    54   1e-07
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      54   1e-07
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    53   1e-07
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    54   1e-07
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    55   1e-07
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    55   2e-07
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    55   2e-07
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    55   2e-07
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    55   2e-07
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    54   2e-07
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    53   2e-07
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    55   3e-07
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    54   3e-07
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    52   3e-07
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    54   4e-07
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    54   5e-07
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    52   5e-07
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    54   6e-07
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    52   7e-07
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    53   7e-07
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    53   8e-07
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    53   9e-07
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    53   9e-07
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    52   9e-07
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    53   1e-06
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    52   2e-06
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    52   2e-06
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    52   2e-06
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    50   2e-06
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    52   3e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    51   3e-06
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    51   3e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    51   3e-06
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    51   4e-06
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    49   4e-06
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    51   4e-06
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    50   4e-06
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    49   5e-06
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    50   5e-06
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    48   6e-06
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    49   6e-06
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    50   6e-06
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    48   8e-06
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    49   9e-06
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    50   1e-05
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    49   1e-05
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    50   1e-05
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    50   1e-05
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    49   1e-05
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    49   1e-05
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    49   1e-05
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    49   2e-05
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    49   2e-05
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    49   2e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    49   2e-05
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    49   2e-05
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    49   2e-05
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       48   3e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    48   3e-05
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    48   4e-05
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    48   4e-05
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    47   5e-05
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    47   5e-05
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    45   7e-05
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    45   7e-05
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    46   8e-05
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    46   9e-05
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    45   1e-04
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    45   2e-04
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    45   2e-04
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    45   2e-04
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    45   2e-04
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    45   3e-04
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    44   3e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    44   4e-04
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    44   4e-04
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    44   5e-04
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    42   5e-04
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    44   5e-04
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    44   5e-04
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    44   5e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    44   6e-04
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    44   6e-04
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    44   6e-04
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    44   6e-04
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    42   8e-04
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    43   8e-04
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    43   0.001
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    42   0.001
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    42   0.003
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    40   0.003
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    41   0.004
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    41   0.004
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    41   0.004
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    41   0.006
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    40   0.006
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    40   0.006
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    40   0.007
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    40   0.009
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    39   0.010
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         40   0.010
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    40   0.010
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    40   0.012
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    39   0.016
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    39   0.019
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    38   0.025
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    38   0.028
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    38   0.029
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    38   0.046
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    38   0.049
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    37   0.050
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    37   0.074
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    37   0.081
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    37   0.10 
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    36   0.14 
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    36   0.14 
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    36   0.16 
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    36   0.17 
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    36   0.20 
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    35   0.21 
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    35   0.24 
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    35   0.32 
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    35   0.33 
KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON...    34   0.34 
Ecym_7225 Chr7 complement(466300..466908) [609 bp, 202 aa] {ON} ...    34   0.37 
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    34   0.52 
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    34   0.55 
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    34   0.70 
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    33   0.89 
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    33   1.1  
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    33   1.1  
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    33   1.2  
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    32   1.4  
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    33   1.5  
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    33   1.6  
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    32   1.7  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    32   1.8  
Skud_2.145 Chr2 (271582..274335) [2754 bp, 917 aa] {ON} YBR033W ...    33   2.2  
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    32   2.3  
NDAI0F02040 Chr6 (502138..503286) [1149 bp, 382 aa] {ON} Anc_6.153     32   2.6  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    31   3.1  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    31   3.4  
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    32   3.7  
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    32   4.1  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    31   4.9  
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    31   5.2  
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    31   5.9  
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    30   8.4  
Smik_16.233 Chr16 (429105..430493) [1389 bp, 462 aa] {ON} YPL003...    30   9.3  
Kpol_1002.89 s1002 complement(231120..232232) [1113 bp, 370 aa] ...    30   9.4  

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/435 (91%), Positives = 397/435 (91%)

Query: 1   MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD 60
           MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD
Sbjct: 1   MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD 60

Query: 61  EDSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRT 120
           EDSRKKYDVY                    MNFFRTYAGGGFYDEPRQPYPEEENRSVRT
Sbjct: 61  EDSRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSVRT 120

Query: 121 SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH 180
           SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH
Sbjct: 121 SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH 180

Query: 181 KERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
           KERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS
Sbjct: 181 KERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240

Query: 241 RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFE 300
           RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFE
Sbjct: 241 RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFE 300

Query: 301 KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNW 360
           KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNW
Sbjct: 301 KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNW 360

Query: 361 FSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYLSXXXXXXXXX 420
           FSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYLS         
Sbjct: 361 FSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYLSYEKGEYQGQ 420

Query: 421 XXXXXXXXXPQCAQQ 435
                    PQCAQQ
Sbjct: 421 EQEYGAFEEPQCAQQ 435

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  465 bits (1196), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 233/436 (53%), Positives = 304/436 (69%), Gaps = 30/436 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           YE LGVAPDA+Q EIKKAYR+LALQHHPDKV+DE LR+ESE+KFKE+ AAYE+LS+E+ R
Sbjct: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDAR 124
           + YD Y                     +FF  +A   + DE    Y  +   S RT DA 
Sbjct: 64  QNYDTYGDTNGFSGDYSGFQDGDF--ASFFGNFASNRYQDE----YEAQSPPSPRTDDAH 117

Query: 125 IPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERI 184
           +P++L+M+ELYNGKT +F++KRNV+C+RC+G+G+R++     R    C  CEGHG K+R+
Sbjct: 118 VPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRR----ARHASACSQCEGHGVKQRL 173

Query: 185 KRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNGD 244
           +R+  GFV RE V+C++C G G+    + ED CKKCHGK V  E K L VYIPRGSR+GD
Sbjct: 174 RRLGPGFVTREIVQCDKCKGLGKNL--RSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGD 231

Query: 245 IVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVT 304
            V L+GEAD+EP K+ GDL+F I EN   S++LERRG DL+ ++ ISLS+A+TGFEK V 
Sbjct: 232 RVVLKGEADEEPGKIPGDLVFDIAEN-SASSSLERRGSDLYAKITISLSDALTGFEKEVC 290

Query: 305 TTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWFSEK 364
           TTLD R+LKLK+P G+V+RPGN++R++NEGWPLDD G+KFGDMYVQ+ IEFPPD+WFSE+
Sbjct: 291 TTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSER 350

Query: 365 SDVEVLRTLLPEVPNARV-----ADTGDLNNTETVIDYSVVKSADELPDYLSXXXXXXXX 419
           SDV+ L+ LLP+  ++       A   D  NTET + +S+VKSA+ELP YLS        
Sbjct: 351 SDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLS-------- 402

Query: 420 XXXXXXXXXXPQCAQQ 435
                     PQCAQQ
Sbjct: 403 ----EESEPGPQCAQQ 414

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  436 bits (1121), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 230/439 (52%), Positives = 302/439 (68%), Gaps = 36/439 (8%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y+ LGVAPDA+Q EIKKAYR+LALQHHPDKV+DE LREESE+KFKE+ AAYE+LS+E+ R
Sbjct: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRS---VRTS 121
           + YD Y                     +FF  +A G + DE       E+ R+    RT 
Sbjct: 64  RNYDTYGDTNGYSDSYGGFQDGDF--ASFFGNFASGRYEDE-------EDFRAHARPRTD 114

Query: 122 DARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHK 181
           DA + L+L+M++LYNGKT +F+S RNV+C+RC+G+G+RK+     R    C  CEGHG K
Sbjct: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKR----ARHASACTHCEGHGVK 170

Query: 182 ERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSR 241
           +R++R+  GFV RETV+C +C G G+    + ED CKKCHGK V  E K L VYIPRGSR
Sbjct: 171 QRLRRLGPGFVTRETVQCTKCRGLGKNL--RSEDLCKKCHGKRVTPETKNLNVYIPRGSR 228

Query: 242 NGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEK 301
           + D + LEGEAD+EP K+TGDL+F I E+  T++NLERRG DLHT++ ISLS+A+TGFEK
Sbjct: 229 HNDRIVLEGEADEEPGKLTGDLVFDISED-STTSNLERRGSDLHTKIIISLSDALTGFEK 287

Query: 302 VVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWF 361
            V TTLD R L+LKIP G+VIRPGNYI L+NEGWPLDD G KFG+MYVQ++IEFPPD+W+
Sbjct: 288 EVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWY 347

Query: 362 SEKSDVEVLRTLLPEVPNARVADTG-----DLNNTETVIDYSVVKSADELPDYLSXXXXX 416
           SE+ ++E LR ++P+  ++  A +      D  NTE +  + ++KSA+ELP+YL      
Sbjct: 348 SERGEIEALRNIIPQSTSSSAASSSASAEPDPVNTE-MPTFDILKSAEELPNYLP----- 401

Query: 417 XXXXXXXXXXXXXPQCAQQ 435
                        PQC+QQ
Sbjct: 402 ------DDAEQGGPQCSQQ 414

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  427 bits (1099), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 210/414 (50%), Positives = 288/414 (69%), Gaps = 15/414 (3%)

Query: 1   MTK-LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILS 59
           MT+ LYEVLG+A  AS+ E+K+AYR+LAL++HPDK++DE  RE SE KFKEI+AAY +LS
Sbjct: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60

Query: 60  DEDSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEEN---R 116
           DE  R +YD +                    MNFFR  AG       R  Y  EE+    
Sbjct: 61  DEQKRAEYDQFGTVDGGYGHDEFGHGDDDF-MNFFRYGAG-------RHGYQHEEDDFEE 112

Query: 117 SVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCE 176
             RT+D+ +PLKL+ K+LY GKTF+F+++R VLC RC GSGLRK+    P   + C+ CE
Sbjct: 113 VGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPM--IRCEGCE 170

Query: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYI 236
           G G+KERI R+  G + RE V C  C GKG+  PT   D+CKKC GKCV+ EE  ++VY+
Sbjct: 171 GQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYV 230

Query: 237 PRGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAI 296
           PRGS++GD ++  G++D EP K TGDL+FVI+E  + S++LER+G DL+  +KISL+EA+
Sbjct: 231 PRGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEAL 290

Query: 297 TGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
           TGF ++VT T D+R+L++ IP+GKV+RPGNY++  NEGWP++D G +FGDMYVQV IEFP
Sbjct: 291 TGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIED-GARFGDMYVQVLIEFP 349

Query: 357 PDNWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYL 410
            DNWF+EK++++ +R +LP + +A    T D +NTE V  YS++ +   LPDYL
Sbjct: 350 KDNWFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYL 403

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  404 bits (1037), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 200/416 (48%), Positives = 278/416 (66%), Gaps = 17/416 (4%)

Query: 4   LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           LY VLG+  +A++ E+K+AYR LAL +HPDK++DE  R ESE KFKEI+AAY+ILSDE  
Sbjct: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 64  RKKYDVYXXXXXXX----XXXXXXXXXXXXXMNFFRTYAGG-GFYDEPRQPYPEEENRSV 118
           R +YD Y                        MNFFR  AG  G Y++       E+  S 
Sbjct: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDA------EQKTSQ 118

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           +T D  +PLKLS K+LY GKTF+F+ KRNVLC +C+G GLRK+       P+ C  C+G 
Sbjct: 119 KTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHC--MPMKCGICDGR 176

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G KER+ R++ GF+ RE V C+ C+GKG      P D+CKKCHGKCVI E   LT+Y+PR
Sbjct: 177 GFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPR 236

Query: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298
           G R+ D ++++G+AD E  K TGDL+F I+E  +    LER+G DLH  + ISL+EA+TG
Sbjct: 237 GHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTG 296

Query: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358
           F ++V  T DDR+L++ IP GKV+RPGNY++  NEGWP+++ G++FGD+YV+V+IEFP D
Sbjct: 297 FTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN-GSRFGDLYVKVNIEFPKD 355

Query: 359 NWFSEKSDVEVLRTLLPEVPNARVADTGDLN---NTETVIDYSVVKSADELPDYLS 411
           NW +EKS++E ++ +LP + N+  +  GD +   NTE +  Y V++ +  LPDYL+
Sbjct: 356 NWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLA 411

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  391 bits (1004), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 209/416 (50%), Positives = 274/416 (65%), Gaps = 19/416 (4%)

Query: 1   MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD 60
           M+ LYE+LGV  DA+Q EIKKAYRK ALQHHPDKVADE LREESE++FKEI AAYE+L D
Sbjct: 1   MSTLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGD 60

Query: 61  EDSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSV-R 119
           E+ R +YD Y                    MNFF +     F   P+  Y     + V R
Sbjct: 61  EEKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHS-----FGSNPQNAYDHYGEQKVDR 115

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQH--PRKPVVCQSCEG 177
           ++D ++PL +SM + YNGK+FKF+SKR ++CDRC GSG R++   H  P   V C+ C G
Sbjct: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRR-NDHVVPPPQVECKKCGG 174

Query: 178 HGHKERIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTVY 235
            G K+RI+R+A GF   E + C  C+GKG+  + P   ++ CKKC G  V +E K+LTV 
Sbjct: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVS 234

Query: 236 IPRGSRNGDIVKLEGEADQEPDKV-TGDLLFVIEENPET--STNLERRGDDLHTRLKISL 292
           +PRGSR  D + L+GEADQE  K  TG+L+F I+E  E     +L+R G DL T L +SL
Sbjct: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSL 294

Query: 293 SEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVH 352
           +EAITGF K +T TLD RIL+L+IP GKVIRPGN I++ +EGWP+D + +  GD+YV VH
Sbjct: 295 AEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVH 352

Query: 353 IEFPPDNWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPD 408
           IEFPPDNWFSE+SD+  ++ +LP   N   A   D  NTETV + ++V   +E+PD
Sbjct: 353 IEFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIV---EEIPD 405

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  390 bits (1001), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/442 (49%), Positives = 282/442 (63%), Gaps = 22/442 (4%)

Query: 4   LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           LY+ LGV+ DA+Q EIKKAYRKLALQHHPDKV D+ +REESE++FKEITAAYE+LSDE+ 
Sbjct: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 64  RKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTY-AGGGFYDEPRQPYPEEENRSVRTSD 122
           R KYD Y                    MNFF  + +G GF       +P  +    R+ D
Sbjct: 63  RSKYDTYGDTADGPDFEDESF------MNFFTQFNSGFGFNGGGGGGFPGAQPGDDRSDD 116

Query: 123 ARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKE 182
            ++PLK+SM + YNGK FKF+SKR ++C++C+GSG R++    P +   C+SC+G G+KE
Sbjct: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGPPPQ-TNCKSCQGRGYKE 175

Query: 183 RIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
           +++RVA G V ++TV C  C+GKG+  + PT  ++ CKKC G+ +I E K LTV IPRGS
Sbjct: 176 QLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGS 235

Query: 241 RNGDIVKLEGEADQEPDKV-TGDLLFVIEEN--PETSTNLERRGDDLHTRLKISLSEAIT 297
           R+GD +  EGEADQE  K  TGDL+F+++E   P     LERRG DL T + ISL+EAIT
Sbjct: 236 RHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAIT 295

Query: 298 GFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPP 357
           G ++ +T TLD R+LKL  P GKVI PG  I++E EGWPL+    KFGD+YV V I FP 
Sbjct: 296 GLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPR 355

Query: 358 DNWFSEKSDVEVLRTLLP-EVPNARVADTGDLNNTETVIDYSVVKSADELPDYLSXXXXX 416
           DNWF+EKSD+  +R +LP E  N  V    D  NTE V D  +V   D+LPDY+      
Sbjct: 356 DNWFAEKSDLLKIRNILPSEAANNDV--KADPGNTEQVSDMKLV---DQLPDYMGSNGDQ 410

Query: 417 XXXXXXXXXX---XXXPQCAQQ 435
                           PQCAQQ
Sbjct: 411 YAHEGHASGAFPDDGTPQCAQQ 432

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  384 bits (986), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 203/413 (49%), Positives = 267/413 (64%), Gaps = 13/413 (3%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y+VLGV  DA++ EI+KAYRKLAL++HPDK+ DE  RE SE  FKE+TAAYEILSD + +
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 65  KKYDVYXXXXXXXXXXX--XXXXXXXXXMNFFRTYA----GGGFYDEPRQPYPEEENRSV 118
            +YD+Y                      MNFF+ Y     G       R  Y E E++  
Sbjct: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESK-- 191

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           RT D+RI  K++ ++LY GKT  F+ KR  LC  C G+GLRKK  Q P   + C SC G 
Sbjct: 192 RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPE--ISCTSCNGQ 249

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G KERI R+A G+++++   C+ C GKGR       D CK C GK +I+EEK+ TVYIPR
Sbjct: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPR 309

Query: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298
           GSR+GD  +L   AD E  K TGD++ VI+E+   S +LER+ +DLHT L ISL +A+TG
Sbjct: 310 GSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKS-HLERKSNDLHTTLNISLVDALTG 368

Query: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358
           F  +V  T D+R L++ +P GKVIRPGNY + + EGWPL + G+ FGDMYVQ++IEFP D
Sbjct: 369 FSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINIEFPKD 427

Query: 359 NWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYLS 411
           NWF+EKS++  LR +LP + +    D   L NTE V+ YSV+ S DELPDYL+
Sbjct: 428 NWFNEKSEITALRNILPGLKSKDTKDPDPL-NTEDVLSYSVLHSHDELPDYLA 479

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  373 bits (958), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 206/448 (45%), Positives = 275/448 (61%), Gaps = 28/448 (6%)

Query: 1   MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVL--REESEMKFKEITAAYEIL 58
           MT LY VLGVA +A+ ++IKKAYRKLALQHHPDKV +     RE SE+KFKEI+AAYEIL
Sbjct: 1   MTDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 60

Query: 59  SDEDSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSV 118
           SDED R  YD+Y                     NF +       Y++P+           
Sbjct: 61  SDEDKRAHYDLYGSEEEQQRQQRQYDPFESF-FNFEQDEEPSRHYEDPK----------- 108

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKP--VVCQSCE 176
           R+ D +IPLK++++ELYNGKTFKF+ KRNV+CD C+G G R++       P  V C+ C+
Sbjct: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168

Query: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTV 234
           G G  E+++ +A GF  RE  KC++C+GKG+        ++ CKKCHG+ + +E K LTV
Sbjct: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228

Query: 235 YIPRGSRNGDIVKLEGEADQEPDK-VTGDLLFVIEENPET--STNLERRGDDLHTRLKIS 291
            +PRG R+GD +K+  EADQE  K  TGDL+F IEE+        LER+G +  T L IS
Sbjct: 229 SVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNIS 288

Query: 292 LSEAITGF-EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQ 350
           L+EA+TGF +K VT T D RIL L IP GKVIRPGN I++E EGWPL+    KFGD+Y+ 
Sbjct: 289 LAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYIS 348

Query: 351 VHIEFPPDNWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYL 410
           V+IEFPPDNWF+EKSD+  ++ +LP   + +   + D  NTE ++ + V+++   LPD L
Sbjct: 349 VNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLET---LPDTL 405

Query: 411 SXXXXXXXXXXXXXXX---XXXPQCAQQ 435
                                 PQCAQQ
Sbjct: 406 KEGQDQGENNAESHGEYRGEGSPQCAQQ 433

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  365 bits (936), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 200/452 (44%), Positives = 278/452 (61%), Gaps = 36/452 (7%)

Query: 1   MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD 60
           M  LY +LGV   A+ +EIKKAYRKLALQ+HPDKV D   REE+E+KFKEIT+AYEILSD
Sbjct: 1   MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSD 60

Query: 61  EDSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYD-EPRQP-YPEEENRSV 118
           E+ R  YD+Y                     N +       F++ E  QP Y      + 
Sbjct: 61  EEKRAHYDLYGDANE----------------NEYNNQNANDFFNFETDQPDYDSYAFDND 104

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKP--VVCQSCE 176
           ++ D +IPLKLS++ELYNGKTFKF+SKRN++C +C+G G R++   +   P  + C+ C 
Sbjct: 105 KSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCN 164

Query: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTV 234
           G G+KER + +  GFV  + ++CE C+GKG     P   ++ CK CHGK ++SE K L V
Sbjct: 165 GLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLV 224

Query: 235 YIPRGSRNGDIVKLEGEADQEPDKV-TGDLLFVIEENPETSTNLE--RRGDDLHTRLKIS 291
            +PRG +N D +++E EADQE  K  TGD++ VIEE+    +++   R+G D    L +S
Sbjct: 225 SVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLS 284

Query: 292 LSEAITGF-EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQ 350
           L+EA+TGF +K ++ +LD RIL L +P GKVIRPGN I+++ EGWP++   +KFGD+YV 
Sbjct: 285 LAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVI 344

Query: 351 VHIEFPPDNWFSEKSDVEVLRTLLPEVPNARVAD--TGDLNNTETVIDYSVVKSADELPD 408
           + IEFPPDNWFSEKSD+++LR +LP   N  +      D  NTETV  + ++   +ELPD
Sbjct: 345 IKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDIL---EELPD 401

Query: 409 YLSXXXXXXXXXXXXXXXXXX-----PQCAQQ 435
            L+                       PQC+QQ
Sbjct: 402 TLNESNNRSAYDTGDQSDANYDREGPPQCSQQ 433

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  324 bits (831), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/430 (43%), Positives = 260/430 (60%), Gaps = 28/430 (6%)

Query: 3   KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
           +LY+VLGV  DA+  EIK AYRKLAL+HHPDK  D+  +E +E+KFKEITAAYEILSD +
Sbjct: 9   RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68

Query: 63  SRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDE---PRQPYPEEENRSVR 119
            +  YD+Y                    MNFF  +   G +D    P +    EE  S  
Sbjct: 69  KKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTS 128

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179
           + D  I + L++K+LY GK  KF  KR V+C +C GSG + K + H    V C+SC G G
Sbjct: 129 SKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKG 188

Query: 180 HKERIKRVAQGFVIRETVKCERCNGKGRTT--PTKPEDHCKKCHGKCVISEEKTLTVYIP 237
            KER+KR   G V  + V CE+CNGKG+ T  P  P++ C  C G  ++S+++ +TV + 
Sbjct: 189 SKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVA 248

Query: 238 RGSRNGDIVKLEGEADQEPDKVT-GDLLFVIEENPETSTNLERR-----------GDDLH 285
            G    D++ ++G AD+E DK T GDL F + E  E   NLE++           G+DL+
Sbjct: 249 PGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE---NLEQKQIFLKNFDDGAGEDLY 305

Query: 286 TRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSGNKF 344
           T + ISLSEA+TGFEK +T T DDR+L L +  G+V+RPG+ I++ NEGWP LD+   + 
Sbjct: 306 TSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRC 365

Query: 345 GDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPN------ARVADTGDLNNTETVIDYS 398
           GD+YV VHIEFPPDNWF+EKS++  ++T LP   +          D  +L N ET+ ++ 
Sbjct: 366 GDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFR 425

Query: 399 VVKSADELPD 408
           ++ + D+LP+
Sbjct: 426 IIHT-DDLPE 434

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  315 bits (806), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 235/404 (58%), Gaps = 30/404 (7%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           YE+LGVA DA+  EIKK YRKLALQ+HPDK  DE  +  +E+KFK+ITAAY+ LSDED R
Sbjct: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDAR 124
            +YD                         F  Y    F +     Y     RS R+ D +
Sbjct: 74  NEYD---------------------NKKNFEPYFESDFANNHDGNY-NSRYRS-RSKDIK 110

Query: 125 IPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKP--VVCQSCEGHGHKE 182
           + L L   ELYNGKT KF + RN +C  C G G R K    P  P  + CQ C G G+K 
Sbjct: 111 VELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKN 170

Query: 183 RIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
              ++A GF   + V C  C G G+    P  P++ CK C+GKC+I  +  + V IPRGS
Sbjct: 171 MKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGS 230

Query: 241 RNGDIVKLEGEADQE-PDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGF 299
            NGD + L+GEAD+E   K  GDL+F I E  +++ +LER G+ L     ISL+EAITGF
Sbjct: 231 SNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGF 290

Query: 300 E-KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358
           E K +  T DDR L L  P+GKVIRPG+ + ++NEGWP+D  G  FG++YV + IEFPPD
Sbjct: 291 ENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPD 350

Query: 359 NWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKS 402
           NW +EK+D+  +R +LP     R  +  D  N+E +  + +VKS
Sbjct: 351 NWINEKNDIIKIRNILPNEKTKR-NNIVDPINSEYISTFEIVKS 393

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  313 bits (803), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/427 (43%), Positives = 255/427 (59%), Gaps = 24/427 (5%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
            +LY VLGV  DA   EIK AYRKLAL+HHPDK  D+  ++ +E+KFKEITAAYEILSD 
Sbjct: 8   NRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDP 67

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRT------YAGGGFYDEPRQPYPEEEN 115
           + +  YD+Y                    MNFF        + G GF +E +     E+N
Sbjct: 68  EKKSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKM---YEDN 124

Query: 116 RSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSC 175
            S  + D  I + L+MK+LY GK  +F  KR V+C +C GSG + K + H    V C+SC
Sbjct: 125 DSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESC 184

Query: 176 EGHGHKERIKRVAQGFVIRETVKCERCNGKG--RTTPTKPEDHCKKCHGKCVISEEKTLT 233
            G G KER+KR   G V  + V CE+C+GKG  R +P  P++ C  C G  + S+++ +T
Sbjct: 185 GGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVIT 244

Query: 234 VYIPRGSRNGDIVKLEGEADQEPDKVT-GDLLFVIEENPE----TSTNLERRGD----DL 284
           V +  G    D++ +EG AD+E  K   GDL F + E  E        L+  GD    D 
Sbjct: 245 VIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDS 304

Query: 285 HTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSGNK 343
           +  + ISLSEA+TGFEK +T T DDR+L L I  G+VIRPG+ +++ NEGWP LDD+  +
Sbjct: 305 YVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGR 364

Query: 344 FGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNARVA--DTGDLNNTETVIDYSVVK 401
            GD+YV +HIEFPPDNWF+EKS++  ++T LP   ++  A  D  DL N ETV ++ ++ 
Sbjct: 365 CGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDLINNETVSNFQIIH 424

Query: 402 SADELPD 408
           + D+LP+
Sbjct: 425 T-DDLPE 430

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  313 bits (801), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/424 (42%), Positives = 250/424 (58%), Gaps = 19/424 (4%)

Query: 3   KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
           +LY+VLGV  +AS  EIK AYRKLAL+HHPDK  D+  +E +E KFKEITAAYEILSD +
Sbjct: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68

Query: 63  SRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSD 122
            +  YD+Y                     N F         D P +    E N +  + D
Sbjct: 69  KKSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSKD 128

Query: 123 ARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKE 182
             I L  +MK+LY GK  KF  KR ++C +CQGSG + K + H    + C+SC G G KE
Sbjct: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKE 188

Query: 183 RIKRVAQGFVIRETVKCERCNGKGRTT--PTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
           R+KR   G V  + V CE+C+GKG+ T  P   ++ C  C    +  +++ +TV +P G 
Sbjct: 189 RLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248

Query: 241 RNGDIVKLEGEADQEPDK-VTGDLLFVIEENPE----TSTNLERRG----DDLHTRLKIS 291
              D+V ++G AD+E DK V GDL+F + E PE        +++ G     DL+  + +S
Sbjct: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308

Query: 292 LSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSGNKFGDMYVQ 350
           LSEA+TGFEK +T T DDR+L L I  GKVIRPG+ I++ NEGWP LD    + GD+YV 
Sbjct: 309 LSEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVF 368

Query: 351 VHIEFPPDNWFSEKSDVEVLRTLLPEV---PNARVADTGDLN---NTETVIDYSVVKSAD 404
           V IEFPPDNWF+EKS++  ++T LP     P+    +TG  N   N+ETV ++ ++ S D
Sbjct: 369 VDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIHS-D 427

Query: 405 ELPD 408
           +LP+
Sbjct: 428 DLPE 431

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  312 bits (799), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/431 (42%), Positives = 260/431 (60%), Gaps = 29/431 (6%)

Query: 3   KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
           +LY+VLGV  DAS  EIK AYRKLAL+HHPDK  D+  +E +E+KFKEITAAYEILSD +
Sbjct: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68

Query: 63  SRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFY---DEPRQPYPEEENRSVR 119
            +  YD+Y                    MNFF  +   G +   D PR+    EE++   
Sbjct: 69  KKSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDTYEEDKCKS 128

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179
           + D  I + L++K+LY GK  KF  KR ++C  C GSG + K + H    V C+SC G G
Sbjct: 129 SKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188

Query: 180 HKERIKRVAQGFVIRETVKCERCNGKGRTT--PTKPEDHCKKCHGKCVISEEKTLTVYIP 237
            KER+KR   G V  + V CE+C+GKG+    P  P++ C  C G  + S+++ +TV + 
Sbjct: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248

Query: 238 RGSRNGDIVKLEGEADQEPDK-VTGDLLFVIEENPETSTNLERR-----------GDDLH 285
            G    D++ ++G AD+E DK   GDL F + E  E   NLE++            +DL+
Sbjct: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE---NLEQKQIFLKNFDEGSAEDLY 305

Query: 286 TRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSGNKF 344
           T   ISLSEA+TGFEK +T T DDR+L L I  G+VIRPG+ I++ NEGWP +DD   + 
Sbjct: 306 TSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR 365

Query: 345 GDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNA---RVADTGDLN----NTETVIDY 397
           GD+YV +HIEFPPDNWF+EKS++  ++T+LP   +      A+TG+ +    N ET+ ++
Sbjct: 366 GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNF 425

Query: 398 SVVKSADELPD 408
            ++ + +ELP+
Sbjct: 426 QII-NMEELPE 435

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  306 bits (785), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/453 (38%), Positives = 264/453 (58%), Gaps = 46/453 (10%)

Query: 4   LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVA-----DEVLREESEMKFKEITAAYEIL 58
           LY +L V    +Q E+KK YRKLAL++HPDKV      ++ ++ E E+KFKEI +AYEIL
Sbjct: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 59  SDEDSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSV 118
           SDE+ RK+YD+                      NF     G  + D     +  + ++  
Sbjct: 72  SDEEKRKQYDL--------------------QKNFRDANQGSDYGDGINTAFGNQTSK-- 109

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLR--KKFQQHPRKPVVCQSCE 176
              D  IPLK+++K+LYNGK  ++  KRNV+C++C G G R  K  +Q+      C++C+
Sbjct: 110 ---DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCD 166

Query: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTV 234
           G G+K+  +++A GF  ++ + C+ C+GKGR    P   ++ C KC+GK +I   +++TV
Sbjct: 167 GAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITV 226

Query: 235 YIPRGSRNGDIVKLEGEADQEPDKV-TGDLLFVIEENPETSTNLERRGD-DLHTRLKISL 292
            IPRGS + D + ++ +ADQE  K  TGDL+FV+EE  +  T L+R GD DL T L ISL
Sbjct: 227 NIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISL 286

Query: 293 SEAITGF-EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQV 351
           ++AITGF EK +  TLD R+L+L IP GKVIR G+ +++E EGWPL+ +  + GD+Y++ 
Sbjct: 287 ADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKF 346

Query: 352 HIEFPPDNWFSEKSDVEVLRTLLPEVPNARVADTGDL---------NNTETVIDYSVVKS 402
           +IEFP DNW SE +D+  +R LLP + +A+    GD+          N+E + +Y  VK 
Sbjct: 347 NIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKD 406

Query: 403 ADELPDYLSXXXXXXXXXXXXXXXXXXPQCAQQ 435
             ++ D                     P+C+QQ
Sbjct: 407 LPDIIDTSHNNGAEYGHNGDSANFTEMPECSQQ 439

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  280 bits (716), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 164/419 (39%), Positives = 245/419 (58%), Gaps = 25/419 (5%)

Query: 1   MTKL--YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEIL 58
           M KL  Y++LGV  D++  EI+KAYRKLAL+ HPDKV D   +  +EMKFKEIT AYEIL
Sbjct: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60

Query: 59  SDEDSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSV 118
           S+ +  ++                        MNFF      G    P   +P+ E+ S 
Sbjct: 61  SNGEYVEE------MEEEYEGQGYGFNFGDDFMNFFNE----GRNAHPMGGHPQREDEST 110

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVV--CQSCE 176
             +  +I +++++K+LYNGK  KF+  RNV+C  C G+  R++       P V  C  C+
Sbjct: 111 NEA-TQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCK 169

Query: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGRTT--PTKPEDHCKKCHGKCVISEEKTLTV 234
           G G+ ER+   +  F   + + C +C GKG  T  PT  ++ CK CHG+ +I E++ L V
Sbjct: 170 GAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLV 229

Query: 235 YIPRGSRNGDIVKLEGEADQE-PDKVTGDLLFVIEENPETSTN-----LERRGDDLHTRL 288
            IPRGS N + +  + + D++   +  GD++F ++ + E +       + + G DLH  +
Sbjct: 230 TIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNI 289

Query: 289 KISLSEAITGFE-KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDM 347
           +I L EAI+G + + +T T DDR+LKL +PQGKV+RPG+ I ++ EGWP   +G +FGDM
Sbjct: 290 EIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDM 349

Query: 348 YVQVHIEFPPDNWFSEKSDVEVLRTLLPEV-PNARVADTGDLNNTETVIDYSVVKSADE 405
           +V V++EFPPDNW SE++D+  L  +LP    +   A TGD NN E V DY ++K+ DE
Sbjct: 350 FVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDE 408

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  256 bits (655), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 163/439 (37%), Positives = 232/439 (52%), Gaps = 47/439 (10%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREES-----EMKFKEITAAYEILS 59
           Y +LGV  DASQ EIK+AYRKLAL+HHPDK       E+S     ++ FKE+TAAY++LS
Sbjct: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 60  DEDSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGF------YDEPRQPYPEE 113
           D   R +YD                      MNFF  + GG        +D  R      
Sbjct: 64  DASLRAEYD-------QKLAFEAQPYGDDDFMNFFSGFNGGSHPGHRSGFDSGRGA---- 112

Query: 114 ENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPV--- 170
             R  ++ D  I LK+   ELY GK   F  KR   C RC G+G +       +K     
Sbjct: 113 --RRYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFF 170

Query: 171 --VCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKG--RTTPTKPEDHCKKC--HGKC 224
             VC+ CEG G ++R++++A GFV  E ++C +C GKG  R  P   ++ C  C   G  
Sbjct: 171 WNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTV 230

Query: 225 -VISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKV-TGDLLFVIEENPETSTNLERRGD 282
            ++ E K +T+ I +G+ +GD + L+GEAD++ +    GDL+  I+E  E   ++ R G 
Sbjct: 231 GMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGY 290

Query: 283 DLHTRLKISLSEAITGF-EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSG 341
           DL  + +I L++AI GF EK +  T D R+LK    +GKVIRP + +R++NEGWP  +  
Sbjct: 291 DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350

Query: 342 N------KFGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNARVADTG--DLNNTET 393
           N      K GD+YV V I FPPDNW  E +D   +R ++P   N R + T    + N E 
Sbjct: 351 NDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVEN 410

Query: 394 VIDYSVVK---SADELPDY 409
           +    +VK   + DELP +
Sbjct: 411 INVSEIVKEIPNCDELPKF 429

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  206 bits (523), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 140/390 (35%), Positives = 202/390 (51%), Gaps = 32/390 (8%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLY+VLGV+  A+  EIKKAYRK+AL+ HPDK   E    E+  KFKE ++AYE+LSD 
Sbjct: 5   TKLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSE----EAAEKFKEASSAYEVLSDA 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMN-FFRTYAGGGFYDEPRQPYPEEENRSVRT 120
           D R  YD +                     +  F  + GG     PR P         R 
Sbjct: 61  DKRDTYDQFGLEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAGAQRPRGPQ--------RG 112

Query: 121 SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH 180
            D +  + ++++ELY GKT K    + +LC  C+G G +K   +       C SC G G 
Sbjct: 113 RDIKHEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGAVKK------CSSCNGQGI 166

Query: 181 KERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
           K  + R     + R   +C+ C+G G      P+D CK C+GK V SE K L V++  G 
Sbjct: 167 K-FVTRQMGPMIQRFQTECDVCHGAGDIV--DPKDRCKSCNGKKVASERKILEVHVDPGM 223

Query: 241 RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFE 300
           +NG  V  +GEADQ PD + GD++FVI E P    + +R GD+L    ++ L  AI G E
Sbjct: 224 KNGQKVVFKGEADQAPDVIPGDVVFVINEKPH--KHFQRSGDNLVYEAEVDLLTAIAGGE 281

Query: 301 KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNW 360
             +     D  LK+ I  G+VI PG    ++ +G P+   G  +G++ ++  ++FP  ++
Sbjct: 282 FAIEHVSGD-WLKVAIVPGEVIAPGARKVIDGKGMPVAKYGG-YGNLIIKFTVKFPEPHF 339

Query: 361 FSE---KSDVEVL--RTLLPEVP-NARVAD 384
            +E   K   E+L  RT LP++P NA V D
Sbjct: 340 TTEENLKKLEEILPQRTPLPQMPKNAHVED 369

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  204 bits (519), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 133/375 (35%), Positives = 193/375 (51%), Gaps = 27/375 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLY++LGV+P AS +EIKKAYRK AL++HPDK   E    E+  KFKE ++AYE+LSD 
Sbjct: 5   TKLYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSE----EAAEKFKEASSAYEVLSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM-NFFRTYAGGGFYDEPRQPYPEEENRSVRT 120
           + R  YD +                      + F  + GG     PR P         R 
Sbjct: 61  EKRDIYDQFGQDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRPRGPQ--------RG 112

Query: 121 SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH 180
            D +  + +S++ELY GKT K    + +LC  C+G G +K   +       C SC G G 
Sbjct: 113 RDIKHEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKKGAVKK------CSSCNGQGI 166

Query: 181 KERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
           K  + R     + R   +C+ C+G G     K  D CK CHGK + +E K L V +  G 
Sbjct: 167 K-FVTRQMGPMIQRFQTECDVCHGTGDIIDAK--DRCKDCHGKKIANERKILQVNVDPGM 223

Query: 241 RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFE 300
           +NG  V  +GEADQ PD + GD++FVI E P    + +R GDDL    +I L  A+ G E
Sbjct: 224 KNGQKVVFKGEADQAPDIIPGDVIFVISEKPH--KHFQRVGDDLIYEAEIDLLTAVAGGE 281

Query: 301 KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNW 360
                 +    LK+ I  G+VI P     +E +G P+   G  +G++ ++  I+F P+N 
Sbjct: 282 -FALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGG-YGNLIIKFSIKF-PENH 338

Query: 361 FSEKSDVEVLRTLLP 375
           F+++  ++ L  +LP
Sbjct: 339 FADEDTLKKLEEILP 353

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  204 bits (518), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 132/374 (35%), Positives = 194/374 (51%), Gaps = 26/374 (6%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLY+ LGV+P AS  EIKKAYRK AL++HPDK   E    E+  KFKE+++AYEILSD 
Sbjct: 5   TKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSE----EAAEKFKEVSSAYEILSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTS 121
             R+ YD +                     + F  + GG     PR P         R  
Sbjct: 61  QKREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGPQ--------RGR 112

Query: 122 DARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHK 181
           D +  +  S++ELY G+T K    + +LC  C+G G ++   +       C SC G G K
Sbjct: 113 DIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVKK------CSSCNGQGIK 166

Query: 182 ERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSR 241
             + R     + R   +C+ C+G G     K  D CK C+GK V +E K L V I  G +
Sbjct: 167 -FVTRQMGPMIQRFQTECDVCHGTGDIIDAK--DRCKSCNGKKVDNERKILEVRIEPGMK 223

Query: 242 NGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEK 301
           +G  +  +GEADQ PD + GD++FVI E P    + +R GDDL    +I L  A+ G + 
Sbjct: 224 DGQKIVFKGEADQAPDVIPGDVVFVISEKPH--KHFQRAGDDLIYEAEIDLLTALAGGQF 281

Query: 302 VVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWF 361
            +     D  LK+ I  G+VI PG    +E +G P+   G  +G++ ++ +I+F P+N F
Sbjct: 282 ALEHVSGD-WLKVDIVPGEVIAPGARKIVEGKGMPIQKYGG-YGNLLIKFNIKF-PENHF 338

Query: 362 SEKSDVEVLRTLLP 375
           + + +++ L  +LP
Sbjct: 339 TSEENLKKLEEILP 352

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  202 bits (515), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 135/390 (34%), Positives = 196/390 (50%), Gaps = 35/390 (8%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLY++LGV+PDA+  +IKKAYRK AL++HPDK   E    E+  KFK+IT AYEILSD 
Sbjct: 5   TKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSE----EAADKFKQITGAYEILSDS 60

Query: 62  DSRKKYD---VYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSV 118
             R+ YD                          + F  + GGG    PR P         
Sbjct: 61  QKREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQ-------- 112

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           +  D R  +  +++ LY G+  K    + VLC RC+G G +    +       C SC G 
Sbjct: 113 KGRDIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGKAGSVKK------CTSCNGQ 166

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G K  + R     + R    CE CNG+G   P    D CK C GK + SE K L V I  
Sbjct: 167 GVK-FVTRHMGPMIQRFQTTCEVCNGEGDVIPAA--DRCKDCDGKKIASERKILEVNIQP 223

Query: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298
           G ++G  +  +GEADQ+P ++ GD++FV+  N +      R GD+LH   +I L  AI G
Sbjct: 224 GMKHGQKIVFQGEADQQPGQIPGDVVFVV--NEQEHPRFVRNGDNLHYEAEIDLLTAIAG 281

Query: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358
            +  +     D  LK+ I  G+VI PG    +E +G P+   G+ +GD+ ++ +++FP  
Sbjct: 282 GQFALEHVSGD-WLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGDLLIKFNVKFPKS 339

Query: 359 NWFSEKSDVEVLRTLLPEV------PNARV 382
           + F+++  ++ L  +LP        PNA V
Sbjct: 340 H-FADEEALKKLEAILPPKTLPRIPPNAEV 368

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  200 bits (509), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 128/377 (33%), Positives = 195/377 (51%), Gaps = 29/377 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV+P AS++EIKK YRK AL++HPDK        E+  KFKE +AAYE+LSD 
Sbjct: 5   TKFYDILGVSPTASESEIKKGYRKAALKYHPDKNP----TAEAAEKFKECSAAYEVLSDP 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM---NFFRTYAGGGFYDEPRQPYPEEENRSV 118
           + R  YD Y                        + F  + GGG    PR P         
Sbjct: 61  EKRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQ-------- 112

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           +  D +  +  +++ELY G+T K    + +LC  C+G G +    +       C SC G 
Sbjct: 113 KGRDIKHEIAATLEELYKGRTAKLALNKQILCKSCEGRGGKADAVKK------CSSCGGQ 166

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G K   K++    + R   +C+ C+G G      P+  CK CHGK + +E K L V I  
Sbjct: 167 GIKFVTKQMGP-MIQRFQTECDVCHGTGDII--DPKGRCKSCHGKKIANERKILEVKIEP 223

Query: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298
           G ++G  +  +GE+DQ PD + GD++FV+ E P    + +R G+DL    +I L  AI G
Sbjct: 224 GMKDGQRIVFKGESDQAPDIIPGDVVFVVNEKPH--KHFQRSGNDLVYLAEIDLLTAIAG 281

Query: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358
            E      +    LK+ I  G+VI PG    +E +G P+   G  +G++ +Q +I+F P+
Sbjct: 282 GE-FALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGG-YGNLIIQFNIKF-PE 338

Query: 359 NWFSEKSDVEVLRTLLP 375
           N F+++S+++ L  +LP
Sbjct: 339 NHFTDESNLKKLEEILP 355

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  200 bits (508), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 128/376 (34%), Positives = 194/376 (51%), Gaps = 28/376 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLY++LGV+ DA+  +IKKAYRK AL++HPDK        E+  KFK++TAAYEILSD 
Sbjct: 5   TKLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSS----EAADKFKQMTAAYEILSDS 60

Query: 62  DSRKKYD--VYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVR 119
             R+ YD                         + F  + GGG    PR P         +
Sbjct: 61  QKREVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQ--------K 112

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179
             D +  +  +++ LY G+T K    + VLC  C+G G +    +       C SC GHG
Sbjct: 113 GRDIKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRGGKSGSVKK------CSSCGGHG 166

Query: 180 HKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRG 239
            K  + R     + R    CE CNG+G      P+D C++C GK + +E K L V I  G
Sbjct: 167 VK-FVTRQMGPMIQRFQTTCEACNGEGDVI--DPKDRCRECSGKKISNERKILEVNIEPG 223

Query: 240 SRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGF 299
            +NG  V  +GEADQ+P ++ GD++FV+  N +      R GD+LH   +I L  A+ G 
Sbjct: 224 MKNGQKVVFQGEADQQPGQIPGDVVFVV--NEQEHPKFVRNGDNLHYEAQIDLLTAVAGG 281

Query: 300 EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDN 359
           +  +     D  LK+ I  G+VI PG    +E +G P+   G+ +G++ ++ +++FP  +
Sbjct: 282 QFALEHVSGD-WLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGNLLIKFNVKFPKSH 339

Query: 360 WFSEKSDVEVLRTLLP 375
            F+  +D++ L  +LP
Sbjct: 340 -FASDADLKKLEEILP 354

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  199 bits (506), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 195/374 (52%), Gaps = 27/374 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLY++LGV+P A   +IKKAYRK AL+ HPDK   E    E+  KFKEIT+AYEILSD 
Sbjct: 5   TKLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSE----EAAEKFKEITSAYEILSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTS 121
             R+ YD +                     + F  + GGG    PR P         +  
Sbjct: 61  QKREVYDQFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGG-SSRPRGPQ--------KGR 111

Query: 122 DARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHK 181
           D R  +  ++++L+ G+T K    + ++C  C+G G ++   +       C +C G G K
Sbjct: 112 DIRHEIPATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSVKK------CTACSGQGFK 165

Query: 182 ERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSR 241
             + R     + R  V+CE C+G G      P+  CK C GK V++E K L V I  G +
Sbjct: 166 -FVTRQMGPMIQRFQVECESCHGAGEII--DPKGRCKVCSGKKVVNERKVLEVNIEPGMK 222

Query: 242 NGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEK 301
           +G  +  +GEADQ P  + GD++FV+ E P      +R G+DLH   +I L  AI G + 
Sbjct: 223 DGQRIVFQGEADQSPGIIPGDVVFVVSEQPHPV--FKRDGNDLHYDAEIDLLSAIAGGQF 280

Query: 302 VVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWF 361
            V   +    LK++I  G+VI PG+   +E +G P+   G  +G++ ++ +I+FPP + F
Sbjct: 281 AV-KHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGG-YGNLLIKFNIKFPPAH-F 337

Query: 362 SEKSDVEVLRTLLP 375
           ++   ++ L  +LP
Sbjct: 338 TDDETLKKLEEILP 351

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  198 bits (504), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 131/377 (34%), Positives = 190/377 (50%), Gaps = 29/377 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV+PDA+  +IKKAYRK AL+ HPDK   E    E+  KFKE+T AYEILSD 
Sbjct: 5   TKFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSE----EAADKFKELTVAYEILSDS 60

Query: 62  DSRKKYD---VYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSV 118
             R  YD                          + F  + GGG    PR P         
Sbjct: 61  QKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQ-------- 112

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           +  D +  +  S++ELY G+T K    + +LC  C+G G +    +       C SC G 
Sbjct: 113 KGRDIKHEMSASLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVKK------CSSCNGQ 166

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G K  I R     + R   +C+ C+G G      P+D CK C+GK + +E K L V+I  
Sbjct: 167 GIK-FITRQMGPMIQRFQAECDVCSGTGDII--DPKDRCKSCNGKKIDNERKILEVHIEP 223

Query: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298
           G ++G  +  +GEADQ P  + GD++FVI + P    + ER+GDDL  + ++ L  AI G
Sbjct: 224 GMKDGQKIVFQGEADQAPGIIPGDVVFVISQRPH--KHFERKGDDLLYQAEVDLLSAIAG 281

Query: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358
            E  +   +    LK+ I  G+VI PG    +E +G P+   G  +G++ V   I FP  
Sbjct: 282 GEFAI-EHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGG-YGNLIVTFKINFPT- 338

Query: 359 NWFSEKSDVEVLRTLLP 375
           N F+++  ++ L  +LP
Sbjct: 339 NHFADEESLKKLEEILP 355

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  198 bits (503), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 130/376 (34%), Positives = 194/376 (51%), Gaps = 28/376 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV+  A+  EIKKAYRK AL++HPDK   E    E+  KFKE ++AYEILSD 
Sbjct: 5   TKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSE----EAAEKFKEASSAYEILSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM--NFFRTYAGGGFYDEPRQPYPEEENRSVR 119
           + R+ YD +                       + F  + G G    PR P         R
Sbjct: 61  EKREVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQ--------R 112

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179
             D +  +  S++ELY G+T K    + +LC  C+G G +K   +       C SC G G
Sbjct: 113 GKDIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK------CSSCNGQG 166

Query: 180 HKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRG 239
            K  + R     + R   +C+ C+G G      P+D CK C+GK V +E K L V++  G
Sbjct: 167 IK-FVTRQMGPMIQRFQTECDVCHGTGDII--DPKDRCKSCNGKKVENERKILEVHVEPG 223

Query: 240 SRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGF 299
            ++G  +  +GEADQ PD + GD++F++ E P    N +R GDDL    +I L  AI G 
Sbjct: 224 MKDGQRIVFKGEADQAPDVIPGDVVFIVSERPH--KNFKRDGDDLVYEAEIDLLTAIAGG 281

Query: 300 EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDN 359
           E  +     D  LK+ I  G+VI PG    +E +G P+   G  +G++ ++  I+F P+N
Sbjct: 282 EFALEHVSGD-WLKVGIVPGEVISPGMRKVIEGKGMPIPKYGG-YGNLVIKFTIKF-PEN 338

Query: 360 WFSEKSDVEVLRTLLP 375
            F+ + +++ L  +LP
Sbjct: 339 HFTTEENLKKLEEILP 354

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  197 bits (501), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 127/375 (33%), Positives = 194/375 (51%), Gaps = 27/375 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV+P+AS++EIKK YRK AL++HPDK       +E+  KFKE + AYE+LSD 
Sbjct: 5   TKFYDLLGVSPNASESEIKKGYRKAALKYHPDKNP----TDEAAEKFKECSGAYEVLSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMN-FFRTYAGGGFYDEPRQPYPEEENRSVRT 120
             R+ YD Y                     +  F  + GG     PR P         R 
Sbjct: 61  QKREIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASRPRGPQ--------RG 112

Query: 121 SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH 180
            D R  ++ +++ELY G+T K    + +LC  C+G G ++   +       C SC G G 
Sbjct: 113 KDIRHEIQNTLEELYKGRTAKLALNKQILCKGCEGRGGKEGAVKK------CSSCGGQGV 166

Query: 181 KERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
           K  + R     + R   +C+ C+G G      P+D CK+C G  V +E K L V++  G 
Sbjct: 167 K-FVTRQMGPMIQRFQTECDVCHGSGDII--DPKDRCKECKGNKVANERKVLEVHVEPGM 223

Query: 241 RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFE 300
           R G  V  +GEADQ PD + GD++FV+ E P    + +R GDDL    ++ L  AI G +
Sbjct: 224 REGQKVTFKGEADQAPDIIPGDVIFVVTEKPH--KHFKRSGDDLLYEAEVDLLTAIAGGD 281

Query: 301 KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNW 360
             +     D  LK+ I  G+VI PG    ++ +G P+   G  +G++ +   I+F P+N 
Sbjct: 282 FAIEHVSGD-WLKVTIVPGEVISPGVRKVIDGKGMPVQKYGG-YGNLIITFKIKF-PENH 338

Query: 361 FSEKSDVEVLRTLLP 375
           F++++ ++ L  +LP
Sbjct: 339 FADEAKLKALEDILP 353

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  196 bits (499), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 131/376 (34%), Positives = 192/376 (51%), Gaps = 28/376 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV   A+  EIKKAYRK AL++HPDK   E    E+  KFKE +AAYEILSD 
Sbjct: 5   TKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSE----EAAEKFKEASAAYEILSDP 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM--NFFRTYAGGGFYDEPRQPYPEEENRSVR 119
           + R  YD +                       + F  + G G    PR P         R
Sbjct: 61  EKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQ--------R 112

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179
             D +  +  S++ELY G+T K    + +LC  C+G G +K   +       C SC G G
Sbjct: 113 GKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK------CTSCNGQG 166

Query: 180 HKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRG 239
            K  + R     + R   +C+ C+G G      P+D CK C+GK V +E K L V++  G
Sbjct: 167 IK-FVTRQMGPMIQRFQTECDVCHGTGDII--DPKDRCKSCNGKKVENERKILEVHVEPG 223

Query: 240 SRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGF 299
            ++G  +  +GEADQ PD + GD++F++ E P  S   +R GDDL    +I L  AI G 
Sbjct: 224 MKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKS--FKRDGDDLVYEAEIDLLTAIAGG 281

Query: 300 EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDN 359
           E  +     D  LK+ I  G+VI PG    +E +G P+   G  +G++ ++  I+F P+N
Sbjct: 282 EFALEHVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGG-YGNLIIKFTIKF-PEN 338

Query: 360 WFSEKSDVEVLRTLLP 375
            F+ + +++ L  +LP
Sbjct: 339 HFTSEENLKKLEEILP 354

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  196 bits (497), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 136/377 (36%), Positives = 196/377 (51%), Gaps = 29/377 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLY+++GV+P A   +IKKAYRK AL++HPDK       EE+  KFKEI++AYEILSD 
Sbjct: 5   TKLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNP----TEEAAEKFKEISSAYEILSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMN---FFRTYAGGGFYDEPRQPYPEEENRSV 118
             R+ YD +                         F + + G G    PR P         
Sbjct: 61  QKREMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRGPQ-------- 112

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           +  D R  +  +++ELY G+T K    + +LC  C+G G +    +       C SC G 
Sbjct: 113 KGRDIRHEISATLEELYKGRTAKLALNKQILCKSCEGRGGKAGAVKK------CSSCNGQ 166

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G K  I R     + R   +C+ CNG G     K  D CK C+GK + +E K L V+I  
Sbjct: 167 GFK-FITRQMGPMIQRFQAECDACNGTGDIIDAK--DRCKACNGKKIANERKILEVHIEP 223

Query: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298
           G ++G  +  +GEADQ PD V GD++FV+ E P    N  R+GDDL+   ++ L  AI G
Sbjct: 224 GMKDGQKIVFQGEADQAPDVVPGDVVFVVSERPHERFN--RKGDDLYYEAEVDLLTAIAG 281

Query: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358
            E  V     D  LK++I  G+VI PG    +E +G P+   G  FG++ V+  I+FPP 
Sbjct: 282 GEFAVQHVSGD-WLKVEIVPGEVIAPGATKIIEGKGMPVQKYGG-FGNLIVKFKIKFPP- 338

Query: 359 NWFSEKSDVEVLRTLLP 375
           N F++++ ++ L  +LP
Sbjct: 339 NHFADEASLKQLENILP 355

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  195 bits (496), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 134/394 (34%), Positives = 197/394 (50%), Gaps = 39/394 (9%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV+P AS +EIKKAYRK AL++HPDK   E    E+  KFKE +AAYE+LSD+
Sbjct: 5   TKFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSE----EAAEKFKEASAAYEVLSDD 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM------NFFRTYAGGGFYDEPRQPYPEEEN 115
           + R+ YD +                            FF     G       Q       
Sbjct: 61  EKREMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQ------- 113

Query: 116 RSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSC 175
              R  D +  L  +++ELY G+T K    + +LC  C+G G +K   +       C SC
Sbjct: 114 ---RGRDIKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK------CSSC 164

Query: 176 EGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVY 235
            G G K  + R     + R   +CE C+G G      P+D CK C+ K V +E K L V+
Sbjct: 165 NGQGVK-FVTRQMGPMLQRFQAECEVCHGTGDII--DPKDRCKTCNAKKVTNERKILEVH 221

Query: 236 IPRGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEA 295
           I  G ++G  V  +GEADQ PD + GD++FV+ + P    + +R GDDL    +I L  A
Sbjct: 222 IEPGMKDGQKVVFKGEADQAPDIIPGDVIFVVSQKPH--EHFQRAGDDLVYEAEIDLLTA 279

Query: 296 ITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEF 355
           I G E  +   +    LK+ I  G+VI PG    + ++G P+   G  +G++ V+ +I+F
Sbjct: 280 IAGGEFAI-KHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGG-YGNLIVKFNIKF 337

Query: 356 PPDNWFSEKSDVEVLRTLLP-----EVPNARVAD 384
           PP N F+++  ++ L  +LP      +P   V D
Sbjct: 338 PP-NHFTDEESLKKLEEILPPRTKTNIPEGAVID 370

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  194 bits (493), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 193/377 (51%), Gaps = 29/377 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV+  A+  EIKKAYRK AL++HPDK   E    E+  KFKE ++AYEILSD 
Sbjct: 5   TKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSE----EAAEKFKEASSAYEILSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMN---FFRTYAGGGFYDEPRQPYPEEENRSV 118
           + R  YD +                         F + + G G    PR P         
Sbjct: 61  EKRDVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQRPRGPQ-------- 112

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           R  D +  +  S++ELY G+T K    + +LC  C+G G +K   +       C SC G 
Sbjct: 113 RGKDIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK------CSSCNGQ 166

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G K  + R     + R   +C+ C+G G      P+D CK C+GK V +E K L V++  
Sbjct: 167 GIK-FVTRQMGPMIQRFQTECDVCHGTGDIV--DPKDRCKSCNGKKVENERKILEVHVEP 223

Query: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298
           G ++G  +  +GEADQ PD + GD++F++ E P  S   +R GDDL    +I L  AI G
Sbjct: 224 GMKDGQRIVFKGEADQAPDVIPGDVVFLVSERPHKS--FKRDGDDLVYEAEIDLLTAIAG 281

Query: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358
            E  +     D  LK+ I  G+VI PG    +E +G P+   G  +G++ ++  ++F P+
Sbjct: 282 GEFALEHVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIIKFTVKF-PE 338

Query: 359 NWFSEKSDVEVLRTLLP 375
           N F+ + +++ L  +LP
Sbjct: 339 NHFTAEENLKKLEEILP 355

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  194 bits (492), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 189/375 (50%), Gaps = 27/375 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV+P+AS+TEIKK YRK AL++HPDK   E    E+  KFKE +AAYE+LSD 
Sbjct: 5   TKFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSE----EAAEKFKECSAAYEVLSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMN-FFRTYAGGGFYDEPRQPYPEEENRSVRT 120
             R+ YD Y                     +  F  + GG     P  P         R 
Sbjct: 61  QKREVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPSGPQ--------RG 112

Query: 121 SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH 180
            D +  ++ +++ELY G+T K    + +LC  C+G G +    +       C SC G G 
Sbjct: 113 RDIKHEIQNTLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVKK------CTSCNGQGI 166

Query: 181 KERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
           K  + R     + R   +C+ C+G G      P+D CK C GK + +E K L V++  G 
Sbjct: 167 K-FVTRQMGPMIQRFQTECDVCHGSGDII--DPKDRCKDCKGKKIANERKVLEVHVEPGM 223

Query: 241 RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFE 300
           R G  +  +GEADQ PD + GD++FV+ E P    + +R GDDL    +I L  AI G E
Sbjct: 224 REGQKIVFKGEADQAPDVIPGDVIFVVVEKPH--KHFKRAGDDLLYEAEIDLLTAIAGGE 281

Query: 301 KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNW 360
             +     D  LK+    G+VI  G    +E +G P+   G  +G++ V   I+FP +N 
Sbjct: 282 FAIQHVSGD-WLKVSTVPGEVISSGMKKVIEGKGMPVPKYGG-YGNLIVTFKIKFPENN- 338

Query: 361 FSEKSDVEVLRTLLP 375
           F+ +  ++ L  +LP
Sbjct: 339 FATEDKLKELENILP 353

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  193 bits (491), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 131/379 (34%), Positives = 193/379 (50%), Gaps = 32/379 (8%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV+  AS+TEIKKAYRK AL++HPDK   E    E+  KFKE ++AYE+L D 
Sbjct: 5   TKFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSE----EAAEKFKEASSAYEVLMDA 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM-----NFFRTYAGGGFYDEPRQPYPEEENR 116
           + R+ YD +                          + F  + GGG    PR P       
Sbjct: 61  EKREAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGG-ASRPRGPQ------ 113

Query: 117 SVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCE 176
             R  D +  + ++++ELY G+T K    + +LC  C+G G ++   +       C SC 
Sbjct: 114 --RGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVKK------CTSCN 165

Query: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYI 236
           G G K  I R     + R   +C+ C+G G      P+D CK C GK V +E K L V++
Sbjct: 166 GQGVK-FITRQMGPMIQRFQTECDACDGTGDII--NPKDRCKACSGKKVANERKILEVHV 222

Query: 237 PRGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAI 296
             G ++G  +  +GEADQ PD + GD++FV+ E P    +  R  DDL     I L  AI
Sbjct: 223 DPGMKDGQKIVFKGEADQAPDIIPGDVIFVVSERPH--KHFRRDSDDLVYEADIDLLTAI 280

Query: 297 TGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
            G E  +     D  LK++I  G+VI PG    +E +G P+   G  FG++ V+ +I FP
Sbjct: 281 AGGEFAIEHVSGD-WLKVEIVPGEVISPGMRKVIEGKGMPVLKYGG-FGNLLVKFNIVFP 338

Query: 357 PDNWFSEKSDVEVLRTLLP 375
            D+ F+   +++ L  +LP
Sbjct: 339 KDH-FTSLENMKKLEEILP 356

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  191 bits (486), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 188/377 (49%), Gaps = 30/377 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV  DA+  +IKK YRK AL+ HPDK        E+  KFKE+T AYE+LSD 
Sbjct: 5   TKFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSA----EAADKFKELTVAYEVLSDS 60

Query: 62  DSRKKYD---VYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSV 118
             R  YD                          + F  + GGG    PR P         
Sbjct: 61  QKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGG-ASRPRGPQ-------- 111

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           +  D +  +  S++ELY G+T K    + VLC  C+G G ++   +       C SC G 
Sbjct: 112 KGRDIKHEMSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAVKK------CASCNGQ 165

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G K  I R     + R   +C+ CNG G      P+D CK C+GK + +E K L V+I  
Sbjct: 166 GVK-FITRQMGPMIQRFQAECDACNGTGDIV--DPKDRCKTCNGKKIDNERKILEVHIEP 222

Query: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298
           G ++G  +  +GEADQ P  + GD++FVI + P    + ER+GD+L+ + ++ L  AI G
Sbjct: 223 GMKDGQKIVFQGEADQAPGVIPGDVIFVISQRPH--KHFERKGDNLYYQAEVDLLSAIAG 280

Query: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358
            E  +   +    LK+ I  G+VI PG    +E +G P+   G  FGD+ V   + FP  
Sbjct: 281 GEFAI-EHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGG-FGDLIVTFKVNFPT- 337

Query: 359 NWFSEKSDVEVLRTLLP 375
           N F+++  ++ L  +LP
Sbjct: 338 NHFADEESLKKLEEILP 354

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  191 bits (485), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 192/376 (51%), Gaps = 28/376 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TK Y++LGV+  A+  EIKKAYRK AL+ HPDK   E    E+  KFKE ++AYE+LSD 
Sbjct: 5   TKFYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSE----EAAEKFKEASSAYEVLSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM--NFFRTYAGGGFYDEPRQPYPEEENRSVR 119
           + R+ YD +                       + F  + G G    P+ P         R
Sbjct: 61  EKREVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPKGPQ--------R 112

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179
             D +  +  S++ELY G+T K    + +LC  C+G G +K   +       C  C G G
Sbjct: 113 GRDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK------CTGCNGQG 166

Query: 180 HKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRG 239
            K  + R     + R   +C+ C+G G      P+D CK C+GK + +E K L V++  G
Sbjct: 167 IK-FVTRQMGPMIQRFQTECDACHGTGDIV--DPKDRCKSCNGKKIENERKILEVHVEPG 223

Query: 240 SRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGF 299
            ++G  +  +GEADQ PD + GD++F++ E P    + +R GDDL    +I L  AI G 
Sbjct: 224 MKDGQKIVFKGEADQAPDVIPGDVVFLVSERPH--KHFKRDGDDLVYEAEIDLLTAIAGG 281

Query: 300 EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDN 359
           E  +     D  LK+ I  G+VI PG    +E +G P+   G  +G++ V+  I+F P+N
Sbjct: 282 EFALEHVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIVKFTIKF-PEN 338

Query: 360 WFSEKSDVEVLRTLLP 375
            F+ + +++ L  +LP
Sbjct: 339 HFTTEENLKKLEEILP 354

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  183 bits (465), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 126/374 (33%), Positives = 188/374 (50%), Gaps = 21/374 (5%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLY+VLGV+P A  +EIKKAYRK AL++HPDK       EE   KFKE++AAYEILSD 
Sbjct: 5   TKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNP----TEEGAEKFKEVSAAYEILSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTS 121
           + R+ YD +                          ++   F+               R  
Sbjct: 61  EKREIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQ--FFGGAGAGAGRPRGPQ-RGR 117

Query: 122 DARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHK 181
           D +  +  +++ELY G+T K    + +LC  C+G G +K   +       C SC G G K
Sbjct: 118 DIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK------CSSCNGQGVK 171

Query: 182 ERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSR 241
             + R     + R   +C+ C+G G      P+D CK C+ K V +E K L V+I  G +
Sbjct: 172 -FVTRQMGPMIQRFQAECDVCSGTGDII--DPKDRCKTCNAKKVTNERKILEVHIEPGMK 228

Query: 242 NGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEK 301
           +G  +  +GEADQ PD + GD++FV+ + P    + +R GDDL    +I L  AI G E 
Sbjct: 229 DGQNIVFKGEADQAPDVIPGDVIFVVAQKPH--KHFQRSGDDLVYEAEIDLLTAIAGGEF 286

Query: 302 VVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWF 361
            +     D  LK+ I  G+VI PG+   +E +G P+   G   G++ V   ++F P   F
Sbjct: 287 ALEHVSGD-WLKVSILPGEVISPGSKKVIEGKGMPIPKYGG-HGNLIVHFTVKF-PQKHF 343

Query: 362 SEKSDVEVLRTLLP 375
           +++  ++ L  +LP
Sbjct: 344 ADEDSLKKLEEILP 357

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  183 bits (465), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 124/376 (32%), Positives = 188/376 (50%), Gaps = 27/376 (7%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           +K Y++LGV+  A++ EIKKAYRK AL++HPDK        E+  KFKE+++AYE+LSD 
Sbjct: 5   SKYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSA----EAAEKFKEVSSAYEVLSDS 60

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM--NFFRTYAGGGFYDEPRQPYPEEENRSVR 119
           + R+ YD +                       + F  +           P         R
Sbjct: 61  EKRQVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFF-------GGAPGGGRPRGPQR 113

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179
             D +  + ++++ELY G+T K    + +LC  C G G ++   +       C SC G G
Sbjct: 114 GRDIKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAVKK------CSSCNGQG 167

Query: 180 HKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRG 239
           +K  + R     + R   +CE C G G      P+D CK C+GK V +E K L V++  G
Sbjct: 168 YK-FVTRQMGPMIQRFQTECEACAGTGDII--DPKDRCKSCNGKKVANERKILEVHVDPG 224

Query: 240 SRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGF 299
            ++G  +  +GEADQ PD + GD++FV+ E P    N +R GDDL    +I L  A+ G 
Sbjct: 225 MKDGQKIVFKGEADQAPDVIPGDVIFVVSEKPH--KNFQRVGDDLVYEAEIDLLTAVAGG 282

Query: 300 EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDN 359
           E  +     D  LK+ I  G+VI PG    +E +G P+   G  +G++ V   I FPP N
Sbjct: 283 EFSLEHVSGD-WLKVAIVPGEVISPGMRKVVEGKGMPIAKFGG-YGNLLVTFKINFPP-N 339

Query: 360 WFSEKSDVEVLRTLLP 375
            F+   +++ L  +LP
Sbjct: 340 HFTSDENLKKLEEILP 355

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  168 bits (425), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 118/402 (29%), Positives = 191/402 (47%), Gaps = 42/402 (10%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           ++LY++LGV+  AS+ +IKKAYR  AL+HHPDK       EES++KF++I  AYEIL DE
Sbjct: 7   SELYDILGVSASASRQDIKKAYRVNALKHHPDKNGHS---EESKLKFQQICKAYEILKDE 63

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM---NFFRTYAGGG-----FYDEPRQPYPEE 113
             R+ YD +                    M   + F  + GGG     F+++    + + 
Sbjct: 64  RKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKR 123

Query: 114 ENRSVRTSDARIP--------LKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQH 165
           +      S   +P        LK +++E+Y+GK  K   KR  LC +C+G G  K  Q  
Sbjct: 124 QGAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKASQ-- 181

Query: 166 PRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCV 225
                 C +C G G +   KR     V   +  C  C G+G  +  K +D C+ C+G+  
Sbjct: 182 ------CYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRG--SFMKQKDICRDCNGQGC 232

Query: 226 ISEEKTLTVYIPRGSRNGDIVKLEGEADQ-------EPDKVTGDLLFVIEENPETSTNLE 278
           I E +   + + +G  NG  V L GEAD+           + GD++ ++E+ P  +    
Sbjct: 233 IRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQLPHKAFWRH 292

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R    +    K+ L  ++ G    V +    ++LK+ +  G++++PG    +E  G P  
Sbjct: 293 RDASLVLDHCKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEGMGMP-- 350

Query: 339 DSGNKFGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNA 380
            SG +FG++Y++  + FP      +   VE LR  L + P A
Sbjct: 351 KSGGRFGNLYIRFDVAFPES---LKPETVEALRAALGQEPGA 389

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  165 bits (418), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 119/410 (29%), Positives = 195/410 (47%), Gaps = 51/410 (12%)

Query: 4   LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           LY+ LGVA +AS+ EIKKAYR  AL+HHPDK       E+S++KF++I  AYEIL D+  
Sbjct: 9   LYDTLGVAANASRQEIKKAYRLKALKHHPDKNGHS---EQSKLKFQQICKAYEILGDDKK 65

Query: 64  RKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYA---------------GGGFYDEPRQ 108
           R+ YD +                    M+    ++               G  F+   R 
Sbjct: 66  REMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDFFGSSRG 125

Query: 109 PYPEEENRSV--RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHP 166
              +   RS   R  D +  LK +++E+YNGK  K   KR  LC  CQG G         
Sbjct: 126 FRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEG--------S 177

Query: 167 RKPVVCQSCEGHGHKERIKRVAQGFVIRE-TVKCERCNGKGRTTPTKPEDHCKKCHGKCV 225
           +K   C +C G G + + KR  QG +++  +  C  C G G  T  KP D C  CHG+  
Sbjct: 178 KKATSCYACRGKGMQTQTKR--QGPIMQTWSSTCGTCGGSG--TIVKPSDICNGCHGQGW 233

Query: 226 ISEEKTLTVYIPRGSRNGDIVKLEGEADQ-------EPDKVTGDLLFVIEENPETSTNLE 278
           + E K   + + +G  NG  V +  EAD+           + GD++ ++E+ P  S    
Sbjct: 234 VRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILEQLPHRSL--- 290

Query: 279 RRGDD---LHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGW 335
           +RG D   L +  ++ L  ++ G    V +    ++LK+ +  G++++PG    +++ G 
Sbjct: 291 KRGHDSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQSMGM 350

Query: 336 PLDDSGNKFGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNARVADT 385
           P    G  +GD++++  + F PDN   +   ++ ++  L + P+ + + T
Sbjct: 351 PKSKGG--YGDLFIKFKVIF-PDNL--KPDTIQTMQAALDKEPSMQTSAT 395

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  151 bits (381), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 126/408 (30%), Positives = 190/408 (46%), Gaps = 46/408 (11%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           T+LY+VL V+P+AS  EI+KAYR LAL+HHPDK       EES+ KF E+  AYEIL DE
Sbjct: 5   TRLYDVLNVSPEASAVEIRKAYRLLALKHHPDKNNHS---EESKSKFLEVNEAYEILIDE 61

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTY----------AG---GGFYDEPRQ 108
             R  YD Y                     +FF T           AG     F+D+   
Sbjct: 62  KKRSLYDQYGTIDENAIQQSMPQEDPVMS-SFFNTGSPMGMGMGMSAGDLFASFFDKMSS 120

Query: 109 PY--PEEENRSV-RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQH 165
           P    ++  +S+    D +  LK ++  LY GK  K    R  +C  C+G G        
Sbjct: 121 PSFGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRG-------- 172

Query: 166 PRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCV 225
             K   C++C G G + R +++    +   T  C  CNG G  T TK  D C+ C G+  
Sbjct: 173 SMKVRTCKACRGRGQQSRSRQMGP-MMQTWTQTCSDCNGMG--TFTKDSDVCRDCEGEGC 229

Query: 226 ISEEKTLTVYIPRGSRNGDIVKLEGEADQ-------EPDKVTGDLLF-VIEENPETSTNL 277
           I E K   V +  G   G  + L GEAD+           + GD++  +I+        +
Sbjct: 230 IRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDPKFQRV 289

Query: 278 ERRGDDLHTR-LKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP 336
            R G DL  R  KI L  ++ G +  +    + +++ + I  G++I+P ++  +EN G P
Sbjct: 290 NRNGCDLMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGMP 349

Query: 337 LDD---SGNKFGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNAR 381
             +   +   +G++Y+Q  +EF P+   SE   V  L+ +L E PN +
Sbjct: 350 RYEEKRAPEGYGNLYIQFQVEF-PETLASET--VTKLKQVLDEDPNVK 394

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  150 bits (378), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 112/368 (30%), Positives = 174/368 (47%), Gaps = 39/368 (10%)

Query: 1   MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD 60
           M  LY+VLGVA DASQ+EIKKAYRKLAL++HPDK   +   E+    F++I+ AY +L D
Sbjct: 1   MESLYDVLGVASDASQSEIKKAYRKLALRYHPDKNNGD---EKCHEAFQKISHAYGVLGD 57

Query: 61  EDSRKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRT 120
              R++YD                        F   + GGG Y       P       R 
Sbjct: 58  VAQRQRYDQSGDENESLQPTGSNAADL-----FSSFFNGGGVYPSGSSGGPGPSRGPSRG 112

Query: 121 SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH 180
            +    LK ++++LY GK  K   +R   C+RC                 VC SC G G+
Sbjct: 113 PNIIHELKCTLQDLYRGKVIKLALRRTAPCERCSLGAAN-----------VCSSCNGSGN 161

Query: 181 KERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
             RI+RV        +  C  C G+GR +       C +C G   ++E     V++  G 
Sbjct: 162 ITRIERVGP-LTQTWSSTCNACQGQGRMSVD-----CSQCGGAQYLNERVVFKVHVKPGM 215

Query: 241 RNGDIVKLEGEADQ-EPDKV-------TGDLLFVIEENPETS---TNLERRGDDLHTRLK 289
            +G  + L+GEADQ   D++       +GD++ VI E  +     + L +R +    ++K
Sbjct: 216 HDGQTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENLFVDQVK 275

Query: 290 ISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIR-LENEGWPLDDSGNKFGDMY 348
           + L+ A+TG   ++       ++K+ I  G+ + P N I+ +E  G P+DD+G + GD+Y
Sbjct: 276 VDLTTALTGGNVLLEDHPSGNLMKINILPGEFL-PENCIKCVEGLGMPIDDTGQR-GDLY 333

Query: 349 VQVHIEFP 356
           ++     P
Sbjct: 334 IRFCTHSP 341

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  146 bits (368), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 108/358 (30%), Positives = 167/358 (46%), Gaps = 24/358 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +LGV   AS  +IK AYR+L+ ++HPDK   +   E++  +F E+  AYE LSD + R
Sbjct: 23  YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGD---EDAHNRFIEVGEAYEALSDPEKR 79

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXM----NFFRTYAGGGFYDEPRQPYPEEENRSVRT 120
           K YD +                         + F    GGG     R      + R  R 
Sbjct: 80  KIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGG--AGSRFHGGGGQRRKQRG 137

Query: 121 SDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH 180
              ++  +L++K+ Y+G + +F    N  CD C GSG          K   C  C G G 
Sbjct: 138 QSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSG------SQDGKVEKCGQCGGRGM 191

Query: 181 KERIKRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRG 239
             ++ R  QGF+ ++  + C++C G+G     K    CK CHG  V+ + K+  V +P G
Sbjct: 192 VVQVIR--QGFITQQIQQMCQKCEGRGEVIKNK----CKTCHGSKVVKKNKSFHVDVPAG 245

Query: 240 SRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGF 299
           +    +  + GEA++ PD   GD+   + E+P  +    RRG DL     +SL+EA+ G 
Sbjct: 246 APRDFVAVIRGEAEKSPDTEPGDIYVKVVESPVQNMGYRRRGPDLFRTEVLSLTEALKGG 305

Query: 300 EKVVTTTLDD-RILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
                  LD  + + L   +G  ++ G    ++  G PL +SG K+GD+YV   I  P
Sbjct: 306 WVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPL-ESGTKYGDLYVDYVIVMP 362

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  146 bits (369), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 111/375 (29%), Positives = 169/375 (45%), Gaps = 36/375 (9%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           T+LY+VLGV P  S  E+KK+Y+  AL++HPDK       E S+ +F++I  AY +L DE
Sbjct: 5   TRLYDVLGVQPGVSAAELKKSYKLAALRYHPDKNGHS---EASKQRFQQIADAYRVLGDE 61

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXXM----NFFRTYAGGGFYDEPRQPYPEEENRS 117
             RK YD Y                         + F  + G G        + E    S
Sbjct: 62  RLRKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESGASS 121

Query: 118 VRTS------DARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVV 171
            R S      D +  L+ +++ELY GK  +    R  LC  C G G          +   
Sbjct: 122 ARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRG--------GSRAST 173

Query: 172 CQSCEGHGHKERIKRVAQGFVIRE-TVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEK 230
           C +C G G   + KR  QG +++  +  C  C+G G  T  K  D C  C G   + E K
Sbjct: 174 CTACSGQGICSQTKR--QGSLVQTWSSTCRVCSGSG--TIVKDCDTCTSCGGAGYLRERK 229

Query: 231 TLTVYIPRGSRNGDIVKLEGEADQEPDK-------VTGDLLFVIEENPETSTNLERRGDD 283
              V I  G R G  V   GEAD+  +        + GDL   IEE    +T  + RGD 
Sbjct: 230 VFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEE-ATPATRYQCRGDA 288

Query: 284 --LHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSG 341
             L T L + L  ++ G    +      ++++L+I  G+++ PG    +E+ G P  D  
Sbjct: 289 NLLLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPDDP 348

Query: 342 NKFGDMYVQVHIEFP 356
           +++G ++++ H++FP
Sbjct: 349 SQYGHLFIKFHVDFP 363

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  143 bits (360), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 170/361 (47%), Gaps = 27/361 (7%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y++LGV  DA+  EIK AYR+L+ ++HPDK   +   EE+  KF E+  AY++LSD + R
Sbjct: 24  YKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGD---EEAHNKFIEVGEAYDVLSDSEKR 80

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMN-----FFRTYAGGGFYDEPRQPYPEEENRSVR 119
             YD Y                     +     F + + G  F    R           +
Sbjct: 81  NIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGGPGGRGRPRGQ 140

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179
               R   ++S+ + YNG+ FK+  + N  C++C G+G +        K   C  C+G G
Sbjct: 141 NLLLR--EEVSLMDFYNGREFKYNLQLNDFCEKCHGTGSKDG------KVTRCPDCQGRG 192

Query: 180 HKERIKRVAQGFVIRETVK--CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIP 237
               I +V Q  ++ + ++  C+RC+G G       ++ C  CHG  V   +K  TV +P
Sbjct: 193 ---VIVQVIQMGIMTQQIQHVCDRCSGSGEII----KNPCPHCHGHKVAKMDKEFTVKLP 245

Query: 238 RGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAIT 297
            G++   +    GEA++  D   GDL+F   EN   +    RRGD L+    +S+ EA+ 
Sbjct: 246 NGAQRNYVDIKHGEAEKGADFDAGDLMFEFRENSMNNMGYRRRGDHLYRTEVLSVQEALK 305

Query: 298 -GFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSGNKFGDMYVQVHIEF 355
            G+E+ +     D+ +KLK    +V+  G    +   G P L+  G KFGD+++   I  
Sbjct: 306 GGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFIDYVILM 365

Query: 356 P 356
           P
Sbjct: 366 P 366

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  142 bits (359), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 112/384 (29%), Positives = 182/384 (47%), Gaps = 40/384 (10%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +LGVA DAS+ +IK AYR+++ + HPDK A +   +E+  KF EI  AYE+LSD + R
Sbjct: 21  YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGD---DEAHHKFIEIGEAYEVLSDSEKR 77

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXX-------MNFFRTYAGGGFYDEPRQPYPEEENRS 117
             YD +                            + F    G          +P  +N  
Sbjct: 78  ATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFG--------DSHPGGQNVR 129

Query: 118 VRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEG 177
            + S+  +   +++   Y+G         N  C+ C GSG          +   C++C+G
Sbjct: 130 -KGSNLIVKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDN------QFATCETCQG 182

Query: 178 HGHKERIKRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYI 236
            G    I+ +  GF+ ++  + C  C GKG+T     +  CK C G  V+   KT  + +
Sbjct: 183 RG--VIIQVIQMGFMTQQIQQVCGACQGKGKTI----KHVCKICRGARVVKTPKTFEISV 236

Query: 237 PRGS-RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEA 295
           P G+ RN ++VK  G+A++ PD  +GDL+FV EEN   +    RRGD L+    +   EA
Sbjct: 237 PAGAQRNYNVVK-SGQAEKVPDMQSGDLVFVFEENSHENLGYRRRGDHLYRTEVLHWKEA 295

Query: 296 IT-GFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSG---NKFGDMYVQ 350
           +  G+E+ +    D + + +K  +  V  PG   R+ N G P L+  G   N +GD++++
Sbjct: 296 LLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDLFIE 355

Query: 351 VHIEFPPDNWFSEKSDVEVLRTLL 374
            ++   P  + S K   E++R  L
Sbjct: 356 -YVIVSPKEFPSGKGSPEIIRDEL 378

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  142 bits (357), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 109/356 (30%), Positives = 167/356 (46%), Gaps = 31/356 (8%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +LG++ DAS  EIK AYR+L+ ++HPDK   +   EE+  KF E+  AY+IL D + R
Sbjct: 22  YAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGD---EEAHHKFIEVGEAYDILGDPEKR 78

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTY---AGGGFYDEPRQPYPEEENRSVRTS 121
           K YDV+                     + F       GGGF    R      +N  VR  
Sbjct: 79  KTYDVHGADAFKNGGQGQRGGGFHDPFDMFEQMFGRQGGGFRQTQRS-----QNYQVRN- 132

Query: 122 DARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHK 181
                 ++S+KE Y+G   +F    N +CD C GSG          K  VC +C+G G  
Sbjct: 133 ------QVSLKEFYSGGEVEFEIPLNDICDSCHGSG------SADGKVKVCPACQGRGVV 180

Query: 182 ERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSR 241
            ++ R+  G + ++  +     G    T   P   CK C G  V+ + K      P G  
Sbjct: 181 VQVIRM--GPITQQIQQQCGQCGGKGKTIENP---CKTCKGHKVVRKNKPFHFEFPGGIP 235

Query: 242 NGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEK 301
              I K  GE+D+ PD  +GD++    E+ + +    RRG++L+    I+ +EAI G   
Sbjct: 236 RNHIDKKSGESDKSPDMESGDIIIEYNESEKENLGYRRRGNNLYRTEIITANEAINGGWT 295

Query: 302 VVTTTLDD-RILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
                LD+ + +KL  P+G ++  G+  R++  G P+  S N FGD+Y+   +  P
Sbjct: 296 REIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSKN-FGDLYIDYVVLVP 350

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  140 bits (353), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 111/361 (30%), Positives = 165/361 (45%), Gaps = 31/361 (8%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +LGV+  A   +IK AYR+L+ ++HPDK  D+   + +  KF E+  AYE+LSD + R
Sbjct: 22  YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDD---DSAHNKFIEVGEAYEVLSDPEKR 78

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXX-----MNFFRTYAGGGFYDEPRQPYPEEENRSVR 119
           K YD Y                          + F    GGG   + ++      N   R
Sbjct: 79  KIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRRARGHNLETR 138

Query: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179
                   +L++KE Y G +  F    N  C+ C+GSG          K   C  C+GHG
Sbjct: 139 E-------ELTLKEYYRGTSIDFNLNLNDFCEHCEGSG------SQDGKVTKCPDCKGHG 185

Query: 180 HKERIKRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
              +I R+  G V ++  + C +C G+G T   K    CK CHG+ V+ + K+  V +P 
Sbjct: 186 VVVQIVRM--GPVTQQIQQMCGKCQGRGSTIKNK----CKHCHGEKVVRKPKSFHVDVPP 239

Query: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAIT- 297
           G+    +   +GE+D+ PD   GDL     E    +    RRGDDL     +SL EA+  
Sbjct: 240 GAPRNFVEVKQGESDKGPDFDAGDLFIKFSETSRDNLGYRRRGDDLFRTEALSLREALKG 299

Query: 298 GFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPP 357
           G+E+ +      R +K+K     V   G   R+   G P +   NKFGD+Y+   +  P 
Sbjct: 300 GWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMPKEH--NKFGDLYIDYVVIVPD 357

Query: 358 D 358
           D
Sbjct: 358 D 358

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  142 bits (359), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 122/465 (26%), Positives = 199/465 (42%), Gaps = 74/465 (15%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLY++L V   A++ EIKKAYRK AL+HHPDK        ES   F++I+ AYE LS+ 
Sbjct: 5   TKLYDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSA---ESIKLFQDISHAYETLSNS 61

Query: 62  DSRKKYDVY--------------XXXXXXXXXXXXXXXXXXXXMNFFRTYAGG------- 100
           + R+ YD Y                                   + F  + GG       
Sbjct: 62  NKRELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSSGTG 121

Query: 101 --------GFYDEPRQPYPEEENRSVRTS-------------DARIPLKLSMKELYNGKT 139
                   G  + P Q +  + N +                   R  LK ++ +L++GK 
Sbjct: 122 ASGFGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHNLKCNLYDLFHGKR 181

Query: 140 FKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKC 199
            K    R  LC RCQG G +K  Q        C+ C+G G     KR+       +T  C
Sbjct: 182 AKLALNRTRLCQRCQGYGGKKATQ--------CRGCQGTGLFTTTKRMGPMVQTWQTT-C 232

Query: 200 ERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDK- 258
           + C+G G+   +K  D C +C G   I E K   V +  G RNG+ + L GEAD+  +  
Sbjct: 233 KECSGTGKYIRSK--DACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVINTE 290

Query: 259 ------VTGDLLFVIEENPETSTNLERR-----GDDLHTRLKISLSEAITGFEKVVTTTL 307
                 + GD++  I+      +N+  +      D +    ++ L  ++ G   ++    
Sbjct: 291 YGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILDNFEVDLKTSLCGGTIIIEDHP 350

Query: 308 DDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWFSEKSD- 366
                K+++  G++++PG    +EN+G P+D +GN FG++Y++  ++FP       KSD 
Sbjct: 351 SGNPFKIEVLSGELLKPGCIKCVENKGMPVDSNGN-FGNLYIRFRVKFPE----QLKSDT 405

Query: 367 VEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYLS 411
           +  L  +L +  N     +  +NN    I+ S +     L  + +
Sbjct: 406 INKLSEILVQDENISSILSDSINNKSYKINSSDIAEEQVLSTFTT 450

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  138 bits (347), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 107/357 (29%), Positives = 165/357 (46%), Gaps = 23/357 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +LG+  DAS  EIK +YR+L+ + HPDK   +   EE+  KF EI  AYE+LSD + R
Sbjct: 23  YAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGD---EEAHHKFIEIGEAYEVLSDPEKR 79

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDAR 124
           K +D Y                     + F  +                  +  R  + +
Sbjct: 80  KIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGGGGFGRMQRPRGHNLK 139

Query: 125 IPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERI 184
           +  +LS+KE Y G T +F    N +CD C G+G          K   C  C+G G    I
Sbjct: 140 VREQLSLKEYYTGATLEFTLALNDICDHCDGTG------SADGKVAKCSDCQGRG--VVI 191

Query: 185 KRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNG 243
           + +  G + ++  + C RC GKG       ++HCK CHG  V+ ++K   V +P G+   
Sbjct: 192 QVIRMGMMTQQIQQMCGRCGGKGSVI----KNHCKTCHGSKVVKKQKPFHVEVPPGAARH 247

Query: 244 DIVKLEGEADQEPDKVTGDLLFVIEENPETSTNL--ERRGDDLHTRLKISLSEAITGFEK 301
                 GE+D+  D   GD+   IE N +T+ NL   RRG  L+    +S  EA+ G  +
Sbjct: 248 YTETRSGESDKGADFDAGDVF--IEFNEKTTNNLGYRRRGPHLYRTEVLSAREALKGDWQ 305

Query: 302 VVTTTLDDRILKLKIPQGK--VIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
                LD++  K+KI + K  V+  G   R+   G P  +  + FGD++++  +  P
Sbjct: 306 REVEFLDEK-KKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDLFIEYVVVMP 361

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  137 bits (345), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/377 (27%), Positives = 173/377 (45%), Gaps = 37/377 (9%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           T+LY+ L ++ DA+  EIKKAYR  AL+ HPDK       E+S+ KF+EI  AYEIL D 
Sbjct: 7   TELYDTLNISVDATPQEIKKAYRLAALKSHPDKNNHS---EDSKRKFQEICKAYEILGDA 63

Query: 62  DSRKKYDVYXXXXXXXXXXXXXX-----XXXXXXMNFFRTYAGGG-------FYDEPRQP 109
             +  YD Y                          + F  + GGG       F+++    
Sbjct: 64  KKKLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMF 123

Query: 110 YPEEENRSVRTS---DARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHP 166
           +  ++N   R S   D +  L+ S++ELY+GK  K R  R  LC  C+G+G         
Sbjct: 124 FTGKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNG--------G 175

Query: 167 RKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVI 226
                C++C G G   + +R     V   +  C+ C G G  T  + +D C +C G+  I
Sbjct: 176 TSSSACRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSG--TFVRRKDVCSECKGQGCI 232

Query: 227 SEEKTLTVYIPRGSRNGDIVKLEGEADQ------EPDKVT-GDLLFVIEENPETSTNLER 279
            E K   + +  G  +G  + L  EAD+        ++V  GD++ ++++       +  
Sbjct: 233 KERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQVKHPLFQIHN 292

Query: 280 RGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDD 339
             D +     + L  ++ G E ++        LK+++  G++++PG    +E+ G P   
Sbjct: 293 DTDLVMNDCHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPGCVKCVESMGMPHPQ 352

Query: 340 SGNKFGDMYVQVHIEFP 356
           S   FG++Y++  ++FP
Sbjct: 353 S-QGFGNLYIRFQVDFP 368

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  135 bits (340), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 99/355 (27%), Positives = 167/355 (47%), Gaps = 19/355 (5%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y++L +  DA+  +I+ AYR+L+ ++HPDK  ++   E++  KF E+  AYEILSD + R
Sbjct: 24  YKILELDKDATDKDIRSAYRQLSKKYHPDKNPND---EDAHHKFIEVGQAYEILSDPEKR 80

Query: 65  KKYDVYX-XXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDA 123
           ++YD +                      + F    GGG         P ++ R  R  + 
Sbjct: 81  QRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQ-RGQNV 139

Query: 124 RIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKER 183
                 S+K  YNG   KF    N +CD C GSG       +  K   C  C+G G   +
Sbjct: 140 VARESTSLKNYYNGYVLKFSINLNDICDHCHGSG------SNDGKSTKCPDCQGRGVTVQ 193

Query: 184 IKRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRN 242
           + R+  G + ++  + C +C GKG+      ++ CK CHG  V+ + K   + +P G+  
Sbjct: 194 VIRM--GMMTQQIQQVCGKCGGKGQII----KNPCKTCHGSKVVQKPKDFEIELPAGAPR 247

Query: 243 GDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAI-TGFEK 301
             +    G AD+ PD  +GD+     EN + +    RRG  L+    ++ +EA+  G+E+
Sbjct: 248 KFVHAEHGAADKHPDYDSGDVYIEFTENDKDNMGYRRRGPHLYRTEVLNATEALYGGWER 307

Query: 302 VVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
            +      +I+ +K    K+I+ G   R+   G PL +    FGD+++   +  P
Sbjct: 308 QLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYVVVMP 362

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  135 bits (339), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 102/357 (28%), Positives = 161/357 (45%), Gaps = 29/357 (8%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +LGV   AS+ EIK AYR+L+ ++HPDK       +E+   F E+  AY++LSD + R
Sbjct: 22  YAILGVDKQASEKEIKSAYRQLSKKYHPDKNPG---NDEAHHHFIEVGEAYDVLSDPEKR 78

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXX--MNFFRTYAGGGFYDEPRQPYPEEENRSVRTSD 122
           + YD +                       + F    G   Y+  R   P  +N  V    
Sbjct: 79  QIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGK-PRGQNLQVNHD- 136

Query: 123 ARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKE 182
                 +S+K  Y G  F+F    N +CD C GSG          K   C  C G G   
Sbjct: 137 ------ISLKTFYLGTEFEFTLNLNDICDACDGSG------SEDGKTETCPDCGGSG--- 181

Query: 183 RIKRVAQGFVIRETVK--CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
           +I +V +   I + V+  C RC G+G+      +  CKKC G  V+ + K  T  +  G 
Sbjct: 182 QIMKVFRAGPIEQRVRQPCSRCQGRGQLI----KHVCKKCKGVKVVQKSKVFTAKVEPGM 237

Query: 241 RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAIT-GF 299
               I  ++G++++ PD   GDL     E+ + S    RRG+ L+    +S  EA+  G+
Sbjct: 238 ERNHIHVMQGQSEKHPDIEPGDLYQYFRESEKDSMGYRRRGNTLYRTEILSFKEALQGGW 297

Query: 300 EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
           E+ +     ++ L L  P G  ++ G    +++ G P+  + +KFGD+ +   I  P
Sbjct: 298 ERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVILLP 354

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  134 bits (337), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 162/370 (43%), Gaps = 45/370 (12%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +LG+  DAS  ++K AYR+L+ ++HPDK   +   E +  +F E+  AYE+LSD + R
Sbjct: 21  YSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGD---ESAHQRFIEVGEAYEVLSDPEKR 77

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSV------ 118
             +D Y                                + +P   + +  NR        
Sbjct: 78  GIFDQYGADGLKNGAGGGGGPGGGFGG-----------FHDPFDIFEQMFNRGGGGGGFG 126

Query: 119 ---------RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKP 169
                    +    R+  +LS+K+ Y+G   +F    N +CD C+GSG          K 
Sbjct: 127 GGFGGMHRGKGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSG------SEDGKV 180

Query: 170 VVCQSCEGHGHKERIKRVAQGFVIRETVK--CERCNGKGRTTPTKPEDHCKKCHGKCVIS 227
             C  C G G   +I R+    ++ + ++  C RC+G+G       ++ CK C G  V+ 
Sbjct: 181 ETCPDCGGQGILIQIIRMG---IMTQRIQQPCGRCSGRGHII----KNQCKACGGHKVVK 233

Query: 228 EEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTR 287
           + K+  V +P G+    +     EADQ  D   GD+     E+ + +    RRGD L   
Sbjct: 234 KPKSFQVEVPAGAPRDHVEVRHQEADQSTDMEAGDIFVEFTESDKNNMGYRRRGDHLFRT 293

Query: 288 LKISLSEAITGFEKVVTTTLDD-RILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGD 346
             +S  EA+ G        LDD + +KL+ P+G ++  G   ++   G P   SG  FGD
Sbjct: 294 EVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGD 353

Query: 347 MYVQVHIEFP 356
           ++V+  +  P
Sbjct: 354 LFVEYAVVMP 363

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  133 bits (335), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 103/357 (28%), Positives = 164/357 (45%), Gaps = 22/357 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +L V  DAS+ EIK AYR+L+ ++HPDK +     EE+  KF E+  AY++LSD + +
Sbjct: 25  YAILEVDKDASEKEIKSAYRQLSKKYHPDKNSGS---EEAHHKFIEVGEAYDVLSDPEKK 81

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNF---FRTYAGGGFYDEPRQPYPEEENRSVRTS 121
           K YD +                      F   F  +                + +  R  
Sbjct: 82  KIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPFDIFEHMFQGGHGGPGGGFGQRQRQRGP 141

Query: 122 DARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHK 181
             ++  KLS+K+ Y+G + +F    N  CD C GSG          K   C  C+G G  
Sbjct: 142 MIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG------SADGKLAQCPDCQGRGVI 195

Query: 182 ERIKRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240
            ++ R+  G + ++  + C RC G G+      ++ CK CHGK VI + K   V +P G+
Sbjct: 196 IQVLRM--GIMTQQIQQMCGRCGGTGQII----KNQCKTCHGKKVIKKNKFFHVDVPPGA 249

Query: 241 RNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAI-TGF 299
               +    GEA++ PD   GDL+   +E    +    RRGD+L+    +S  EA+  G+
Sbjct: 250 PRNYLDTRAGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAEEALYGGW 309

Query: 300 EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
           ++ +    +++ +KL  P   V+  G    L+  G P   SG   GD+Y+   +  P
Sbjct: 310 QRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMP--KSGKGHGDLYIDYVVIMP 364

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  133 bits (335), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 122/461 (26%), Positives = 192/461 (41%), Gaps = 70/461 (15%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           T+LY++L V  DASQ  IKKA+   AL+ HPDK       EES+ +F+EI+ AYE+LSD 
Sbjct: 5   TRLYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHS---EESKKQFQEISKAYEVLSDP 61

Query: 62  DSRKKYDVYXXXXXXXXXXX------XXXXXXXXXMNFFRTYAGGGF------------- 102
            SR+ YD Y                          M+ F T AG  F             
Sbjct: 62  KSREMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDAGPS 121

Query: 103 ---------YDEPRQPYPEEENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRC 153
                    +    Q +   +       D +  LK ++ +LY GK  K    R  +C  C
Sbjct: 122 FGFGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVCSSC 181

Query: 154 QGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKP 213
            G G          +   C++C+G G   + +RV    V   +  C  C+G G  T  K 
Sbjct: 182 DGKG--------GMRVASCRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTG--TFIKD 230

Query: 214 EDHCKKCHGKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPD------KVT-GDLLFV 266
            D C  C G  V  E K   V +  G  +  ++ L GEAD+  +      KV  GD++ V
Sbjct: 231 SDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQPGDVVIV 290

Query: 267 IEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGN 326
           I+    T   +    D +    ++ L   + G E ++      +I+KL I   ++++P  
Sbjct: 291 IDLVKNTQFQVVNDHDLVLKNCEVPLKTCLCGGEIMIEGHPSGKIIKLSIIPNELLKPSC 350

Query: 327 YIRLENEGWPL----DDSGN-------KFGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLP 375
           +  +E  G P      D  N        +G++YVQ  ++FP      E + +  L+ +L 
Sbjct: 351 FKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFPER---LEDTTITKLQEILE 407

Query: 376 EVPNARVADTGD-------LNNTETVIDYSVVKSADELPDY 409
           + PN +  D  D       + N++  ++      +D +PDY
Sbjct: 408 QDPNVKKEDESDQKRIDDAVTNSDGAVEVEEHVLSDFVPDY 448

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  130 bits (328), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/366 (27%), Positives = 165/366 (45%), Gaps = 20/366 (5%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y++LG+A DA+  EIK AYR+L+ + HPDK       E++  KF E+  AYE+LSD   R
Sbjct: 23  YQILGIAKDATDKEIKSAYRQLSKKFHPDKNPGN---EDAHQKFIEVGEAYEVLSDPQKR 79

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDAR 124
           + +D +                     + F  +                + +  R  +  
Sbjct: 80  QTFDQFGADAVKNGGQGQPGGGAQFH-DPFDIFEQMFGGQGGGGNPFGGQRQKPRGPNIM 138

Query: 125 IPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERI 184
              ++S+K+ Y G    F    N LCD C G+G          K   C  C+G G    I
Sbjct: 139 AREEISLKDYYTGYELNFTLNVNDLCDHCHGTG------SDDGKLTPCPDCQGRG--VII 190

Query: 185 KRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNG 243
           + +  G + ++  + C RC GKG+      +  C+KCHG  V+ ++K   V +P+G++  
Sbjct: 191 QLIRMGMMTQQIQQMCGRCGGKGQLF----KKQCRKCHGNKVMPQKKEFQVKLPKGAKRH 246

Query: 244 DIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVV 303
            +    GEAD+ PD   GDLL    EN +++    RRG +L+    ++++EA+ G  +  
Sbjct: 247 YMDVKHGEADKNPDLEAGDLLIEFNENDKSNMGYRRRGQNLYRTEVLNVTEALYGGWQRE 306

Query: 304 TTTLD-DRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNK-FGDMYVQVHIEFPPDNWF 361
              LD  + L++      V+  G   R+   G P      + FGD+++  ++   P  W 
Sbjct: 307 IPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFID-YVVIMPKQWN 365

Query: 362 SEKSDV 367
              S +
Sbjct: 366 KVSSSI 371

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  129 bits (323), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 106/356 (29%), Positives = 158/356 (44%), Gaps = 36/356 (10%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +LGV+ DAS+ EIK AYR+L+ ++HPDK   +   E +  KF E+  AYE+LSD+  R
Sbjct: 26  YAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGD---ETAHHKFIEVGEAYEVLSDDQKR 82

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXX---------MNFFRTYAGGGFYDEPRQPYPEEEN 115
           + Y+ Y                             M+ F    G       ++       
Sbjct: 83  QIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFG------AQRGGGGRGR 136

Query: 116 RSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSC 175
                 +AR   ++++KE Y G +  F    N  CD C+G+G +        K   C  C
Sbjct: 137 PRGHNLEAR--EEITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDG------KTTRCSDC 188

Query: 176 EGHGHKERIKRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTV 234
           +G G   +I R+  G + ++  + C  C GKG+    K    CK+CHG  V  + K   V
Sbjct: 189 QGQGVVIQIIRM--GPITQQIQQMCGACQGKGQIIKNK----CKQCHGAKVERKTKHFHV 242

Query: 235 YIPRGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSE 294
            +P G+    +    GEAD+ PD   GD+     E+   +    RRG  LH    ++L E
Sbjct: 243 DVPAGAPRDFVDVKNGEADKGPDFDAGDVYIKFSESSRDNMGYRRRGVHLHRTEVLTLKE 302

Query: 295 AITGFEKVVTTTLDD-RILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYV 349
           A+ G  K     LD  + +KL    G  +R G   R+   G P D  G  FGD++V
Sbjct: 303 ALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMPKD--GRHFGDLFV 356

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  127 bits (320), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/356 (27%), Positives = 164/356 (46%), Gaps = 21/356 (5%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +L +  DA++ EIK AYR+L+ ++HPDK A     EE+  KF E+  AY++LSD + +
Sbjct: 25  YAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGS---EEAHQKFIEVGEAYDVLSDPEKK 81

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXM--NFFRTYAGGGFYDEPRQPYPEEENRSVRTSD 122
           K YD +                       + F  +                + +  R   
Sbjct: 82  KIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQRGPM 141

Query: 123 ARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKE 182
            ++  KLS+K+ Y+G + +F    N  CD C GSG          K   C  C+G G   
Sbjct: 142 IKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG------SADGKLAQCPDCQGRGVII 195

Query: 183 RIKRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSR 241
           ++ R+  G + ++  + C RC G G+      ++ CK CHGK V  + K   V +P G+ 
Sbjct: 196 QVLRM--GIMTQQIQQMCGRCGGTGQII----KNECKTCHGKKVTKKNKFFHVDVPPGAP 249

Query: 242 NGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAI-TGFE 300
              +    GEA++ PD   GDL+   +E    +    RRGD+L+    +S +EA+  G++
Sbjct: 250 RNYMDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAAEALYGGWQ 309

Query: 301 KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
           + +    +++ +KL  P   V+  G    ++  G P    G  +GD+Y+   +  P
Sbjct: 310 RTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKG--YGDLYIDYVVVMP 363

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  127 bits (320), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 159/355 (44%), Gaps = 21/355 (5%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +L +   AS+ EIK AYR+L+ + HPDK A     EE+  KF E+  AY++LSD + +
Sbjct: 25  YAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGS---EEAHQKFIEVGEAYDVLSDPEKK 81

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDAR 124
           K YD +                     + F  +                + +  R    +
Sbjct: 82  KIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQRGPMIK 141

Query: 125 IPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERI 184
           +  KLS+K+ Y+G + +F    N  CD C GSG          K   C  C+G G   ++
Sbjct: 142 VQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG------SADGKLAQCPDCQGRGVIIQV 195

Query: 185 KRVAQGFVIRETVK--CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRN 242
            R+    ++ + ++  C RC G G+      ++ CK CHG  V    K   V +P G+  
Sbjct: 196 LRMG---IMTQQIQQMCGRCGGTGQVI----KNECKTCHGNKVTKRNKFFHVDVPPGAPR 248

Query: 243 GDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAI-TGFEK 301
             +    GEA++ PD   GDL+   +E    +    RRGD+L+    +S+ EA+  G+E+
Sbjct: 249 NYMDTRAGEAEKGPDFDAGDLVIEFKEKDSENMGYRRRGDNLYRTEVLSIEEALYGGWER 308

Query: 302 VVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
            +    +++ +KL  P    +  G    ++  G P    G  +GD+Y+   +  P
Sbjct: 309 TIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMP--KGGKGYGDLYIDYVVIMP 361

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  127 bits (319), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 98/354 (27%), Positives = 160/354 (45%), Gaps = 19/354 (5%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +L +  DAS+ EIK AYR+L+ ++HPDK A     +E+  KF EI  AYE+LSD + +
Sbjct: 25  YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGS---DEAHHKFIEIGEAYEVLSDPEKK 81

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDAR 124
           K YD +                     + F  +       +        + +  R    +
Sbjct: 82  KIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGFGQRQRQRGPTIK 141

Query: 125 IPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERI 184
           +   LS+K+ Y+G + +F    N  CD C GSG          K   C  C+G G   ++
Sbjct: 142 VHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG------SADGKLAQCPDCQGRGIIVQV 195

Query: 185 KRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNG 243
            R+  G + ++  + C RC G G+      ++ CK CHGK V  + K   V +P G+   
Sbjct: 196 VRM--GIMTQQIQQICGRCAGTGQVI----KNQCKTCHGKKVTKKNKFFHVDVPPGAPRN 249

Query: 244 DIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAI-TGFEKV 302
            +    GEA++ PD   GDL+    E    +    RRG +L+    +S +EA+  G+E+ 
Sbjct: 250 YMDTRAGEAEKGPDFDAGDLVIEFREMDTENMGYRRRGHNLYRTEVLSAAEALYGGWERT 309

Query: 303 VTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
           +    +++ +KL  P   V+  G    ++  G P        GD+Y+   +  P
Sbjct: 310 IEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMP--KGSRDHGDLYIDYVVVMP 361

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  123 bits (309), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 95/365 (26%), Positives = 164/365 (44%), Gaps = 29/365 (7%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y++LG+  +AS+  IK AYR+L+ ++HPDK  ++   EE+   F EI  AYE+LSD + R
Sbjct: 31  YKILGIPKEASEKAIKSAYRQLSKKYHPDKNQND---EEAHNHFIEIGEAYEVLSDPEKR 87

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFFR-----------TYAGGGFYDEPRQPYPEE 113
           + YD +                       F               G              
Sbjct: 88  RTYDQFGSDAFQNGGQGQGGPGGPGGPGGFHDPFDLFNQMFGGNKGNFGGFGGFGGGGFA 147

Query: 114 ENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQ 173
           ++R  +    ++   LS++E + G    F+      CD C+GSG          K   C+
Sbjct: 148 DDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSG------SEDGKVDKCK 201

Query: 174 SCEGHGHKERIKRVAQGFVIRET-VKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTL 232
            C G+G   ++ R+  G V ++   +C +C+G G T     ++HCKKCHG+ ++++ K +
Sbjct: 202 ECGGNGFVVQVIRM--GPVTQQMHTQCPKCHGAGSTI----KNHCKKCHGQKLVTKSKEI 255

Query: 233 TVYIPRGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISL 292
            V +P G+    +  +E   D+E +   GDLL   +E  + +    RRG+DL     +  
Sbjct: 256 NVKVPAGAPRDFLKIVENGGDKELNAEAGDLLVQFQEIAQNNLGYRRRGNDLFRTEALVF 315

Query: 293 SEAI-TGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQV 351
            +A+  G+ + +      R +K+    G  +      +L   G P+  S ++FGD+Y+  
Sbjct: 316 KDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQGS-DRFGDLYIDY 374

Query: 352 HIEFP 356
            I  P
Sbjct: 375 VIIVP 379

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score =  122 bits (305), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 116/400 (29%), Positives = 181/400 (45%), Gaps = 59/400 (14%)

Query: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
           TKLYE L V   A+  +IKKAY+KLAL++HPDK       E+S+ KF+ +  AYEIL+D+
Sbjct: 5   TKLYETLNVPITATTLDIKKAYKKLALKYHPDKNNHS---EDSKTKFQAVCQAYEILNDK 61

Query: 62  DSRKKYDVYXXXXXXXXXXXXXXXXXXXX----MNFFRTYAGGG-----FYDE----PRQ 108
            SR  YD                          M F       G     F+D      +Q
Sbjct: 62  QSRAIYDALGITDEALIEQQKKQQQQQHQQQGGMEFPPMGMSPGDLFAQFFDNNNNAAKQ 121

Query: 109 P-------YPEEENRSVRTS-----------DARIPLKLSMKELYNGKTFKFRSKRNVLC 150
           P       YP  ++ S  T+           D +  LK +++ELYNGK  K    R  LC
Sbjct: 122 PSQSQMHAYPNFKSESHVTNGKADHPLHRGPDIKHVLKCTLRELYNGKMAKLALNRTRLC 181

Query: 151 DRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTP 210
             C G G  ++          C+SC+G G + + +R+    V   T  C  C+G G    
Sbjct: 182 LPCNGFGGLQR--------TTCESCQGDGFQTQTRRMGP-MVQTWTQTCASCDGAG--CF 230

Query: 211 TKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQ-------EPDKVTGDL 263
            KP D C  CHG+  I E K   V +  G ++G  V ++GEAD+       +   + GD+
Sbjct: 231 IKPNDVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEKVIPGDV 290

Query: 264 LFVIEENPETSTNLE--RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKV 321
           +  I+++ + +   +     D L     + L  ++ G E  +      +++KL I  G++
Sbjct: 291 VITIKQSRDENNCFQMINNKDLLMNGCPVDLVTSLCGGEVYIDNHPSGKLIKLDIIPGEI 350

Query: 322 IRPGNYIRLENEGWPL-----DDSGNKFGDMYVQVHIEFP 356
           ++P  +  +E  G P      DD+  + GD+Y+Q  I++P
Sbjct: 351 LKPNCFKIIEGLGMPYLEDGKDDTMLRRGDLYIQFKIQYP 390

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score =  104 bits (260), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 94/355 (26%), Positives = 153/355 (43%), Gaps = 24/355 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y +LGV  +A++ +IK AYR+L+ ++HPDK   +     +   F E+  AYE LSD + R
Sbjct: 23  YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTT---AHHNFIEVGEAYEALSDPEKR 79

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXX-MNFFRTYAGGGFYDEPRQPYPEEENRSVRTSDA 123
           + YD Y                      + F               +   + R  R+   
Sbjct: 80  RIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMF------GGGARFGGGQRRRQRSQSL 133

Query: 124 RIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKER 183
           ++  +L++++ Y+G   +F    N  CD C  +G +        K   C  C   G   +
Sbjct: 134 QVQEELTLRQYYHGTAVEFTLSLNDHCDHCGATGSQDG------KVERCTQCSVRGVIVQ 187

Query: 184 IKRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRN 242
           + R  QGF+ ++  + C R  G     P      CK C G   I + K+  V +P G+  
Sbjct: 188 VGR--QGFMTQQFQQVCPRLLG---PWPKALPKKCKVCQGHKAIKKNKSFRVEVPPGAPR 242

Query: 243 GDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKV 302
             +   +GEA++ PD   GD+   + EN   +    R+G +L     +SL EA+ G  K 
Sbjct: 243 DFVAVQQGEAEKVPDMDPGDIYVKVFENTRDNMGYRRQGANLFRTEVLSLKEALHGDWKR 302

Query: 303 VTTTLD-DRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
               LD  + +     +G+ ++ G   R+   G PL DS   FGD+YV   +  P
Sbjct: 303 ELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSAG-FGDLYVDYVVILP 356

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  105 bits (262), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 111/246 (45%), Gaps = 19/246 (7%)

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           R  D +  LK  +KELY+GK  K    R  LC RC G G             VC  C G 
Sbjct: 151 RGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSGHG--------SMTSSVCGECRGQ 202

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G   + +R     V   +  C  C+G G  T  K  D C+ C G   I E K   V I  
Sbjct: 203 GVYSQTRRHGP-LVQTWSSSCRNCSGAG--TFVKSNDVCQTCRGTGYIRERKIFEVEIKP 259

Query: 239 GSRNGDIVKLEGEADQ-------EPDKVTGDLLFVIEENPETSTNLERRGDDL-HTRLKI 290
           G  N   + L GEADQ       +   + GD++ +++E   T      R  DL  TR  +
Sbjct: 260 GLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRFRESDLVLTRCVV 319

Query: 291 SLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQ 350
            L  ++ G    +      R +KL++  G+++ PG+   +EN G P  D+ +++GD+Y++
Sbjct: 320 DLRTSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNPSQYGDLYIK 379

Query: 351 VHIEFP 356
             + FP
Sbjct: 380 FCVNFP 385

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++L V+P  S  E+KK+Y+  AL++HPDK       E ++  F++IT AY ILSDE
Sbjct: 5  TRFYDLLNVSPTVSPQELKKSYKLAALRYHPDKNGHS---ESAKQAFQQITEAYGILSDE 61

Query: 62 DSRKKYDVY 70
            RK YD Y
Sbjct: 62 RKRKIYDRY 70

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score =  102 bits (253), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 123/441 (27%), Positives = 192/441 (43%), Gaps = 69/441 (15%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLRE-ESEMKFKEITAAYEILSDEDS 63
           Y+ LGV+ DAS ++IK+AY KLA ++HPD     + +E  ++  F  +  AYEILSDE  
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPD-----INKEPGADKTFHNLQNAYEILSDEKK 104

Query: 64  RKKYDVYXXXXXXXXXXXXXXXXXX--------------XXMNF------------FRTY 97
           + +YD Y                                  +NF            FR  
Sbjct: 105 KLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGFRNG 164

Query: 98  AGGGFYDEPRQPYPEEENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSG 157
              G ++       E +  S+      +  K ++  L N  + K++S     C  C GSG
Sbjct: 165 GDAGGFNGRANIVREYQGDSIEIQHV-VSFKDAVFGL-NNVSLKYKSLD--PCGTCHGSG 220

Query: 158 LRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHC 217
           L K  +QH RK   C  C G G +  +K    GF +  T  C  C+G+G T     ED C
Sbjct: 221 L-KNGEQHKRK--TCSYCNGTGTQVHVK---SGFQMAST--CMHCHGEGTTIAR--EDTC 270

Query: 218 KKCHGKCV-ISEEKTLTVYIPRGSRNGDIVKLEGE------ADQEPDKVT----GDLLFV 266
             C G  V I+ +K+L V  P G  +GD++++ GE      A  E DK      GDLL  
Sbjct: 271 SACDGDGVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVR 330

Query: 267 IEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGN 326
           I    +    ++ +  D+ T  +I ++ A  G   V   T+D + ++LK+  G   +   
Sbjct: 331 IRVKSDPKFFVKNK-YDIWTIKEIPITTAALG-GTVEIETVDGKNIRLKVISG--TQHDQ 386

Query: 327 YIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWFSEKSDVE-VLRTLLPEVPNARVADT 385
              + N G P  + G   G+M VQ  I          +S++E  L   L +V N ++A  
Sbjct: 387 VTSIPNMGIPYRN-GTGRGNMNVQYKIVIK-----KPQSNIERCLWEGLADVTNDKMAKR 440

Query: 386 GDLNNTETVID-YSVVKSADE 405
             +N + +++D  S V ++ E
Sbjct: 441 TIVNGSGSIMDQASTVGTSSE 461

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 88/335 (26%), Positives = 149/335 (44%), Gaps = 33/335 (9%)

Query: 98  AGGG---FYDEPRQPYPEEENRSV-RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRC 153
           +GGG    Y  P +   E E R + R  D +  LK ++KELY GKT K    R  +C  C
Sbjct: 154 SGGGMNNLYSPPSRYNSEGEGRHLNRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICQVC 213

Query: 154 QGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKP 213
            G G  KK+         C++C+G G + +  R+    V   +  C  C G G    +K 
Sbjct: 214 DGHGGLKKY--------ACKTCKGQGVQTQTNRMGP-LVQSWSQTCADCGGAGIFVESK- 263

Query: 214 EDHCKKCHGKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDK--------VTGDLLF 265
            D C++C G   + + K L V +  GS +  ++ L GE D+            + GD++ 
Sbjct: 264 -DICQQCQGLGFVKQRKILQVAVQPGSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVI 322

Query: 266 VIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPG 325
            I    +    +    + ++ + K+ L  ++ G    +      +++KL I  G+V++PG
Sbjct: 323 TILRLKDPRFQIVDDYNLIYKKCKVDLMTSLCGGVVYIEGHPSGKLIKLDIIPGEVLKPG 382

Query: 326 NYIRLENEGWP--LDDSGNKFGDMYVQVHIEFP----PDNWFSEKSDVEVLRTLLPEVPN 379
            +  +EN G P  ++   + FG MYV+  + +P    P+N    +  +   + +  E   
Sbjct: 383 CFKTVENMGMPKFINGVRSGFGHMYVKFEVTYPRRLEPENAIKLQKVLANDKYVQNERSA 442

Query: 380 ARVADTG---DLNNTETVIDYSVVKSADELPDYLS 411
              AD     DL  +  V++  V+ S  E PD  S
Sbjct: 443 METADADCYCDLERSYNVVEEHVLSSF-EAPDMKS 476

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T LY+ L V   AS +EIKKAYR  AL++HPDK       EES+ KF+EI  AYE L D 
Sbjct: 5  TSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHT---EESKRKFQEICQAYETLKDN 61

Query: 62 DSRKKYDVY 70
            R  YD Y
Sbjct: 62 HLRSLYDQY 70

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 115/248 (46%), Gaps = 22/248 (8%)

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSG-LRKKFQQHPRKPVVCQSCEG 177
           R  D +  LK ++ ELY+GK  K    R  +C  CQG G LR++          C++C G
Sbjct: 161 RGPDIKHNLKCTLAELYDGKITKLGLNRRRMCQSCQGQGSLRRR---------TCKTCRG 211

Query: 178 HGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIP 237
            G +   +R     V   T  C  CNG G  T TK  D C +C G+  I E K   V + 
Sbjct: 212 QGQQTETRRTGP-MVQTWTQTCPDCNGLG--TYTKQADVCHECRGESYIKERKIFDVEVS 268

Query: 238 RGSRNGDIVKLEGEADQEPDK-------VTGDLLFVIEENPETSTN-LERRGDDL-HTRL 288
           +G  +G  + L GEAD+           + GD++  I++  ++  + + R G DL     
Sbjct: 269 KGMCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQVKDSKFHRVNRYGCDLVMGSC 328

Query: 289 KISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMY 348
            I LS ++ G +  +      ++LK+ I  G++I P     +E  G P        G++Y
Sbjct: 329 SIDLSTSLCGGDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGGKGNLY 388

Query: 349 VQVHIEFP 356
           +Q  +E+P
Sbjct: 389 IQFQLEYP 396

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 51/69 (73%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+LY+ L V+PDA+ +EIK+AY+ +AL++HPDK       E+++ KF+E+  AYEIL+DE
Sbjct: 5  TRLYDTLKVSPDATISEIKRAYKVMALKYHPDKNHHS---EDAKNKFQEVCKAYEILADE 61

Query: 62 DSRKKYDVY 70
          D R  YD Y
Sbjct: 62 DKRVMYDRY 70

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score = 98.2 bits (243), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 113/235 (48%), Gaps = 14/235 (5%)

Query: 124 RIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKER 183
           ++  +LS+K+ Y G  F+F    +  CD C G+G          K  VC  C+G G   +
Sbjct: 152 KVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTG------SEDGKTKVCPDCKGSGIIIQ 205

Query: 184 IKRVAQGFVIRETVK-CERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRN 242
           I R+  G + ++  + C RC G+G       ++ CK C+G  V  + K   VY+P GS  
Sbjct: 206 IIRM--GMMTQQIQQPCGRCRGQGHLI----KNFCKVCNGAKVQQKLKDFKVYVPPGSPR 259

Query: 243 GDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG-FEK 301
             +    G+A++ P+   GD++    E P  +    RRG++L     ISL+EA+ G +E+
Sbjct: 260 NHVEVKAGQAEKNPNYEPGDVIIEFNELPLDNLGYRRRGNNLFRTEYISLNEALYGNWER 319

Query: 302 VVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
            +      + + LK      I  G    L+  G P+ +  NKFGD+Y+   +  P
Sbjct: 320 TLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKKNKFGDLYIDYKVIIP 374

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 44/65 (67%), Gaps = 4/65 (6%)

Query: 5  YEVLGVAPDAS-QTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
          Y++LG+  +   + EIK AYRKL+ ++HPDK  ++   ++++  F ++  AY++L D D 
Sbjct: 26 YKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKND---KDAQQNFIKVGEAYDVLGDPDK 82

Query: 64 RKKYD 68
          +++YD
Sbjct: 83 KRQYD 87

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 99/366 (27%), Positives = 159/366 (43%), Gaps = 54/366 (14%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y+ LG+  +ASQ++IKKAY KLA ++HPD +  E   E +E KF ++  AYEILSDE  R
Sbjct: 49  YKTLGINSNASQSDIKKAYYKLAKKYHPD-INKE---ENAEAKFHDLQNAYEILSDEQKR 104

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNF--------FRTYAGGGFYDEPRQPYPEEEN- 115
           K+YD +                      F        F  + G  F D     + ++ + 
Sbjct: 105 KQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLFGNAFKQQHSN 164

Query: 116 ----------RSVRTSDARIPLKLSMKE-LYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQ 164
                     R  +     +   L+ K+ ++  K  K        C+ C GSGL+     
Sbjct: 165 NTSNSNRNFFREFKGDTIHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNGSGLK----- 219

Query: 165 HPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKC 224
           H      CQ+C G G +  I+    GF +  T  C  CNG+G  T   P D+C  CHG  
Sbjct: 220 HNAHKSTCQTCNGTGTRVHIR---GGFQMMST--CNDCNGEG--TKIDPNDYCNHCHGDG 272

Query: 225 V-ISEEKTLTVYIPRGSRNGDIVKLEGEAD-----QEPDKVT--------GDLLFVIEEN 270
           V     K +TV +P   ++GD++++  +        +PD +         GD+L  I   
Sbjct: 273 VEFKRNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLINNNNVRMTRGDILIKINVI 332

Query: 271 PETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRL 330
            +T   +  + D  +T ++I ++ A  G   V   ++D   ++L++  G   +    I +
Sbjct: 333 NDTKFKIRDKYDIWYT-MEIPITTAALG-GIVTIPSIDGTNVRLRVSPG--TQNDQIISI 388

Query: 331 ENEGWP 336
            N G P
Sbjct: 389 PNMGVP 394

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 96.7 bits (239), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 112/402 (27%), Positives = 174/402 (43%), Gaps = 76/402 (18%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREE-SEMKFKEITAAYEILSDEDS 63
           YE LGV   +SQ++IKKAY KLA ++HPD     + +E  +E KF ++  AYEILSDE  
Sbjct: 49  YETLGVKKSSSQSDIKKAYYKLAKKYHPD-----INKEAGAEKKFHDLQNAYEILSDESK 103

Query: 64  RKKYDVYXXXXXXX---------------------------XXXXXXXXXXXXXMNF--- 93
           RK+YD +                                               +NF   
Sbjct: 104 RKQYDQFGAAAFSGGAGAGPGGPGAGPGGFNPFGNGFGFDFSGGQAGGAGGFGGINFEDL 163

Query: 94  FRTYAGGGFYDEPRQPYPEEEN--RSVRTSDARIPLKLSMKELYNGK---TFKFRSKRNV 148
           F T  GGG +           +  R  +     +   L  K+   GK   + KFR+    
Sbjct: 164 FGTAFGGGPFGSSSNSGRRSSSMFREYKGDTIEVIQNLDFKDAVFGKKNVSIKFRALDP- 222

Query: 149 LCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRT 208
            C  C GSGL+    +       C SC G G    ++    GF +  T  C+ C G+G T
Sbjct: 223 -CGTCNGSGLKSGASK-----TTCPSCHGSGTTVHVR---AGFQMMST--CQTCGGEGTT 271

Query: 209 TPTKPEDHCKKCHGKCV-ISEEKTLTVYIPRGSRNGDIVKLEGEA-------DQEPDKVT 260
                 D CK CHG+ V ++ +KT+TV +P G ++GD+V++ G+        D+E  K  
Sbjct: 272 V--NASDFCKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAKSV 329

Query: 261 ----GDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKI 316
               GD+L  I  N +   +++ + D  +T+ +I ++ A  G   V   T++   +++K+
Sbjct: 330 KLSRGDILVRIRVNKDPHFSIKNKYDIWYTK-EIPITTAALG-GTVSIPTIEGTKIRIKV 387

Query: 317 PQGKVIRPGNYIRLENEGWP-----LDDSGNKFGDMYVQVHI 353
           P G    P   I + N G P      + +    GDM +Q  +
Sbjct: 388 PAGTA--PEQVISIPNMGVPKSSPYRNSAVQARGDMKIQYKV 427

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 102/230 (44%), Gaps = 13/230 (5%)

Query: 128 KLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRV 187
           +L++K+ Y G +  F    N  C+ C GSG +     H      C  C G G   ++ R+
Sbjct: 146 ELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQDGKTTH------CSECRGQGVVIQVVRM 199

Query: 188 AQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNGDIVK 247
                 +    C  C GKG+    K    CK+CHG  V  + K   V +P G+    +  
Sbjct: 200 GP-LTQKIQQMCGACQGKGQVIKNK----CKRCHGAKVERKAKHFHVDVPAGAPRDFVDV 254

Query: 248 LEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTL 307
             GEAD+ PD  +GD+     E+   +    RRG  L+    +SL EA+ G  K      
Sbjct: 255 KAGEADKGPDFDSGDVFIKFSESSRDNMGYRRRGPHLYRTEVLSLKEALLGGWKREIEFF 314

Query: 308 D-DRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
           D ++ LKL+  QG  +R G   R+   G P    G K GD++V   +  P
Sbjct: 315 DPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHG-KHGDLFVDYVVVIP 363

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 123/267 (46%), Gaps = 25/267 (9%)

Query: 113 EENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVC 172
           EE+   R  D +  LK ++KELY GKT K    R  +C  C G G  +K+         C
Sbjct: 176 EEHHLNRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRKY--------TC 227

Query: 173 QSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTL 232
           + C+G G + + KR+    V   +  C  C G G  T  K +D C++C G   I + K L
Sbjct: 228 KPCKGQGIQTQTKRMGP-LVQSWSQTCADCGGAG--TFVKNKDICEQCQGLGFIKQRKIL 284

Query: 233 TVYIPRGSRNGDIVKLEGEADQ--------EPDKVTGDLLFVIEENPETSTNLERRGDDL 284
            V +  GS +  ++ L GE D+            + GD++  I    +    +    D +
Sbjct: 285 QVTVQPGSCHNQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQITDNCDLI 344

Query: 285 HTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP--LDDSGN 342
             + ++ L  ++ G    +      +++K+ I  G+V++PG +  +EN G P  ++   +
Sbjct: 345 CKKCEVDLMTSLCGGIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRS 404

Query: 343 KFGDMYVQVHIEFP----PDNWFSEKS 365
            FG +YV+  + +P    P+N    KS
Sbjct: 405 GFGHLYVKFDVTYPERLEPENAAKVKS 431

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T LY+ L V   AS +EIKKAYR  AL++HPDK       EES+ KF+EI  AYE+L D 
Sbjct: 5  TSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNH---TEESKRKFQEICQAYEVLKDN 61

Query: 62 DSRKKYDVY 70
            R  YD Y
Sbjct: 62 HLRSLYDQY 70

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/233 (30%), Positives = 102/233 (43%), Gaps = 14/233 (6%)

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           R    ++   L++K+ YNG +  F    N  CD C GSG          K   C  C G 
Sbjct: 148 RGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSG------SEDGKVKKCPDCGGR 201

Query: 179 GHKERIKRVAQGFVIRETV-KCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIP 237
           G    I+ +  G V ++   +C RC G G     K    CK C G  V  +EK ++V   
Sbjct: 202 G--VVIQVIRMGIVTQQVQQRCNRCAGSGEIIQNK----CKVCSGAKVQKKEKDISVSFD 255

Query: 238 RGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAIT 297
            G     I   +GEA++ P    GDL+    E PE +    RRG DL     ++L EAI 
Sbjct: 256 SGIERNHISVQQGEAEKGPGIEPGDLIVEFFEVPEANMGYRRRGKDLFRTEVLTLQEAIN 315

Query: 298 GFEKVVTTTLD-DRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYV 349
           G        LD  + L+LK     ++  G   ++   G P+  S  KFGD+Y+
Sbjct: 316 GDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKGKFGDLYI 368

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          Y++LG++ + ++ EIK AYR+L+ + HPDK  ++   E++  KF EI  AYE+LSD + R
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPND---EDAHNKFIEIGEAYEVLSDPEKR 81

Query: 65 KKYDVY 70
          + YD +
Sbjct: 82 RMYDQF 87

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 137/310 (44%), Gaps = 33/310 (10%)

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           R  D +  L+ S+K+LY GK  K R  R  LC  C G G  KK +        C +C G 
Sbjct: 163 RGPDIKHTLRCSLKDLYYGKKTKLRLDRTRLCVLCMGQGSMKKSK--------CFTCNGL 214

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G   + +R+    +   +  C  C G G     K  D C+ C G   + E K   V I  
Sbjct: 215 GSLTQTRRMGP-MIQTFSQSCPDCQGSGMF--VKRSDTCQSCSGNGYVEERKIFDVEIQP 271

Query: 239 GSRNGDIVKLEGEADQEPDK-------VTGDLLFVIEENPETSTNLERRGDDLHTRLKIS 291
           G  NG ++ L GEAD+  +        + GD++  I +  + +  +    D L     ++
Sbjct: 272 GMVNGQVIILPGEADEVVNTSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLDNFSVN 331

Query: 292 LSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGN--------K 343
           LS+A+ G    ++      ++K+ I  G+++ PG    + N G P ++  +         
Sbjct: 332 LSKALCGGTIFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINIS 391

Query: 344 FGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPE--VPNARVAD--TGDLNNTETVIDYSV 399
            G++YV+  I+FP      E+  +  L+ +L E    +A +AD    D++N + +++   
Sbjct: 392 KGNLYVKFDIKFPTR---LEEDTIAKLKAVLSEDRYAHAEMADEEAKDVSNLDDLVEIEE 448

Query: 400 VKSADELPDY 409
               +  PDY
Sbjct: 449 HVFNNFEPDY 458

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          ++LY++L ++ +A   +IKKAYR LAL++HPDK       EES++ F++I+ AYE+L D 
Sbjct: 5  SELYDILNISSNADAKDIKKAYRVLALKYHPDKNNHS---EESKVMFQKISEAYEVLIDV 61

Query: 62 DSRKKYDVY 70
          + RK YD Y
Sbjct: 62 EKRKLYDQY 70

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
           YFL016C
          Length = 500

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 118/431 (27%), Positives = 170/431 (39%), Gaps = 66/431 (15%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREE-SEMKFKEITAAYEILSDEDS 63
           Y VLGV   ASQ EIKKAY KLA Q+HPD     + +E  +E KF ++  AYEILSDE  
Sbjct: 37  YGVLGVKSSASQGEIKKAYYKLAKQYHPD-----INKEAGAEKKFHDLQNAYEILSDESK 91

Query: 64  RKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAG------------GG------FYDE 105
           RK++D +                       F  +A             GG      F   
Sbjct: 92  RKQFDQFGPAAFGAGAGAGGPGSGYPQGQGFNPFASYTSSSSSPFGDFGGINFEDLFGAA 151

Query: 106 PRQPYPEEENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQH 165
                     ++     +R P   S    Y G +       +        SG++ KF   
Sbjct: 152 FSGSGGAGGAKAGGAGASRNPFSSSGYRQYKGDSVHVSYNMSFKDAVFGKSGVKLKFNVF 211

Query: 166 PRKPVVCQSCEGHGHKERIKR--------------VAQGFVIRETVKCERCNGKGRTTPT 211
                 C +C G G K+   R              V  GF +  T  C  C G+G T  +
Sbjct: 212 D----PCDTCSGSGIKKGASRHQCPGCQGSGTKIHVRGGFQMMST--CNECQGEGTTVNS 265

Query: 212 KPEDHCKKCHGKCV-ISEEKTLTVYIPRGSRNGDIVKLEG-----EADQEPD-----KVT 260
              D C  CHG+ V     K +TV +P G ++GD++++ G     E   +P      K+T
Sbjct: 266 --SDLCGACHGEGVHFHRGKEITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSVKLT 323

Query: 261 -GDLLFV--IEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIP 317
            GD+L    +EE+P   T   R   D+   ++I ++ A  G   V   T+D   ++LK+ 
Sbjct: 324 RGDVLVNVRVEEDP---TFTIRDKSDIWYTMEIPITTAALG-GTVQVPTVDGSHIRLKVA 379

Query: 318 QGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEV 377
            G   + G+ I + N G P  +     G M VQ  I     +   EK   E L  +  + 
Sbjct: 380 PG--TQSGDVITVPNMGVPRSNLTRSRGAMKVQYRIVIKKPSSEVEKCLWEALADVKNDT 437

Query: 378 PNARVADTGDL 388
              R  D  D 
Sbjct: 438 TARRSVDRSDF 448

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 113/394 (28%), Positives = 173/394 (43%), Gaps = 65/394 (16%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y VLGV   AS +EIKKAY KLA ++HPD       + ++E KF ++  AYEILSDE+ R
Sbjct: 81  YSVLGVNNSASTSEIKKAYYKLAKKYHPDINK----QPDAEKKFHDLQNAYEILSDENKR 136

Query: 65  KKYDVYXXXXXXXXXXXXXXXXXXXXMNFF------RTYAGGG--FYDEP---------- 106
           K+YD +                      F       +T +G G  F D            
Sbjct: 137 KQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNPFADFGINFEDLFGAA 196

Query: 107 --RQPYPEEENRSVRTSDARIPLKLSMKELYNGKTFK--------FRSKRNVL--CDRCQ 154
               P+     R+ R S+     K    E+ +   FK           K N +  C++C 
Sbjct: 197 FGNGPHATGGGRARRQSNIYREFKGDPIEIVHNLNFKDAVFGVQNVNLKFNSMDPCNKCS 256

Query: 155 GSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPE 214
           GSGL +       K   C SC G G K  I+    GF +  T  C  C+G+G    +K  
Sbjct: 257 GSGLNRN-----AKRTTCPSCHGSGQKVHIR---SGFQMVST--CNHCHGEGTIIDSK-- 304

Query: 215 DHCKKCHGKCV-ISEEKTLTVYIPRGSRNGDIVKLEGE-------ADQEPDKVT------ 260
           D C  CHG  V ++  K++ V +P G ++GD++++ G+       A  +P  +       
Sbjct: 305 DICSSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGASIDPAMMNSIKLSR 364

Query: 261 GDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGK 320
           GDLL  +  N + + ++  + D   T+ +I ++ AI G   V   T+D   ++LK+  G 
Sbjct: 365 GDLLVRVRVNKDPNFSIRDKYDIWFTK-QIPITTAILG-GVVKIPTVDGTQIRLKVSPG- 421

Query: 321 VIRPGNYIRLENEGWPLDD-SGNKFGDMYVQVHI 353
             +    I + N G P    + +  G+M VQ  I
Sbjct: 422 -TKHDQIISIPNLGVPRSSINKDNRGNMKVQYKI 454

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 107/406 (26%), Positives = 175/406 (43%), Gaps = 64/406 (15%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLRE-ESEMKFKEITAAYEILSDEDS 63
           Y+ LG+   A+  EIKKAY KLA ++HPD     + +E ++E KF ++  AYEILSDE  
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPD-----INKEPDAEKKFHDLQNAYEILSDETK 117

Query: 64  RKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYDEPRQPY------------- 110
           R++YD +                        + +   GF      P+             
Sbjct: 118 RQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPFGGINFEDLFGAAF 177

Query: 111 ------------PEEENRSVRTSDARIPLKLSMKE-LYNGKTFKFRSKRNVLCDRCQGSG 157
                            R  R     I  K+S K+ ++  K  + R      C  C G+G
Sbjct: 178 GGGGRGSGGASRSSSMFRQYRGDPIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTG 237

Query: 158 LRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHC 217
           ++    +     V C +C G G    I+    GF +  T  C  CNG+G  T  +P+D+C
Sbjct: 238 MKPNTHK-----VSCSTCHGTGTTVHIR---GGFQMMST--CPTCNGEG--TMKRPQDNC 285

Query: 218 KKCHGKCV-ISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVT------------GDLL 264
            KCHG+ V ++  KT+TV +P G ++GD+V++ G+    PD               GD+L
Sbjct: 286 TKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSY-PDIAVEADLKDSVKLSRGDIL 344

Query: 265 FVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRP 324
             I  + + + +++ + D  + + +I ++ A  G   V   T++ + +++K+  G   + 
Sbjct: 345 VRIRVDKDPNFSIKNKYDIWYDK-EIPITTAALG-GTVTIPTVEGQKIRIKVAPG--TQY 400

Query: 325 GNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWFSEKSDVEVL 370
              I + N G P   +    GDM VQ  I        +EK   E L
Sbjct: 401 NQVISIPNMGVP--KTSTIRGDMKVQYKIVVKKPQSLAEKCLWEAL 444

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 118/255 (46%), Gaps = 21/255 (8%)

Query: 112 EEENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVV 171
           +E++   R  D +  LK ++KELY GKT K    R  +C  C G G  KK          
Sbjct: 168 DEDHHLDRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKK--------CT 219

Query: 172 CQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKT 231
           C++C+G G + + +R+    V   +  C  C G G     K +D C++C G   I E K 
Sbjct: 220 CKTCKGQGIQTQTRRMGP-LVQSWSQTCADCGGAG--VFVKNKDICQQCQGLGFIKERKI 276

Query: 232 LTVYIPRGSRNGDIVKLEGEADQ--------EPDKVTGDLLFVIEENPETSTNLERRGDD 283
           L V +  GS +  ++ L GE D+            + GD++  I    + +  +    + 
Sbjct: 277 LQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLKDPNFQVINYSNL 336

Query: 284 LHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP--LDDSG 341
           +  + KI    ++ G    +      +++KL I  G++++PG +  +E+ G P  ++   
Sbjct: 337 ICKKCKIDFMTSLCGGVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVR 396

Query: 342 NKFGDMYVQVHIEFP 356
           + FG +YV+  + +P
Sbjct: 397 SGFGHLYVKFDVTYP 411

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T LY+ L V   AS +EIKKAYR  AL++HPDK       EES+ KF+EI  AYEIL D 
Sbjct: 5  TSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNH---TEESKRKFQEICQAYEILKDN 61

Query: 62 DSRKKYDVY 70
            R  YD Y
Sbjct: 62 RLRALYDQY 70

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 118/254 (46%), Gaps = 20/254 (7%)

Query: 112 EEENRSVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVV 171
           ++E+   R  D +  LK +++ELY GKT K    R  +C  C+G G  +K+         
Sbjct: 179 DDEHHLNRGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQKY--------T 230

Query: 172 CQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKT 231
           C++C+G G + + K +    V   +  C  C G G    +K  D C++C G   I + K 
Sbjct: 231 CKTCKGQGVQTQTKCMGP-LVQSWSQTCADCGGAGIFVESK--DICQQCQGLGFIKQRKI 287

Query: 232 LTVYIPRGSRNGDIVKLEGEADQEPDK-------VTGDLLFVIEENPETSTNLERRGDDL 284
           L V +  G+ +  ++ L GE D+   K       + GD++  I    +    +      +
Sbjct: 288 LQVTVQPGTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKFQVTDNCSLI 347

Query: 285 HTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP--LDDSGN 342
           + + K+ L  ++ G    +      +++KL I  G+V++P  +  +E  G P  ++   +
Sbjct: 348 YKKCKVDLMTSLCGGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRS 407

Query: 343 KFGDMYVQVHIEFP 356
            FG +YV+  + +P
Sbjct: 408 GFGHLYVKFDVSYP 421

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T LY+ L V   AS +EIKKAYR  AL++HPDK       EES+ KF+EI  AYE+L D 
Sbjct: 5  TSLYDSLNVTTTASTSEIKKAYRNAALRYHPDKNNH---TEESKRKFQEICQAYEVLKDN 61

Query: 62 DSRKKYDVY 70
            R  YD Y
Sbjct: 62 HLRSLYDQY 70

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 123/254 (48%), Gaps = 28/254 (11%)

Query: 127 LKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGH---KER 183
           LK ++K+LY GK  K R +R+ LC  C+G G  K+         +C  C G G+     R
Sbjct: 164 LKCTIKDLYRGKRSKLRLERSKLCSICKGDGGVKR--------SMCNQCHGDGNITETTR 215

Query: 184 IKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNG 243
           +  + Q F    T  C  CNG G    +  ++ C+ C+G    +E K   V I  G ++G
Sbjct: 216 LGPMLQTF----THTCNICNGNGWVIIS--QETCQGCNGVGFYNEMKIFDVEIYPGMKDG 269

Query: 244 DIVKLEGEADQEPDK---VTGDLLFVIEENPETSTNLERRGDDLHT-RLKISLSEAITGF 299
             +    E D+  +K   + G+++  I E  +        G DL+    +I L  ++ G 
Sbjct: 270 TQIVFNNEGDEIVNKRRVIPGNVIIHINEIEDNKFKRVNDGQDLYYWNYEIDLFTSLCGG 329

Query: 300 EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDN 359
              +    +++++K+ I  G++I  G+   +E+ G P  + GN++G +Y+Q  +++P   
Sbjct: 330 VIYIKGHPNNKLIKVDILPGEIIESGSVKGVESLGMP-KNKGNEYGILYIQFQVKYP--- 385

Query: 360 WFSEKSDVEVLRTL 373
              EK ++E ++ +
Sbjct: 386 ---EKLNMESIKAI 396

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 48/68 (70%), Gaps = 3/68 (4%)

Query: 3  KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
          +LY  L + P ASQ++IKKAYR  AL++HPDK  +    EES+ KF++I+ AY IL DE+
Sbjct: 6  RLYNALNIPPTASQSDIKKAYRVQALRYHPDKNNES---EESKKKFQDISEAYSILRDEN 62

Query: 63 SRKKYDVY 70
           RK YD Y
Sbjct: 63 QRKMYDKY 70

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 87.4 bits (215), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 107/409 (26%), Positives = 179/409 (43%), Gaps = 66/409 (16%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLRE-ESEMKFKEITAAYEILSDEDS 63
           Y+ LG+   A+  EIKKAY KLA ++HPD     + +E ++E KF ++  AYEILSD+  
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPD-----INKEPDAEKKFHDLQNAYEILSDDTK 117

Query: 64  RKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAG----------GGFYDEPRQPYPEE 113
           R+++D +                     + F  ++G          GG   E        
Sbjct: 118 RQQFDQFGPAAFGGGGGGGAGGAGSPFGSQFHDFSGFTNASGGSPFGGINFEDLFGAAFG 177

Query: 114 EN-------------------RSVRTSDARIPLKLSMKE-LYNGKTFKFRSKRNVLCDRC 153
                                R  R     I  K+S K+ ++  K  + +      C  C
Sbjct: 178 GGGAGAGAGRGGSGGRSSPMYRQYRGDPIEIVHKVSFKDAVFGAKNVQLKFSALDPCGTC 237

Query: 154 QGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKP 213
            G+G++    +     V C +C G G    ++    GF +  T  C  CNG+G  T  +P
Sbjct: 238 SGTGMKPNTHK-----VSCTTCHGSGSTVHVR---GGFQMMST--CPTCNGEG--TMKRP 285

Query: 214 EDHCKKCHGKCVISEE-KTLTVYIPRGSRNGDIVKLEG---------EAD-QEPDKVT-G 261
           +D+C  CHG+ V +   K++TV +P G ++GD+V++ G         EAD Q+  K++ G
Sbjct: 286 QDNCTSCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLQDSIKLSRG 345

Query: 262 DLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKV 321
           D+L  I  + + S ++  + D  + + +I ++ A  G   +   T+D + +++K+  G  
Sbjct: 346 DILVRIRVDKDPSFSIRNKYDIWYDK-EIPITTAALG-GTITIPTVDGQKIRIKVAPG-- 401

Query: 322 IRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWFSEKSDVEVL 370
            +    I + N G P   +    GDM VQ  I        +EK   E L
Sbjct: 402 TQYNQVISIPNMGVPR--TATLRGDMKVQYKIVVKKPQSLAEKCLWEAL 448

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 134/308 (43%), Gaps = 49/308 (15%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEM-KFKEITAAYEILSDEDS 63
           Y+ LGV   AS +EIKKAY KLA ++HPD     + +E+    KF ++  AYEILSD D 
Sbjct: 35  YDTLGVGKSASPSEIKKAYYKLAKKYHPD-----INKEQGAGDKFHDLQNAYEILSDADK 89

Query: 64  RKKYDVYXXXXXXXXXXXXXXXXXXXXMNFFRTYAGGGFYD------------------- 104
           + +YD +                       F  ++G G +                    
Sbjct: 90  KSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFSDFSGFGNFGGINFEDLFGAAFGGGGGRS 149

Query: 105 EPRQPYPEEENRSVRTSDARIPLKLSMKE-LYNGKTFKFRSKRNVLCDRCQGSGLRKKFQ 163
               P+     R  R     +  ++  K+ ++  K    + +    C  C GSG++    
Sbjct: 150 SRGSPFGSSMFREYRGDPIEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMKTG-- 207

Query: 164 QHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGK 223
               KP  C SC G G    ++    GF +  T  C++C G+G TT  K ED C  CHG 
Sbjct: 208 ---AKPQSCPSCHGTGTTVHVR---AGFQMATT--CQQCGGEGTTT--KREDLCGSCHGD 257

Query: 224 CV-ISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGD 282
            V  +++K++ V +P+G ++GD+V++ G+       V           PE  +++  R  
Sbjct: 258 GVEWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVP----------PEMKSSIRLRRG 307

Query: 283 DLHTRLKI 290
           D+  R+++
Sbjct: 308 DVLVRIRV 315

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 105/229 (45%), Gaps = 26/229 (11%)

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSG-LRKKFQQHPRKPVVCQSCEG 177
           R  D +  LK ++  LY+GK  K R +R   C +C+G G L  K          C  C G
Sbjct: 229 RGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIK---------SCSKCNG 279

Query: 178 HGHKERIKR---VAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTV 234
            G   + K+   + Q F    T  C+ C G G  T    +D C +C G+  ++E+K   V
Sbjct: 280 RGSLTQTKKFGPMTQTF----TQTCDGCGGNG--TFADAQDICNECQGEGFLNEKKIFEV 333

Query: 235 YIPRGSRNGDIVKLEGEADQEPDK-------VTGDLLFVIEENPETSTNLERRGDDLHTR 287
            I  G  +G ++ L GEAD+           + GD++  I   P+ +  + +  D L+  
Sbjct: 334 EITPGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKVVQGADLLYAN 393

Query: 288 LKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP 336
            KI+L  ++ G    +     + ++K+ I  G++I+ G    +EN G P
Sbjct: 394 YKINLLTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMP 442

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+LY++L V  D+ ++ IKKAYR LAL++HPDK     L EES+  F++I+ AY +LS++
Sbjct: 5  TQLYDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNK 61

Query: 62 DSRKKYDVY 70
          D R+ YD Y
Sbjct: 62 DKRQMYDKY 70

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 124/291 (42%), Gaps = 47/291 (16%)

Query: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178
           R  D +  L  ++KELY GK  K    R   C  C G G            ++C  C+G 
Sbjct: 169 RGPDIKHVLNCTLKELYQGKKCKLGLNRTRSCHSCNGMG--------GMNTIICNECQGK 220

Query: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238
           G     K +    V   +  C  C+G G    +  +  CK+C G+  + E    TV +  
Sbjct: 221 GINTETKMLGP-MVQSWSSTCFNCSGMGYFIDS--QSGCKECQGEGYLRERTIFTVTVKP 277

Query: 239 GSRNGDIVKLEGEADQ-------EPDKVT-GDLLFVIEE----NPETSTNLER------- 279
           G RN   + L+GEADQ         +KV  GD++ VI +    + +  +N+++       
Sbjct: 278 GMRNNQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNKF 337

Query: 280 ------RGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENE 333
                   D L    +I L  ++ G E  +      +++KL I   ++++P     +EN 
Sbjct: 338 HFEIINEKDLLLRNCQIDLITSLCGGEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENL 397

Query: 334 GWP--LDDSGNK------FGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPE 376
           G P  ++D  N        GD+Y+Q  +++P      E   ++ LR++L E
Sbjct: 398 GMPRYIEDETNNGEEYLPNGDLYIQFKVKYPTK---LENETIDKLRSILSE 445

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+LY +L V   A+  EIK AY+KLAL++HPDK       EES++KF+EI  AYE+L D+
Sbjct: 12 TRLYSILQVPTAATLFEIKNAYKKLALKYHPDKNNHS---EESKLKFQEICKAYEVLHDK 68

Query: 62 DSRKKYDVY 70
          D +  YD Y
Sbjct: 69 DKKLLYDTY 77

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 106/216 (49%), Gaps = 30/216 (13%)

Query: 150 CDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTT 209
           C  C GSGL+K  Q        C SC G G    ++    GF +  T  C +C G+G T 
Sbjct: 202 CGVCHGSGLKKNAQSS-----TCPSCHGTGTTVHVR---GGFQMAST--CNQCGGEGTTV 251

Query: 210 PTKPEDHCKKCHGKCV-ISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVT-------- 260
             +PED C KCHG+ V ++ +++++V +P+G ++GD+V++ G+       V         
Sbjct: 252 --RPEDVCSKCHGEGVELNSQRSISVDLPQGLQDGDVVRVPGQGSYPHLAVDPKMKNSVK 309

Query: 261 ---GDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIP 317
              GD+L  I  + ++  ++  + D   T+ +I ++ A  G  +V   T+DD  ++LK+ 
Sbjct: 310 LHRGDVLVRIRVDKDSRFSIRNKTDIWFTK-EIPITTAALG-GQVTIPTVDDTQIRLKVQ 367

Query: 318 QGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHI 353
            G   +    I + N G P    G + G M VQ  I
Sbjct: 368 PG--TQHDQVISIPNMGVPR--IGGERGAMKVQYKI 399

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLRE-ESEMKFKEITAAYEILSDEDS 63
          YE LGV  +AS +EIKKAY KLA + HPD     + +E  +E KF ++  AYEILSD+  
Sbjct: 38 YETLGVGKNASSSEIKKAYYKLAKKFHPD-----INKEPNAEAKFHDLQNAYEILSDDTK 92

Query: 64 RKKYDVY 70
          +++YD +
Sbjct: 93 KQQYDQF 99

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 128/274 (46%), Gaps = 37/274 (13%)

Query: 150 CDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTT 209
           CD C GSGL KK + H R+   C  C G G +  ++    GF +  T  C  C+G+G  T
Sbjct: 219 CDTCHGSGL-KKGENHKRRS--CSYCNGTGTQIHVR---SGFQMAST--CNHCHGEG--T 268

Query: 210 PTKPEDHCKKCHGKCV-ISEEKTLTVYIPRGSRNGDIVKLEGEA--------DQEPDKVT 260
               ED C KCHG  V +  +K + V +P    +GD++++ GE         +++ D+V 
Sbjct: 269 IIAFEDMCTKCHGDGVKLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKDRVK 328

Query: 261 ---GDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIP 317
              GDLL  I   P+    ++ +  D+ +  +I ++ A  G   +   T+DD+ ++LK+ 
Sbjct: 329 LSRGDLLVRIRVKPDPDYTIKNK-YDIWSVKEIPITTAALG-GTITIKTIDDKQIRLKVM 386

Query: 318 QGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQ--VHIEFPPDN-----W--FSEKS-DV 367
            G   +      + N G P  + G   GDM +Q  V I  P        W   ++ S D 
Sbjct: 387 AG--TQHDQVTSIPNMGVPRRN-GLGRGDMKIQYKVVIRKPSTEVETCLWEALADVSKDT 443

Query: 368 EVLRTLLPEVPNARVADTGDLNNTETVIDYSVVK 401
              RT+   + ++   DT   N+ ++  D + +K
Sbjct: 444 TAKRTMSNSILSSNPEDTTKTNSKDSSTDVNTLK 477

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 46/67 (68%), Gaps = 6/67 (8%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLRE-ESEMKFKEITAAYEILSDEDS 63
           Y+ LGVA  ASQ+EIKKAY KLA ++HPD     + +E ++E  F  +  AYEILSDED 
Sbjct: 58  YKTLGVARSASQSEIKKAYYKLAKKYHPD-----INKEPDAEKTFHNLQNAYEILSDEDK 112

Query: 64  RKKYDVY 70
           R ++D +
Sbjct: 113 RAQFDQF 119

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A+  EIKK YRK ALQ+HPDK            KFK+I+ AYEILSD 
Sbjct: 5  TKLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNT------EKFKQISEAYEILSDS 58

Query: 62 DSRKKYDVY 70
          + R+ YD Y
Sbjct: 59 NKREVYDQY 67

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 64/132 (48%), Gaps = 10/132 (7%)

Query: 228 EEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLERRGDDL 284
           E+K + + + RG + G  +  + E D  P   TG    L FV++E  +     +R G++L
Sbjct: 201 EKKQIDIQLKRGWKAGTKITYKNEGDFNPR--TGGRKTLQFVLQE--KAHPLFKRDGENL 256

Query: 285 HTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKF 344
              + +S  E++ GF K V T +D R L L   Q   I+P        +G P   + N+ 
Sbjct: 257 LYTVPLSFQESLLGFSKTVQT-IDGRSLSLSRTQ--PIQPTETTTYPGQGMPNPKNPNQR 313

Query: 345 GDMYVQVHIEFP 356
           GD+ +   I++P
Sbjct: 314 GDLIITYKIDYP 325

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 117/246 (47%), Gaps = 38/246 (15%)

Query: 124 RIPLKLSMKELYNGKTFKFRSKRNVL--CDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHK 181
           RIP K ++  L N        K NV+  C  C GSG+++  Q+H      C SC G G K
Sbjct: 199 RIPFKDAVFGLAN-----VSLKYNVMDPCHTCHGSGIKQGAQKHQ-----CPSCHGSGQK 248

Query: 182 ERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCV-ISEEKTLTVYIPRGS 240
             I+    GF +  T  C  C+G+G  T     D+C  CHG  V  + + ++ V +P G 
Sbjct: 249 VHIR---SGFQMVST--CNECHGEG--TILNASDYCGTCHGDAVEFTRDHSINVNLPNGL 301

Query: 241 RNGDIVKLEGEADQ-----EPD-----KVT-GDLLFVIEENPETSTNLERRGDDLHTRLK 289
           ++GD++++ G+ +      +P+     K+T GD+L  I  + +   +++ + D   T+  
Sbjct: 302 QDGDVIRIPGQGNYPQMALDPELKNSVKLTRGDVLVRIRVDKDNRFSIKDKYDIWFTKDI 361

Query: 290 ISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNK--FGDM 347
              + A+ G   V   T+D   L+LK+  G   +    I + N G P   S NK   G+M
Sbjct: 362 PITTAALGGI--VTIPTVDGTTLRLKVQAG--TQHDQVISIPNLGVPR-SSINKENRGNM 416

Query: 348 YVQVHI 353
            VQ  I
Sbjct: 417 KVQYRI 422

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLRE-ESEMKFKEITAAYEILSDEDS 63
           Y+VLG+   A+ +EIKKAY KLA ++HPD     + +E  +E KF ++  AYEILSDE  
Sbjct: 53  YKVLGINKSATSSEIKKAYYKLAKKYHPD-----INKEPTAEKKFHDLQNAYEILSDETK 107

Query: 64  RKKYDVY 70
           + +YD +
Sbjct: 108 KSQYDTF 114

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 49/69 (71%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A++ E+KK Y+K AL++HPDK A +        KFKEI+ AYEILSD 
Sbjct: 5  TKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDT------EKFKEISEAYEILSDS 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 SKREIYDQY 67

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 63/132 (47%), Gaps = 10/132 (7%)

Query: 228 EEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLERRGDDL 284
           E+  + + +  G + G  +  + E D  P   TG    L FV++E  ++    +R GD+L
Sbjct: 218 EKTQIDIQLKPGWKAGTKITYKNEGDYNPQ--TGGRKTLQFVLQE--KSHPLYKRDGDNL 273

Query: 285 HTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKF 344
              L +S  E++ GF K +  T+D R L +   Q   ++P        +G P+     + 
Sbjct: 274 IYSLPLSFKESLLGFSKTI-QTIDGRTLPISKIQ--PVQPTEVSSYPGQGMPVSKRPGQR 330

Query: 345 GDMYVQVHIEFP 356
           GD+ V+  I++P
Sbjct: 331 GDLVVKYKIDYP 342

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P AS  E+KK YRK AL++HPDK   +        KFKEI+ A+EILSD 
Sbjct: 5  TKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDP 58

Query: 62 DSRKKYDVY 70
          + R+ YD Y
Sbjct: 59 NKREVYDTY 67

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 72/138 (52%), Gaps = 10/138 (7%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLE 278
           G+  I E+K + + +  G + G  +  + E D  P   TG    + F+I+E P      +
Sbjct: 204 GQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPS--TGGRQTIQFIIQEKPHEF--FK 259

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R G+DL   L ++  E++ GF+K V T +D R  ++ I + + ++P   +R   +G PL 
Sbjct: 260 RDGNDLIYTLPLTFKESLLGFDKTVRT-IDGR--QISIHKTQPVQPSEEMRYPGQGMPLS 316

Query: 339 DSGNKFGDMYVQVHIEFP 356
            + ++ GD+ V+   ++P
Sbjct: 317 KNPSERGDLIVKYKTDYP 334

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV P A++ EIKK YRK AL++HPDK   +        KFK+I+ AYEILSD 
Sbjct: 5  TKLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDT------EKFKQISEAYEILSDS 58

Query: 62 DSRKKYDVY 70
          + R+ YD Y
Sbjct: 59 NKREIYDQY 67

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 65/137 (47%), Gaps = 8/137 (5%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTG--DLLFVIEENPETSTNLER 279
           G   + E+  + + +  G + G  +  + + D  P +  G   L F+I+E P  +   +R
Sbjct: 216 GPGGVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNP-RTHGRKTLQFIIDEKPHPT--FQR 272

Query: 280 RGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDD 339
             D+L   + ++  E++ GF K V T +D R   L I + + I+P    R   +G P+  
Sbjct: 273 EDDNLVCTVPLTFKESLLGFSKTVQT-IDGR--NLPISRSQPIQPTEITRYPGQGMPISK 329

Query: 340 SGNKFGDMYVQVHIEFP 356
              + GD+ V+  I +P
Sbjct: 330 KPGQRGDLIVKYKIAYP 346

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A +TE+KK YRK AL++HPDK + +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDA------EKFKEISEAFEILNDP 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREVYDTY 67

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 70/138 (50%), Gaps = 10/138 (7%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTG---DLLFVIEENPETSTNLE 278
           G    SE++ + + +  G + G  +  + E D  P   TG    L F+++E P +  N  
Sbjct: 208 GPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNPR--TGRRQTLQFILQEKPHS--NYT 263

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R G+DL   L ++  E++ GF K +  T+D R   L I + + ++P +      +G P+ 
Sbjct: 264 RDGNDLIYSLPLTFKESLLGFSKTI-QTIDGRT--LPISRVQPVQPSDSSTYPGQGMPIA 320

Query: 339 DSGNKFGDMYVQVHIEFP 356
            + ++ G++ V+  I++P
Sbjct: 321 KTPSQRGNLIVKYKIDYP 338

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LG++P A + EIKK YRK AL++HPDK   +        KFKEI+ A+EILSD 
Sbjct: 5  TKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDA 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREVYDTY 67

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 67/138 (48%), Gaps = 10/138 (7%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLE 278
           G   +SE+  + + +  G + G  +  +GE D  P   TG    L FV++E P       
Sbjct: 209 GAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPR--TGGRQTLQFVLQEKPHEF--FT 264

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R+ +DL   L +S  E++ GF K V  T+D +   + I + + I+P        +G  L 
Sbjct: 265 RQDNDLIYTLPLSFKESLLGFSKQV-QTIDGKT--IPITRTQPIQPTQTSTYPGQGMTLS 321

Query: 339 DSGNKFGDMYVQVHIEFP 356
            + ++ GD+ ++  I++P
Sbjct: 322 KNPSQRGDLIIKFKIDYP 339

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 49/69 (71%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A+  EIKK YRK AL++HPDK   +        KFKEI+ A+EILSD+
Sbjct: 5  TKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDK 58

Query: 62 DSRKKYDVY 70
          + R+ YD Y
Sbjct: 59 NKREVYDQY 67

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 68/138 (49%), Gaps = 10/138 (7%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLE 278
           G+  I E+  + + +  G + G  +  + + D  P   TG    L F+++E  +     +
Sbjct: 214 GQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQ--TGGRKTLQFMLQE--KNHPVFK 269

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R GDDL   L ++  E++ GF K +  T+D R   L I + + I+P        +G P+ 
Sbjct: 270 REGDDLTCTLPLTFKESLLGFNKQI-QTIDGRT--LPISRTQPIQPSETSVYPGQGMPIP 326

Query: 339 DSGNKFGDMYVQVHIEFP 356
            + ++ G++ V+  I++P
Sbjct: 327 KTPSQRGNLIVRYKIDYP 344

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 122/269 (45%), Gaps = 33/269 (12%)

Query: 116 RSVRTSDARIPLKLSMKE-LYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQS 174
           R  R     I  K+S K+ ++     + +      C  C G+G++    +     V C +
Sbjct: 194 RQYRGDPIEIVHKVSFKDAVFGSNNVQLKFSALDPCSTCSGTGMKPNTHK-----VNCST 248

Query: 175 CEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCV-ISEEKTLT 233
           C G G    I+    GF +  T  C  CNG+G  T  +P+D C KCHG+ V ++  KT+T
Sbjct: 249 CHGTGTTVHIR---GGFQMMST--CPTCNGEG--TMKRPQDSCTKCHGEGVQVNRAKTIT 301

Query: 234 VYIPRGSRNGDIVKLEGEADQEPDKVT------------GDLLFVIEENPETSTNLERRG 281
           V +P G ++GD+V++ G+    PD               GD+L  I  + + + +++ + 
Sbjct: 302 VDLPHGLQDGDVVRIPGQGSY-PDIAVEADLKDTVKLSRGDILVRIRVDKDPNFSIKNKY 360

Query: 282 DDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSG 341
           D  + + +I ++ A  G   V   T++ + +++K+  G   +    I + N G P   + 
Sbjct: 361 DIWYDK-EIPITTAALG-GTVTIPTVEGQKIRIKVAPG--TQYNQVISIPNMGVP--KTT 414

Query: 342 NKFGDMYVQVHIEFPPDNWFSEKSDVEVL 370
              GDM +Q  I        +EK   E L
Sbjct: 415 TIRGDMKIQYKIVVKKPQSLAEKCLWEAL 443

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 4/64 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y+ LG+   A+  EIKKAY KLA ++HPD +  EV   ++E KF ++  AYEILSDE+ R
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEV---DAEKKFHDLQNAYEILSDENKR 118

Query: 65  KKYD 68
           ++YD
Sbjct: 119 QQYD 122

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A +TE+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDA------EKFKEISEAFEILNDP 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREIYDNY 67

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 68/138 (49%), Gaps = 10/138 (7%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTG---DLLFVIEENPETSTNLE 278
           G     E++ + + +  G + G  +  + E D  P   TG    + F+I+E P    N  
Sbjct: 205 GPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYNPR--TGRRQTMQFIIQEKPHE--NYT 260

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R G+DL   L ++  E++ GF K +  T+D R   L I + + ++P +      +G P+ 
Sbjct: 261 RDGNDLIYTLPLTFKESLLGFNKTI-QTIDGRT--LPISRVQPVQPSDVSTYPGQGMPVA 317

Query: 339 DSGNKFGDMYVQVHIEFP 356
            + ++ G++ V+  I++P
Sbjct: 318 KNPSQRGNLIVKYKIDYP 335

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LG++P A++ EIKK YRK AL++HPDK   +        KFKEI+ A+EILSD 
Sbjct: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDP 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREVYDQY 67

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 10/132 (7%)

Query: 228 EEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTG---DLLFVIEENPETSTNLERRGDDL 284
           E+  + + +  G + G  +  +   D  P   TG    L F+I+E  +      R G+DL
Sbjct: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNP--ATGRRKTLQFIIQE--KKHPFFTRDGNDL 265

Query: 285 HTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKF 344
              L ++  E++ GF K +  T+D R L +   Q   I+P        +G P+  +  + 
Sbjct: 266 IYTLPLTFKESLLGFNKTI-QTIDGRTLPVSRIQ--PIQPSEKSTYPGQGMPIPKTPGQR 322

Query: 345 GDMYVQVHIEFP 356
           GDM V   +++P
Sbjct: 323 GDMIVNYKVDYP 334

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A+  EIKK YRK AL++HPDK            KFKEI+ A+EILSD 
Sbjct: 5  TKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNT------EKFKEISEAFEILSDS 58

Query: 62 DSRKKYDVY 70
          + R+ YD Y
Sbjct: 59 NKREVYDQY 67

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 66/138 (47%), Gaps = 10/138 (7%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLE 278
           G+  + E+  + + +  G + G  +  +   D  P   TG    L FVI+E  +   N +
Sbjct: 210 GQNGVQEKVQVDIQLKAGWKAGTKITFKNYGDYNPS--TGGRKTLQFVIKE--KVHPNFK 265

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R  D L   L ++  E++ GF+K + T +D R L   I + + ++P +      +G P+ 
Sbjct: 266 REDDTLVYYLPLTFKESLLGFQKTIQT-IDGRTLP--ISRVQPVQPNDSSTYPGQGMPMT 322

Query: 339 DSGNKFGDMYVQVHIEFP 356
               + GDM V+  IE+P
Sbjct: 323 KKPGQRGDMIVKYKIEYP 340

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 110/234 (47%), Gaps = 32/234 (13%)

Query: 150 CDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTT 209
           C  C G+G++    +     V C +C G G    I+    GF +  T  C  CNG+G  T
Sbjct: 235 CGTCSGTGMKPNTHK-----VNCGTCHGTGTTVHIR---GGFQMMST--CPTCNGEG--T 282

Query: 210 PTKPEDHCKKCHGKCV-ISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVT-------- 260
             +P+D C KCHG+ V ++  KT+TV +P G ++GD+V++ G+    PD           
Sbjct: 283 MKRPQDSCSKCHGEGVQVNRGKTITVDLPHGLQDGDVVRIPGQGSY-PDIAVEEDLKDSV 341

Query: 261 ----GDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKI 316
               GD+L  I  + + + +++ + D  + + +I ++ A  G   V   T++ + +++K+
Sbjct: 342 KLSRGDILVRIRVDKDPNFSIKNKYDIWYNK-EIPITTAALG-GTVTIPTVEGQKIRIKV 399

Query: 317 PQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWFSEKSDVEVL 370
             G   +    I + N G P   +    GDM VQ  I        +EK   E L
Sbjct: 400 APG--TQYNQVISIPNMGVP--KTPTIRGDMKVQYKIVVKKPQSLAEKCLWEAL 449

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLRE-ESEMKFKEITAAYEILSDEDS 63
           Y+ LG+   A+  EIKKAY KLA ++HPD     + +E ++E KF ++  AYEILSDE  
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPD-----INKEPDAEKKFHDLQNAYEILSDESK 117

Query: 64  RKKYDVY 70
           R++YD +
Sbjct: 118 RQQYDQF 124

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 50/69 (72%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A++ E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 DSRKKYDVY 70
          ++R+ YD Y
Sbjct: 59 NTREVYDQY 67

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 71/133 (53%), Gaps = 9/133 (6%)

Query: 227 SEEKT-LTVYIPRGSRNGDIVKLEGEADQEPDKVTG--DLLFVIEENPETSTNLERRGDD 283
           S+EKT + + +  G + G  V  + + D  P +  G   L FVI+E  +   + +R GDD
Sbjct: 186 SQEKTQIDIQLRPGWKAGTKVTYKNQGDYNP-RSGGRKTLQFVIQE--KAHPDFKRDGDD 242

Query: 284 LHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNK 343
           L   L++S  E++ GF K +  T+D R  KL + + + I+P        +G P+  + ++
Sbjct: 243 LIYILRLSFKESLLGFSKTI-NTIDGR--KLPLSRSQPIQPTEISTYPGQGMPVSKNPSQ 299

Query: 344 FGDMYVQVHIEFP 356
            G++ ++  I++P
Sbjct: 300 RGNLIIKYKIDYP 312

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  YE+LGV P A+  EIKKAYRK ++Q HPDK  D+ +  E   +F+ I+ AY++LSDE
Sbjct: 5  TGYYEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATE---RFQAISEAYQVLSDE 61

Query: 62 DSRKKYDVY 70
          D R KYD +
Sbjct: 62 DLRGKYDRF 70

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+  AS  EIKK YRK AL++HPDK   +        KFKEI+ A+EILSD 
Sbjct: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDS 58

Query: 62 DSRKKYDVY 70
          + R  YD Y
Sbjct: 59 NKRSVYDQY 67

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 60/132 (45%), Gaps = 10/132 (7%)

Query: 228 EEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLERRGDDL 284
           E+  + + +  G + G  +  +   D  P   TG    L F+I+E        +R GD++
Sbjct: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPS--TGGRKTLQFIIKEKKHPL--YKRDGDNI 269

Query: 285 HTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKF 344
              L ++  E++ GF K +  TLD R L L   Q   ++P        +G P+  +  + 
Sbjct: 270 IYTLPLTFKESLLGFSKTL-QTLDGRTLPLSRSQ--PVQPTEENTYPGQGMPISKNPGQR 326

Query: 345 GDMYVQVHIEFP 356
           G++ ++  I +P
Sbjct: 327 GNLIIKYKINYP 338

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TK Y+VLGV PDA+  +IKKAYRK A+Q HPDK  ++    E++ KF+E++ AY++LSD 
Sbjct: 5  TKYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPND---PEAQAKFQEVSKAYKVLSDG 61

Query: 62 DSRKKYD 68
          + R +YD
Sbjct: 62 ELRSRYD 68

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 114/268 (42%), Gaps = 42/268 (15%)

Query: 100 GGFYDEPRQPYPEEENRSVRTSDARIPLKLSMKE-LYNGKTFKFRSKRNVLCDRCQGSGL 158
           GGFY E            VR  +  +   LS K+ ++  +           C  C GSG+
Sbjct: 186 GGFYSE------------VRGDNVEVIHTLSFKDAVFGSRNVTLNVSSIEQCKTCTGSGM 233

Query: 159 RKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCK 218
           +    +       C SC G G    ++    GF +  T  C  C G G       ED C+
Sbjct: 234 KPGSHRSE-----CSSCHGTGTTVHVR---AGFQMAST--CMSCGGTGENIAR--EDVCR 281

Query: 219 KCHGKCVISE--EKTLTVYIPRGSRNGDIVKLEGE--------ADQEPDKVT---GDLLF 265
            C G+       ++T+ V +P G  +GD++++ G+        A ++ D+V    GDLL 
Sbjct: 282 NCDGEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQRDQVKVTRGDLLV 341

Query: 266 VIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPG 325
            I    +   ++ R G++L    +I ++ A+ G   VV  TLD   L+L++  G   R G
Sbjct: 342 RIRVKQDKVFSI-RNGNELWQTREIPVTTAVLG-GNVVIPTLDGNQLRLRVRSG--TRDG 397

Query: 326 NYIRLENEGWPLDDSGNKFGDMYVQVHI 353
             + +  +G P    G   GDM VQ  +
Sbjct: 398 ETVSVPGQGVPRGRGGLSRGDMKVQWRV 425

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y+VLG+  DA  +EIKKAY KLA ++HPD   D    + S+ KF +IT AYEILSDE  +
Sbjct: 49  YKVLGLNKDAKASEIKKAYYKLAKKYHPDINKD----KGSDKKFHDITNAYEILSDEKKK 104

Query: 65  KKYDVY 70
            +YD +
Sbjct: 105 MQYDQF 110

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A++ E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREIYDQY 67

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 69/142 (48%), Gaps = 13/142 (9%)

Query: 218 KKCHGKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTG---DLLFVIEENPETS 274
           K  HG    SE+  + + +  G + G  +  + + D  P   TG    L FVI+E  ++ 
Sbjct: 206 KGPHG---ASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQ--TGRRKTLQFVIQE--KSH 258

Query: 275 TNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEG 334
            N +R GDDL   L +S  E++ GF K +  T+D R L L   Q   ++P        +G
Sbjct: 259 PNFKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQ--PVQPSQTSTYPGQG 315

Query: 335 WPLDDSGNKFGDMYVQVHIEFP 356
            P   + ++ G++ V+  +++P
Sbjct: 316 MPTPKNPSQRGNLIVKYKVDYP 337

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A++ E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDS 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREIYDQY 67

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 69/142 (48%), Gaps = 13/142 (9%)

Query: 218 KKCHGKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTG---DLLFVIEENPETS 274
           K  HG    SE+  + + +  G + G  +  + + D  P   TG    L FVI+E  ++ 
Sbjct: 220 KGPHG---ASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQ--TGRRKTLQFVIQE--KSH 272

Query: 275 TNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEG 334
            N +R GDDL   L +S  E++ GF K +  T+D R L L   Q   ++P        +G
Sbjct: 273 PNFKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQ--PVQPSQTSTYPGQG 329

Query: 335 WPLDDSGNKFGDMYVQVHIEFP 356
            P   + ++ G++ V+  +++P
Sbjct: 330 MPTPKNPSQRGNLIVKYKVDYP 351

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A++ E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDS 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREIYDQY 67

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 72/158 (45%), Gaps = 18/158 (11%)

Query: 210 PTKPEDHC---KKCH-----GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTG 261
           P   ED C   KK       G    SE+  + + + +G + G  +  + E D  P   TG
Sbjct: 204 PVSLEDLCAGKKKSFKIGRKGPNGTSEKTQIDIQLKQGWKAGTKITYKNEGDYNPR--TG 261

Query: 262 D---LLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQ 318
               L FV++E  +     +R GD+L   L +S  E++ GF K + T +D R L +   Q
Sbjct: 262 GRKTLQFVLQE--KAHPLFKRDGDNLIYTLPLSFKESLLGFSKTIQT-IDGRTLPISRVQ 318

Query: 319 GKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
              I+P    R   +G P+     + GD+ V+  I++P
Sbjct: 319 --PIQPSESSRYPGQGMPITKKPGQRGDLIVKYKIDYP 354

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 51/69 (73%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LG+ P A+ TEIKKAYRK A++ HPDK  D+    +++ KF+ +  AY++LSD+
Sbjct: 5  TEYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDD---PDAQSKFQSVGEAYQVLSDD 61

Query: 62 DSRKKYDVY 70
          D RK+YD +
Sbjct: 62 DLRKRYDEF 70

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 49/69 (71%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A++ E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D+
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDT------EKFKEISEAFEILNDK 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREIYDQY 67

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 10/138 (7%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLE 278
           G     E+  + + +  G + G  V  +   D  P   TG    L FVI+E  +T    +
Sbjct: 218 GPGGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYNPR--TGGRKTLQFVIQE--KTHPLYK 273

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R GDDL   L ++  E++ GF K +  T+D R L L   +   ++P    R   +G P+ 
Sbjct: 274 RNGDDLEYTLPLTFKESLLGFSKTI-QTIDGRTLPLS--RSSPVQPTETSRYPGQGMPMP 330

Query: 339 DSGNKFGDMYVQVHIEFP 356
              ++ GD+ V+  I++P
Sbjct: 331 KMPSQRGDLVVRFKIDYP 348

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A + E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREIYDSY 67

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 69/138 (50%), Gaps = 10/138 (7%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLE 278
           G   + E+K + + +  G + G  +  + E D   ++ TG    + FVI+E  +   + +
Sbjct: 203 GPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDY--NQQTGGRQTMQFVIQE--KLHPHFK 258

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R G++L   L +S  E++ GF K + T +D R L   I + + I+P        +G PL 
Sbjct: 259 RDGNNLIYTLPLSFKESLLGFSKTIQT-IDGRTLP--ISRVQPIQPSETSTYPGQGMPLP 315

Query: 339 DSGNKFGDMYVQVHIEFP 356
            +  + GD+ ++  +++P
Sbjct: 316 KTPAQRGDLIIKYKVDYP 333

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A++ E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDA 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREIYDQY 67

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 49/94 (52%), Gaps = 5/94 (5%)

Query: 263 LLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVI 322
           L FVI+E  +   N +R GDDL   L +S  E++ GF K +  T+D R L L   Q   +
Sbjct: 265 LQFVIQE--KGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQ--PV 319

Query: 323 RPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356
           +P        +G P   + ++ G++ V+  +++P
Sbjct: 320 QPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 113/251 (45%), Gaps = 30/251 (11%)

Query: 116 RSVRTSDARIPLKLSMKELYNG-KTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQS 174
           R  +    ++P KLS ++   G K    R      C  C GSGL+   Q+      VC  
Sbjct: 168 REFKGDSIQVPFKLSFRDAVFGLKDVPLRYAVYDQCGTCSGSGLKAGAQRS-----VCGG 222

Query: 175 CEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVI-SEEKTLT 233
           C G G +  ++    GF +  T  C +C+G+G +   +  D C  C G+ V+ +  K + 
Sbjct: 223 CHGTGTQVHVR---AGFQMAST--CSQCSGEGYSI--RRGDRCGTCSGEGVVFNRNKEVK 275

Query: 234 VYIPRGSRNGDIVKLEGEADQEPDKVT-----------GDLLFVIEENPETSTNLERRGD 282
           +  P G ++GD+VK+ G+      +V            GDLL  ++   +    ++   D
Sbjct: 276 MDFPHGLQDGDVVKVPGQGSFPHIQVDPKTAHTMRLRRGDLLVQVQVERDPRFQIKNNYD 335

Query: 283 DLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGN 342
             + + +I ++ A  G   V   T+D   ++LK+  G   +P   + + N+G P   SG 
Sbjct: 336 IWYVQ-EIPITTAALG-GTVSIPTVDGDQIRLKVIPG--TQPDQVVSIPNKGVPRGLSGA 391

Query: 343 KFGDMYVQVHI 353
           + GDM VQ  I
Sbjct: 392 R-GDMKVQYRI 401

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           YE LGVA DAS ++IKKAY KLA Q HPD   D    E +E KF ++  AYEILSDE+ R
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDINKD----EGAEKKFHDLQNAYEILSDENKR 98

Query: 65  KKYDVY 70
           ++YD +
Sbjct: 99  RQYDQF 104

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P A++ E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREIYDQY 67

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 67/140 (47%), Gaps = 9/140 (6%)

Query: 218 KKCHGKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPD-KVTGDLLFVIEENPETSTN 276
           K  HG    SE+  + + +  G + G  +  + + D  P       L FVI+E  ++  N
Sbjct: 213 KGPHG---TSEKTQIDIQLKPGWKAGTKITYKNQGDFNPQTNRRKTLQFVIQE--KSHPN 267

Query: 277 LERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP 336
            +R GDDL   L +S  E++ GF K +  T+D R L L   Q   ++P        +G P
Sbjct: 268 FKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQ--PVQPSQTSTYPGQGMP 324

Query: 337 LDDSGNKFGDMYVQVHIEFP 356
              + ++ G++ V+  +++P
Sbjct: 325 TPKNPSQRGNLIVKYKVDYP 344

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y+VLGV+P A+  EIKKAYRK A+Q HPDK  D+    E+E KF+ +  AY++LSD 
Sbjct: 5  TEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDD---PEAETKFQAVGEAYQVLSDT 61

Query: 62 DSRKKYDVY 70
          + R +YD +
Sbjct: 62 ELRSRYDQF 70

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++LGV+P+ +  E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 DSRKKYDVY 70
          + R+ YD Y
Sbjct: 59 NKREVYDKY 67

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 71/138 (51%), Gaps = 10/138 (7%)

Query: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLE 278
           G   I E+K + + +  G + G  +  + E D  P   TG    L F+I+E  +    L+
Sbjct: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPS--TGGRQTLQFIIQE--KMHDFLK 257

Query: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338
           R G+DL   L +S  E++ GF K V  T+D R  ++ I + + ++P    R   +G PL 
Sbjct: 258 RDGNDLTYTLPLSFKESLLGFSKTV-HTIDGR--QIFISKTQPVQPSEESRYPGQGMPLS 314

Query: 339 DSGNKFGDMYVQVHIEFP 356
            + ++ GD+ V+  I++P
Sbjct: 315 KNPSERGDLIVKYKIDYP 332

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 49/66 (74%), Gaps = 3/66 (4%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          Y+VLGV+P AS  EIKKAYRK A++ HPDK  D+    +++ KF+ +  AY++LSDE+ R
Sbjct: 8  YDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDD---PDAQAKFQRVGEAYQVLSDEELR 64

Query: 65 KKYDVY 70
          K+YD +
Sbjct: 65 KRYDEF 70

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T LY++L V+P A++ EIKK YRK AL++HPDK   +        KFKEI+ A+EILSD 
Sbjct: 5  TGLYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDA 58

Query: 62 DSRKKYDVY 70
          + R+ YD Y
Sbjct: 59 EKREVYDQY 67

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 67/133 (50%), Gaps = 10/133 (7%)

Query: 227 SEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLERRGDD 283
           +E+  + + +  G + G  +  + + D  P   TG    L F+++E P  +TN +R  D+
Sbjct: 217 AEKAQIEIALKAGWKAGTKITYKNQGDYNPS--TGGRKTLQFILKEKP--NTNFKRDEDN 272

Query: 284 LHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNK 343
           L   L ++  E++ GF+K +  T+D +   L I + + ++P        +G P+  S  +
Sbjct: 273 LIYTLPLTFKESLLGFQKTI-KTIDGKT--LPISRVQPVQPSECTTYPGQGMPISKSVGQ 329

Query: 344 FGDMYVQVHIEFP 356
            GDM V+  + +P
Sbjct: 330 RGDMIVKFKVGYP 342

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LG+ PDAS TEIKKAYRK A+  HPDK  D+    E++ KF+ I  AY++LSD 
Sbjct: 5  TEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDD---PEAQAKFQAIGQAYQVLSDP 61

Query: 62 DSRKKYDVY 70
          + R +YD +
Sbjct: 62 ELRSRYDEF 70

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/66 (57%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   AS  E+KKAYRK ALQ+HPDK  D V  EE+  KF  I AAYE+LSD   R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAIIRAAYEVLSDSQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++L V+ DAS  EIKK+YRKLA++ HPDK  D+    +++ KF+E+  AY++L D+
Sbjct: 5  TTYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDD---PQAQTKFQELAKAYQVLIDD 61

Query: 62 DSRKKYDVY 70
          D RKKYD +
Sbjct: 62 DLRKKYDQF 70

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LG+ PDAS T+IKKAYRK A+  HPDK  D+    E++ KF+ I  AY++LSD 
Sbjct: 5  TEYYDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDD---PEAQAKFQAIGEAYQVLSDP 61

Query: 62 DSRKKYDVY 70
          D R +YD +
Sbjct: 62 DLRSRYDEF 70

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 38/66 (57%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   AS  E+KKAYRK ALQ+HPDK  D V  EE+  KF  I AAYE+LSD   R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATEKFAIIRAAYEVLSDSQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/66 (57%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   AS  E+KKAYRK ALQ+HPDK  D V  EE+  KF  I AAYE+LSD   R
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAVIRAAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y+VLGV P+A+ T+IKKAYRK A+Q HPDK  D+    E++ KF+ +  AY++LSD 
Sbjct: 5  TEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDD---PEAQSKFQAVGEAYQVLSDP 61

Query: 62 DSRKKYDVY 70
            R KYD +
Sbjct: 62 GLRSKYDQF 70

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y+ LG++P A+ TEIKKAYR+ A++ HPDK  D+    E+E KF+ +  AY++LSDE
Sbjct: 5  TEYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDD---PEAENKFQAVGEAYQVLSDE 61

Query: 62 DSRKKYDVY 70
            R +YD Y
Sbjct: 62 SLRARYDEY 70

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          TKLY++L V P A++ E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 5  TKLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58

Query: 62 DSRKKYDVY 70
            R+ YD Y
Sbjct: 59 QKREIYDQY 67

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 63/131 (48%), Gaps = 8/131 (6%)

Query: 228 EEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTG--DLLFVIEENPETSTNLERRGDDLH 285
           E+  + + +  G + G  +  + + D  P K  G   L F+I E P    + +R  D+L 
Sbjct: 228 EKTQIDIQLKPGWKAGTKITYKSKGDYNP-KTGGRKTLQFIISEKPHP--HFKREDDNLI 284

Query: 286 TRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFG 345
             L ++  E++ GF K + T +D + L L   +G+ ++P        +G P+     + G
Sbjct: 285 YTLPLTFKESLLGFSKTIQT-IDGKNLPLS--RGQPVQPSETTTYPGQGMPITKKPGQRG 341

Query: 346 DMYVQVHIEFP 356
           D+ ++  +++P
Sbjct: 342 DLLIKYKVDYP 352

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 51/69 (73%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y+VLG++P+A+ +EIKKAYRK+A+  HPDK  D+    E++ KF+ +  AY++L+D 
Sbjct: 5  TEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDD---PEAQAKFQAVGEAYQVLNDP 61

Query: 62 DSRKKYDVY 70
            RK+YD +
Sbjct: 62 ALRKQYDEF 70

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LGV PDA+ TEIKKAYR+ A+Q HPDK  D+    +++ KF+ +  AY++LSD 
Sbjct: 5  TEYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDD---PDAQAKFQAVGEAYQVLSDP 61

Query: 62 DSRKKYDVY 70
            R +YD +
Sbjct: 62 GLRSRYDEF 70

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y+VLG+ P A+ TEIKKAYR+ A++ HPDK  D+    E   +F+++  AY++LSD 
Sbjct: 5  TEYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASE---RFQQVGEAYQVLSDP 61

Query: 62 DSRKKYDVY 70
          D RK+YD +
Sbjct: 62 DLRKQYDEF 70

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LG+ PDA+ TEIKKAYR+ A++ HPDK  D+    +++ KF+ +  AY++LSD 
Sbjct: 5  TEYYDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDP 61

Query: 62 DSRKKYDVY 70
            R KYD +
Sbjct: 62 GLRSKYDEF 70

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LG+ P+A+ TEIKKAYR+ A++ HPDK  D+    +++ KF+ +  AY++LSD+
Sbjct: 5  TEYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDD---PDAQAKFQAVGEAYQVLSDQ 61

Query: 62 DSRKKYDVY 70
            R KYD +
Sbjct: 62 GLRSKYDEF 70

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y+VLGV P A+  EIKKAYR+ A+Q HPDK  D+    E++ KF+E+  AY++LSD 
Sbjct: 5  TGYYDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDD---PEAQAKFQEVGEAYQVLSDP 61

Query: 62 DSRKKYDVY 70
            R +YD +
Sbjct: 62 GLRSRYDEF 70

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   AS  E+KKAYRK ALQ+HPDK  D V  +E+  KF  I AAYE+LSD   R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--QEATEKFAIIRAAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  YE+LG++P A+  EIKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++LSD+
Sbjct: 5  TAYYELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSDD 61

Query: 62 DSRKKYDVY 70
            R KYD Y
Sbjct: 62 TLRLKYDKY 70

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LG+ P A+Q EIKKAYRK +++ HPDK  ++    E   +F++I+ AY++LSDE
Sbjct: 5  TTYYDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATE---RFQQISEAYQVLSDE 61

Query: 62 DSRKKYDVY 70
            R  YD +
Sbjct: 62 HLRNNYDQF 70

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 49/67 (73%), Gaps = 3/67 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LGV P+A+  EIKKAYR+ A++ HPDK  ++     ++ KF+ +  AY++LSD+
Sbjct: 5  TEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPND---PNAQAKFQAVGEAYQVLSDD 61

Query: 62 DSRKKYD 68
          + RK+YD
Sbjct: 62 ELRKRYD 68

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LGV+  AS  EIKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++L D+
Sbjct: 5  TEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLGDD 61

Query: 62 DSRKKYDVY 70
          D R KYD Y
Sbjct: 62 DLRAKYDKY 70

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LG+ P+A+ TEIKKAYR+ A++ HPDK  D+    +++ KF+ +  AY++LSD 
Sbjct: 5  TEYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDP 61

Query: 62 DSRKKYDVY 70
            R KYD +
Sbjct: 62 GLRSKYDEF 70

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LG+ P A+Q EIKKAYRK +++ HPDK  ++    ++  +F+ I+ AY++LSDE
Sbjct: 5  TAYYDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPND---PQATERFQAISEAYQVLSDE 61

Query: 62 DSRKKYDVY 70
            R KYD Y
Sbjct: 62 SLRLKYDKY 70

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 117/284 (41%), Gaps = 30/284 (10%)

Query: 116 RSVRTSDARIPLKLSMKELYNG-KTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQS 174
           R  +     +P  +S K+   G K  K +      C  C GSGL+        K   C  
Sbjct: 184 REYKGDSIHVPFNVSFKDAVFGLKGIKLKYSAYDQCGTCAGSGLKSG-----AKRSSCSI 238

Query: 175 CEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVI-SEEKTLT 233
           C G G +  ++    GF +  T  C +CNG+G  +  +  D C  C G+ V+ + +K + 
Sbjct: 239 CHGTGTQMHVR---AGFQMAST--CTQCNGEG--SSIRRSDQCSSCRGEGVVFNRQKEID 291

Query: 234 VYIPRGSRNGDIVKLEGEA-------DQEPDKVT----GDLLFVIEENPETSTNLERRGD 282
           V +P G ++GD+VK+  +        D E         GDLL  I    +    +    D
Sbjct: 292 VDLPHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIRTRRGDLLIQIRVERDPRFQIRNNYD 351

Query: 283 DLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGN 342
             +T+     + A+ G   V   T+D   L+LKI  G   +    + + N+G P   + +
Sbjct: 352 IWYTQDIPITTAALGGV--VNIPTVDGEQLRLKIAPG--TQHEQVVSVPNKGVPKGLTAS 407

Query: 343 KFGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNARVADTG 386
           + GDM VQ  I        +EK   E L  +  +    R  + G
Sbjct: 408 R-GDMKVQYKISLRKPQSKAEKYLWEALADVTGDNTAKRTENLG 450

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           YE LGV+ DAS ++IKKAY KLA ++HPD   D    E +E KF ++  AYEILSDE  R
Sbjct: 53  YETLGVSRDASTSQIKKAYYKLAKKYHPDINKD----EGAEKKFHDLQNAYEILSDESKR 108

Query: 65  KKYDVY 70
            +YD +
Sbjct: 109 SQYDQF 114

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   AS  E+KKAYRK ALQ HPDK  D V  +E+   F  I AAYE+LSD   R
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDKNPDNV--DEATENFATIRAAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDAH 69

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LGV P+A+  EIKKAYR+ A++ HPDK  D+    E++ KF+ +  AY++LSD 
Sbjct: 5  TQYYDILGVKPEATPAEIKKAYRRRAMETHPDKHPDD---PEAQSKFQAVGEAYQVLSDP 61

Query: 62 DSRKKYDVY 70
            R +YD +
Sbjct: 62 GLRSRYDEF 70

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LG+ P+A+ TEIKKAYR+ A++ HPDK  D+    +++ KF+ +  AY++LSD 
Sbjct: 5  TEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDP 61

Query: 62 DSRKKYDVY 70
            R KYD +
Sbjct: 62 GLRSKYDQF 70

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          Y++L V  DAS  ++KKAYR+ ALQ+HPDK  D V  EE+   F EI AAYE+LSD   R
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNV--EEATTIFAEIRAAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LGV+PDA   +IKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++LS +
Sbjct: 5  TTYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKD 61

Query: 62 DSRKKYDVY 70
          D R KYD +
Sbjct: 62 DLRAKYDKF 70

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LGVA DA Q +IKKAYRK +++ HPDK  D+    E   +F+ I+ AY++LS E
Sbjct: 5  TTYYDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATE---RFQAISEAYQVLSSE 61

Query: 62 DSRKKYDVY 70
          + R KYD +
Sbjct: 62 ELRMKYDKF 70

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          Y+VLG+ PDA+  EIKKAYR+ A+Q HPDK  D+    +++ KF+ +  AY++LSD   +
Sbjct: 8  YDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDD---PDAQSKFQAVGEAYQVLSDPQLK 64

Query: 65 KKYDVY 70
           +YD +
Sbjct: 65 SRYDQF 70

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV  +A+  E+KKAYR+ ALQ HPDK  D V  EE+   F  + AAYE+L+D   R
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDKNPDNV--EETTAIFASVRAAYEVLADPQER 63

Query: 65 KKYD 68
            YD
Sbjct: 64 AWYD 67

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LGV+PDA   EIKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++LS +
Sbjct: 5  TAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLSSD 61

Query: 62 DSRKKYDVY 70
          + R KYD +
Sbjct: 62 ELRAKYDKF 70

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LGV+P+A   EIKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++LS+E
Sbjct: 5  TTYYDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATE---RFQSISQAYQVLSNE 61

Query: 62 DSRKKYDVY 70
          + R KYD +
Sbjct: 62 ELRTKYDKF 70

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LGV P A   +IKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++LS E
Sbjct: 6  TTYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKE 62

Query: 62 DSRKKYDVY 70
          D R KYD Y
Sbjct: 63 DLRAKYDKY 71

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (2%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  YE+LGV+  A   E+KKA+R+ ALQ+HPDK  D V  EE+   F +I AAYE+L+D 
Sbjct: 3  TCYYELLGVSSTADDLELKKAFRRKALQYHPDKNRDNV--EEATETFAQIRAAYEVLNDP 60

Query: 62 DSRKKYDVY 70
            R  YD +
Sbjct: 61 QERAWYDSH 69

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y+ LG++PDA+ TEIKKAYRK A+  HPDK  ++    +++ KF+ +  AY++LSD 
Sbjct: 5  TEYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPND---PDAQAKFQAVGQAYQVLSDP 61

Query: 62 DSRKKYDVY 70
            R +YD +
Sbjct: 62 GLRSRYDEF 70

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LGV+  AS  EIKKAYRK ++Q HPDK  +++   E   +F+ I+ AY++L D+
Sbjct: 5  TEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATE---RFQAISEAYQVLGDD 61

Query: 62 DSRKKYDVY 70
          + R KYD +
Sbjct: 62 ELRAKYDKF 70

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LGV+PDA Q +IKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++L  +
Sbjct: 5  TTYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLGSD 61

Query: 62 DSRKKYDVY 70
          + R KYD +
Sbjct: 62 ELRAKYDKF 70

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREES---EMKFKEITAAYEILSDE 61
           Y++LGV+  AS  EIK AYRKL+L+ HPDKVA ++  EE    E  + +I+ AYE L+DE
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 62  DSRKKYDVY 70
             ++ Y +Y
Sbjct: 182 LVKQNYLMY 190

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   A+  E+KKAYRK ALQ HPDK  D V  EE+   F  I +AYE+LSD   R
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPDNV--EEATEIFATIRSAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDAH 69

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   AS +++KKAYR+ ALQ+HPDK  D V  EE+   F  I +AYE+L+D   R
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPDNV--EEATTVFATIRSAYEVLADPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREE---SEMKFKEITAAYEILSDE 61
           Y++LG++  AS+ EIK AYRKL+++ HPDK+A E+  +E    E  + +IT AYE L+DE
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 62  DSRKKYDVY 70
            +R+ +  Y
Sbjct: 181 LTRQNFLKY 189

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          Y++LG+ P A+  EIKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++LS E+ R
Sbjct: 8  YDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSSEELR 64

Query: 65 KKYDVY 70
           KYD +
Sbjct: 65 AKYDKF 70

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 95/218 (43%), Gaps = 29/218 (13%)

Query: 150 CDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTT 209
           C  C GSGL+    +       C  C G G +  I+    GF +  T  C +C G+G   
Sbjct: 206 CGTCDGSGLKPGASR-----TTCPGCSGTGTRVHIR---AGFQMAST--CNQCGGEGSVV 255

Query: 210 PTKPEDHCKKCHGK-CVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVT-------- 260
             +  D C  CHG+   ++++  + V +P G ++GD++++ G+       V         
Sbjct: 256 --RDSDTCATCHGEGASLNKDHAIKVDLPHGLQDGDVIRISGQGSYPNIAVDPAMKDTVR 313

Query: 261 ---GDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIP 317
              GD+L  I  + +    ++ + D   T+     + A+ G   V   T+D   ++LK+ 
Sbjct: 314 LSRGDVLLRIRVDKDPRFQIKNKYDIWLTQDIPITTAALGGI--VTVPTVDGEQVRLKVA 371

Query: 318 QGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEF 355
            G   +  + + +  +G P    G++ GDM VQ  I  
Sbjct: 372 PG--TQHNDVVSISQKGVPRGAFGSR-GDMKVQYKISI 406

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 4/66 (6%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
           Y  LGV+  AS +EIKKAY KLA ++HPD        E+++ KF ++  AYEILSD+  R
Sbjct: 42  YATLGVSKSASGSEIKKAYYKLAKKYHPDINK----AEDAQKKFHDLQNAYEILSDDSKR 97

Query: 65  KKYDVY 70
           +++D +
Sbjct: 98  QQWDQF 103

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  YE+LGV   AS T++KKAYR+ ALQ+HPDK    V ++ +E+ F  I AAYE+LSD 
Sbjct: 3  TCYYELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNV-QQATEI-FASIRAAYEVLSDA 60

Query: 62 DSRKKYDVY 70
            R  YD +
Sbjct: 61 QERAWYDAH 69

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          Y++L V  DA+ T++K+AYRK AL +HPDK  + +  EE+   F +I AAYE+LSD   R
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNI--EEATEVFAQIRAAYEVLSDAQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDAH 69

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+L V P A   E+KKAYR+ ALQ+HPDK  + V  EE+   F  I AAYE+LSD   R
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDKNPENV--EEATEIFASIRAAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          ++ YEVL V   AS  EIKKAYR+LA++ HPDK         S   FK I  A+E+L DE
Sbjct: 22 SEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNG----HPRSAEAFKVINRAFEVLGDE 77

Query: 62 DSRKKYD 68
          D R+ +D
Sbjct: 78 DKRRLFD 84

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   AS  E+KKAYRK AL++HPDK  + V  EE+   F  I  AYE+LSD   R
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDKNPNNV--EEATQAFATIRLAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   AS  ++KKAYRK AL +HPDK  D V  EE+   F  I AAYE+L+D   R
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRDNV--EEATAIFATIRAAYEVLADPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LG+ P+A+  EIKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++LS++
Sbjct: 5  TAYYDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATE---RFQAISEAYQVLSND 61

Query: 62 DSRKKYD 68
          + R KYD
Sbjct: 62 ELRAKYD 68

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 112/268 (41%), Gaps = 30/268 (11%)

Query: 116 RSVRTSDARIPLKLSMKE-LYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQS 174
           R  + S   I  ++S K+ ++  K    +      C+ C GSGL+    +       C  
Sbjct: 175 REYQGSPIEISHRISFKDSVFGTKNVNLKYSAYDPCNTCDGSGLKPGASRS-----TCPG 229

Query: 175 CEGHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCV-ISEEKTLT 233
           C G G +  ++    GF +  T  C +C G+G     +  D C+ CHG+   + +   L 
Sbjct: 230 CSGTGTRVHVR---AGFQMAST--CNQCGGEGSVL--RDADTCQTCHGEGAKLDKNHELK 282

Query: 234 VYIPRGSRNGDIVKLEGEADQEPDKVT-----------GDLLFVIEENPETSTNLERRGD 282
           V +P G ++GD++++ G+       V            GDLL  I  + +    ++ + D
Sbjct: 283 VDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTVRLSRGDLLLRIRVDKDPRFQIKNKYD 342

Query: 283 DLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGN 342
              T+     + A+ G   V   T+D   ++LK+  G   +  + + +  +G P    G 
Sbjct: 343 IWFTQDIPITTAALGGV--VTIPTVDGEQVRLKVSPG--TQHHDVVSIPQKGVPRGSFGT 398

Query: 343 KFGDMYVQVHIEFPPDNWFSEKSDVEVL 370
           + GDM VQ  +        +EK   E L
Sbjct: 399 R-GDMKVQYRVVIKKPQSQAEKCLWEAL 425

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 8/68 (11%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPD--KVADEVLREESEMKFKEITAAYEILSDED 62
           Y  LGV+  A+ +EIKKAY KLA ++HPD  K AD      ++ KF ++  AYEILSD+ 
Sbjct: 41  YSTLGVSNSATSSEIKKAYYKLAKKYHPDINKAAD------AQKKFHDLQNAYEILSDDC 94

Query: 63  SRKKYDVY 70
            R+++D Y
Sbjct: 95  KRQQWDQY 102

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (68%), Gaps = 2/67 (2%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKV-ADEVLREES-EMKFKEITAAYEILSDED 62
           Y+VLGVAP A+  EI+KAY  L  ++HPDK+ A+   +EE+      +I  AYE LSD+D
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSDDD 596

Query: 63  SRKKYDV 69
            RK+YD+
Sbjct: 597 KRKEYDL 603

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+L V+  AS  E+KKAYRK ALQ+HPDK  +    EE+   F EI AAYE+LSD   R
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDKNRENP--EEATAIFSEIRAAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LGV+  AS  EIKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++L D 
Sbjct: 5  TEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDN 61

Query: 62 DSRKKYDVY 70
          + R KYD Y
Sbjct: 62 ELRVKYDKY 70

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 2/67 (2%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKV-ADEVLREES-EMKFKEITAAYEILSDED 62
           Y++LGV+P+A+  EI+KAY  L  ++HPDK+ A+   ++ES      +I  AYE LSDED
Sbjct: 544 YKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSDED 603

Query: 63  SRKKYDV 69
            RK+YD+
Sbjct: 604 KRKEYDL 610

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   A+  E+KKAYRK ALQ HPDK  D V  +E+   F  I +AYE+LSD   R
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPDNV--DEATEIFATIRSAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDAH 69

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+LGV   AS  E+KKAYRK ALQ+HPDK   +V  EE+   F  I  AYE+LSD   R
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDKNPTKV--EEATEIFATIRTAYEVLSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 AWYDSH 69

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 2/67 (2%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKV-ADEVLREES-EMKFKEITAAYEILSDED 62
           Y++LGV+P AS  EI+KAY  L  ++HPDK+ A+   ++ES      +I  AYE LSD+D
Sbjct: 540 YKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDD 599

Query: 63  SRKKYDV 69
            RK+YD+
Sbjct: 600 KRKEYDL 606

>KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain,
          Length = 162

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 3  KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVA---DEVLREESEMKFKEITAAYEILS 59
            YE+LG+  DAS  EIK+AYR + L+ HPDK     +      S     +I  AY+ L 
Sbjct: 4  SFYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQTLI 63

Query: 60 DEDSRKKYD 68
          D+D RKKYD
Sbjct: 64 DQDLRKKYD 72

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKV---ADEVLREESEMKFKEITAAYEILSDE 61
           YE+LG++  AS  +IK AYRKL+L+ HPDK+     E  RE  E ++ +IT AYE L+DE
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 62  DSRKKYDVY 70
             R  Y  Y
Sbjct: 183 LIRFNYLTY 191

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+L +  DA+Q EIKKAYR   L  HPDK++  +    S +   +I  AY+ILS+  +R
Sbjct: 10 YEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTR 69

Query: 65 KKYD 68
          ++YD
Sbjct: 70 REYD 73

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          ++ Y++LGV+  A+  EIKKAYRK ++Q HPDK  ++    E   +F+ I+ AY++L D+
Sbjct: 5  SEYYDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDD 61

Query: 62 DSRKKYDVY 70
          + R KYD Y
Sbjct: 62 ELRAKYDKY 70

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           YEVL +  +AS  EIKKAYRKLA++ HPDK       E     FK I  A+E+LSDE  
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASE----AFKRINRAFEVLSDEQK 78

Query: 64 RKKYD 68
          R+ +D
Sbjct: 79 RRIFD 83

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           YE+L +  +AS +++KKAYRKLA++ HPDK       E     FK+I  A+E+LSDE+ 
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAE----AFKKINRAFEVLSDENK 80

Query: 64 RKKYD 68
          RK YD
Sbjct: 81 RKVYD 85

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREES---EMKFKEITAAYEILSDE 61
           YE+LG++  AS  +IK AYRKL+++ HPDKVA  +  +E    E  + +IT AYE L+DE
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYESLTDE 186

Query: 62  DSRKKYDVY 70
             R+ Y  Y
Sbjct: 187 LVRQNYLKY 195

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 54.7 bits (130), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/62 (51%), Positives = 37/62 (59%), Gaps = 4/62 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           YEVL V   AS  EIKKAYRKLA++ HPDK       E     FK I  A+E+LSDE  
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSDEQK 78

Query: 64 RK 65
          R+
Sbjct: 79 RR 80

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LGV P+++  EIKKAYRK +++ HPDK  +     ++  KF+ I+ AY++LSD+
Sbjct: 5  TEYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPN---NPDATKKFQAISEAYQVLSDK 61

Query: 62 DSRKKYDVY 70
          + R  YD +
Sbjct: 62 NLRSNYDKF 70

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           YEVL +   AS  EIKK+YRKLA++ HPDK       E     FK I  A+E+LSDE+ 
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASE----AFKVINRAFEVLSDEEK 80

Query: 64 RKKYD 68
          R+ YD
Sbjct: 81 RRLYD 85

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 6/70 (8%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVL------REESEMKFKEITAAYEIL 58
          YEVL +  DA+  EIKKAY++  L  HPDK + ++L       + + +   +I  AY+IL
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYKIL 70

Query: 59 SDEDSRKKYD 68
          S+E +R++YD
Sbjct: 71 SNESTREQYD 80

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEM---KFKEITAAYEILSDE 61
           YE+LG++  AS  +IK AYRKL+++ HPDK+A  +  +E ++    + +IT AYE L+DE
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 62  DSRKKYDVY 70
             R+ Y  Y
Sbjct: 187 LVRQNYLKY 195

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 4/66 (6%)

Query: 3  KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
          + YE+L V   AS+++IKKAYRKLA++ HPDK       E     FK+I  A+E+LSD+ 
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASE----AFKKINRAFEVLSDDS 77

Query: 63 SRKKYD 68
           R+ +D
Sbjct: 78 KRRIFD 83

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ YE+LG+   A+  EIKKAYRK +++ HPDK  ++    E   +F+ I+ AY++LSD 
Sbjct: 5  TEYYELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATE---RFQAISEAYQVLSDS 61

Query: 62 DSRKKYDVY 70
          D R  YD +
Sbjct: 62 DLRANYDKF 70

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  YE+LGV PDA+ +EIKKAYRK AL   P+K    +   E   KF+ I  AY++L  +
Sbjct: 5  TAYYELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANE---KFQAIAEAYQVLHSK 61

Query: 62 DSRKKYD 68
          + R+KYD
Sbjct: 62 ELREKYD 68

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREES---EMKFKEITAAYEILSDE 61
           YE+LGV+  AS  +IK AYRKL+++ HPDK+A  +  +E    E  + +IT AYE L+DE
Sbjct: 127 YEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLTDE 186

Query: 62  DSRKKYDVY 70
             R+ Y  Y
Sbjct: 187 LVRQNYLKY 195

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEV---LREESEMKFKEITAAYEILSDE 61
           YE+LGV+  A+  EIK AYRKL+++ HPDK+  ++    R + E  + +IT AYE L+DE
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 62  DSRKKY 67
           + ++ Y
Sbjct: 184 NVKENY 189

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LG++  A+  EIKKAYRK +++ HPDK  ++    E   +F+ I+ AY++LSD+
Sbjct: 5  TEYYDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATE---RFQAISEAYQVLSDK 61

Query: 62 DSRKKYDVY 70
            R  YD Y
Sbjct: 62 QLRSNYDKY 70

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 4/66 (6%)

Query: 3  KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
          + YE+L V   A+ +EIKKAYRKLA++ HPDK +     E     FK I  A+E+LS+E+
Sbjct: 21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEVLSNEE 76

Query: 63 SRKKYD 68
           R  YD
Sbjct: 77 KRSIYD 82

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREE---SEMKFKEITAAYEILSDE 61
           YE+LG++  AS  +IK AYRKL+++ HPDK++ ++ +EE    E K+ +IT AYE L+DE
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 62  DSRKKYDVY 70
             ++ +  Y
Sbjct: 183 VIKENFLKY 191

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREES---EMKFKEITAAYEILSDE 61
           YE+LG++  AS  +IK AYRKL+++ HPDK+A  +  +E    E  + +IT AYE L+DE
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDE 186

Query: 62  DSRKKYDVY 70
             R+ Y  Y
Sbjct: 187 LVRQNYLKY 195

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEV---LREESEMKFKEITAAYEILSDE 61
           Y++LG+ P+AS  EI+KAY  L  ++HPDK   ++     ++++ K  EI  AYE+L+DE
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 62  DSRKKYD 68
           + RK+YD
Sbjct: 603 EKRKEYD 609

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 3  KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
          + YE+L V   A+  EIKKAYRKLA++ HPDK +     E     FK I  A+E+LS+E+
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASE----AFKVINRAFEVLSNEE 76

Query: 63 SRKKYD 68
           R  YD
Sbjct: 77 KRSIYD 82

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 3  KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
          + YE+L V   AS  EIKKAYRKLA++ HPDK       E     FK I  A+E+LSD  
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASE----AFKRINRAFEVLSDVG 79

Query: 63 SRKKYD 68
           R+ +D
Sbjct: 80 KRRMFD 85

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa]
          {ON} Anc_1.113 YJR097W
          Length = 159

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 1  MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD 60
          ++  YE LG+  D S  EIKKAY++  L  HPDK+ D    E S ++  +I  AY++L D
Sbjct: 2  ISSHYETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGD----ESSSVEVNKIQEAYKVLCD 57

Query: 61 EDSRKKYD 68
           + R+KYD
Sbjct: 58 VNLREKYD 65

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y +LG+ P A+  EI+K+Y KLA Q HPDK   +   E     FK +  A+ IL+DE
Sbjct: 6  TTYYSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAE----LFKLVVHAHSILTDE 61

Query: 62 DSRKKYDV 69
          ++++KYD 
Sbjct: 62 ETKRKYDT 69

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+L +  DA+Q EIKKAYR   L  HPDK+        + +   +I  AY+ILS+   R
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 65 KKYD 68
           +YD
Sbjct: 70 GEYD 73

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (57%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+L +  DA+Q EIK+AYR   L  HPDK+        S +   +I  AY ILSD  SR
Sbjct: 10 YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRSR 69

Query: 65 KKYD 68
           +YD
Sbjct: 70 CEYD 73

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREES---EMKFKEITAAYEILSDE 61
           Y +LGV+P A+  +IK AYRKL+++ HPDK++ ++  EE    E  + +I+ AYE L+DE
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 62  DSRKKYDVY 70
            ++  Y  Y
Sbjct: 185 ITKANYLTY 193

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREE---SEMKFKEITAAYEILSDE 61
           YE+LG++  AS+ +IK AYRKL+++ HPDK++ ++  +E    E  + +IT AYE L+DE
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 62  DSRKKYDVY 70
             R+ +  Y
Sbjct: 191 AMRENFLKY 199

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++LGV   A+  EIKKAYRK ++  HPDK  D+    E   +F+ I+ AY++LS++
Sbjct: 5  TEYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATE---RFQSISEAYQVLSNK 61

Query: 62 DSRKKYD 68
          D R  YD
Sbjct: 62 DLRANYD 68

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREE---SEMKFKEITAAYEILSDE 61
           Y++LG++P AS  +IK AYR+L+L+ HPDK++ E+  EE    E  + +I+ A+E L+D 
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 62  DSRKKYDVY 70
             R+ Y  Y
Sbjct: 187 IVRENYLKY 195

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y VLG+ P AS  +IKK+Y+KLA + HPDK       E SE+ FK +  AY ILSD 
Sbjct: 6  TTHYSVLGLTPTASLNDIKKSYKKLARELHPDKSKS---NESSEL-FKIVVDAYSILSDV 61

Query: 62 DSRKKYDV 69
            R++Y++
Sbjct: 62 KEREEYNI 69

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 2/67 (2%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVAD--EVLREESEMKFKEITAAYEILSDED 62
           Y++LG+  DA+  +I++AY  L  ++HPDK  +  +  R + E K   I  AYE+LSDE 
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDES 570

Query: 63  SRKKYDV 69
            RK+YD+
Sbjct: 571 KRKEYDM 577

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (63%), Gaps = 4/66 (6%)

Query: 3  KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
          + YE+L V   A+ ++IKKAYRKLA++ HPDK +     E     FK I  A+E+LS+E+
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEVLSNEE 76

Query: 63 SRKKYD 68
           R  YD
Sbjct: 77 KRSIYD 82

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (62%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+L +  DA+Q EIKKAYR   L  HPDK+A +   + + +    I  AY++LS+  +R
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKTR 69

Query: 65 KKYD 68
           +YD
Sbjct: 70 GEYD 73

>Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W
          - Hypothetical ORF [contig 116] FULL
          Length = 161

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 3/65 (4%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           YE+LGV  D ++ +IKKAY+   L  HPDKV  +V    +++  +EI  AY +L +  S
Sbjct: 7  FYEILGVEADCNEVDIKKAYKAKLLSTHPDKVGKDV---GNKVLIEEIKEAYRVLIESPS 63

Query: 64 RKKYD 68
          R+KYD
Sbjct: 64 REKYD 68

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 43/55 (78%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILS 59
          Y  L ++ DA  +++KK+YR+L L++HPDK+++++ +EE++ +F ++  +YE+L+
Sbjct: 14 YATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT 68

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLRE---ESEMKFKEITAAYEILSDE 61
           Y +LGVA  A+  E++ AYRKL+++ HPDK+A ++ +E   E E ++  IT AY+ L+DE
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 62  DSRKKY 67
            +++ Y
Sbjct: 178 ITKENY 183

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           YE+L V   A+  EIKKAYRKLA++ HPDK       E     FK I  A+E+LSD + 
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASE----AFKIINRAFEVLSDVEK 78

Query: 64 RKKYD 68
          R+ YD
Sbjct: 79 RQLYD 83

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           YE+L V   +++ EIKKAYRKLA++ HPDK       E     FK I  A+E+LSD + 
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASE----AFKIINRAFEVLSDNEK 77

Query: 64 RKKYD 68
          R+ +D
Sbjct: 78 RRIFD 82

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKV----ADEVLREESEMKFKEITAAYEILSD 60
          YEVLGV  DAS  EIK  YRK+ L  HPDK      D  ++  S +   +I  AY +LS+
Sbjct: 12 YEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLSN 71

Query: 61 EDSRKKYD 68
          +  R  Y+
Sbjct: 72 DQLRAAYN 79

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           YE+L V   AS  +IKKAYRK+A++ HPDK       E     FK++  A+E+LSDE  
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAE----AFKKVNRAFEVLSDEKK 80

Query: 64 RKKYD 68
          R+ YD
Sbjct: 81 RRVYD 85

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVA---DEVLREESEMKFKEITAAYEILSDE 61
           YE+LGV   ++  EIK AYRKL+++ HPDK++   +E+ R   E +F  I  AY+ L+DE
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDE 172

Query: 62  DSRKKYDVY 70
            +++ Y  Y
Sbjct: 173 ITKENYRKY 181

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 44/67 (65%), Gaps = 2/67 (2%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKV-ADEVLREES-EMKFKEITAAYEILSDED 62
           Y+ LGV P A+  EI+KAY  L  ++HPDK+ A+   ++ES      +I  AYE LSD++
Sbjct: 540 YKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSDDN 599

Query: 63  SRKKYDV 69
            RK+YD+
Sbjct: 600 KRKEYDL 606

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          YE+L V   AS  ++KKAYR+ ALQ+HPDK  + + +E +++ F  I  AYEILSD   R
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNINNI-KEATDI-FANIRTAYEILSDPQER 63

Query: 65 KKYDVY 70
            YD +
Sbjct: 64 VWYDSH 69

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (65%), Gaps = 5/70 (7%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMK----FKEITAAYEILSD 60
           YE+LGV   +++ EIKKAYR L+L+ HPDK+ D  L E+  +     F +I+ AYE L++
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDKL-DRNLSEKERLSMEEIFVQISKAYEALTN 181

Query: 61  EDSRKKYDVY 70
             +++ Y +Y
Sbjct: 182 PATKENYLLY 191

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDK---VADEVLREESEMKFKEITAAYEILSDE 61
           Y++LGV   A+  +++++Y +L  + HPDK   + DE  R+++E K  EI  AYEILSD+
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQ-RQKNEEKMAEINEAYEILSDD 588

Query: 62  DSRKKYD 68
           D R KYD
Sbjct: 589 DKRTKYD 595

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 3  KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
          + Y++L V   A+  EIKKAYRKLA++ HPDK       E     FK I  A+E+LS+E+
Sbjct: 21 EFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASE----AFKIINRAFEVLSNEE 76

Query: 63 SRKKYD 68
           R  YD
Sbjct: 77 KRGLYD 82

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           Y++L V   A   EIKK+YRKLA++ HPDK       E     FK I  A+E+LSD++ 
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGE----AFKVINRAFEVLSDDEK 80

Query: 64 RKKYD 68
          R  +D
Sbjct: 81 RSVFD 85

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVA--DEVLREESEMKFKEITAAYEILSDED 62
           Y+VL V P A+  +I+K+Y  +  ++HPDK     E  + +++ +  EI  AYEILSDE 
Sbjct: 505 YKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEG 564

Query: 63  SRKKYD 68
            RK+YD
Sbjct: 565 KRKEYD 570

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVA--DEVLREESEMKFKEITAAYEILSDED 62
           Y+VLGV   A+  +I+K+Y  +  ++HPDK     E  + +++ K  EI  AYEILSDE 
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 63  SRKKYD 68
            RK+YD
Sbjct: 567 KRKEYD 572

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 1  MTKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSD 60
          M   YEVL V  DAS  EIK+AYR   L  HPDK  DE  +    +    I  AY +LSD
Sbjct: 1  MLTHYEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDEN-KPALNVSVNAIQEAYRVLSD 59

Query: 61 EDSRKKYD 68
          E  R++YD
Sbjct: 60 EKLRREYD 67

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEM--KFKEITAAYEILSDED 62
           Y+VLG++  AS  EI+KAY  L  ++HPDK      +E+ ++  K  ++  AYEILSDE 
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSDEG 583

Query: 63  SRKKYD 68
            ++ YD
Sbjct: 584 KKRDYD 589

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVA--DEVLREESEMKFKEITAAYEILSDED 62
           Y++LGVA ++    I+KAY  L  ++HPDK     +  +E++  K  EI  AYEIL DE 
Sbjct: 556 YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGDES 615

Query: 63  SRKKYD 68
            +K+YD
Sbjct: 616 KKKEYD 621

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           Y VL V   + +TEIKK+YRKLA++ HPDK       E     FK I  A+E+LSD + 
Sbjct: 23 FYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASE----AFKVINRAFEVLSDNEK 78

Query: 64 RKKYD 68
          R+ +D
Sbjct: 79 REIFD 83

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREES---EMKFKEITAAYEILSDE 61
           YE+LG+   A++ E++ +YRKL+++ HPDK++ ++ +EE    E ++  IT AY+ L++E
Sbjct: 117 YELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALTEE 176

Query: 62  DSRKKYDVY 70
            +R+ Y  Y
Sbjct: 177 VTRENYLKY 185

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           Y++L V   +S  +IKKAYRKLA++ HPDK       E     FK I  A+E+LSD   
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHE----AFKLINRAFEVLSDSQK 77

Query: 64 RKKYD 68
          R+ YD
Sbjct: 78 RQIYD 82

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 117/285 (41%), Gaps = 59/285 (20%)

Query: 136 NGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKERIKRVAQGFVIRE 195
           +G   K    R+V C  C G+G +   +   +    CQ+C+G           +G  I++
Sbjct: 204 DGSGLKAGHSRSV-CPTCHGTGTQVHVRAGFQMASTCQTCDG-----------EGSTIKD 251

Query: 196 TVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSRNGDIVKLEGEAD-- 253
           + KC  C+  G                   ++  KT+TV +P G ++GD +++  +    
Sbjct: 252 SDKCGTCHSHGFK-----------------LNSNKTITVDLPHGLQDGDTIRVPNQGSYP 294

Query: 254 ---------QEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVT 304
                     E     GDLL  +    +T   +    D ++T+     + A+ G  +V  
Sbjct: 295 GMAIDPSMKSELHLTRGDLLIRVRVRKDTRFQVSNNYDIIYTQEIPITTAALGGVIEV-- 352

Query: 305 TTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYV--QVHIEFPPDN--- 359
            T+++  ++LK+  G   +    IR+ N+G P    G++ GDM V  ++ I+ P D    
Sbjct: 353 PTVEEEKIRLKVSSG--TQHDQVIRIPNKGVPRGARGDR-GDMLVKFKIVIKKPKDETER 409

Query: 360 --WFSEK---SDVEVLRTLLPEVPNAR----VADTGDLNNTETVI 395
             W +     +D    RT+ P   +A+     AD   + N E  I
Sbjct: 410 YLWETLAHLTNDTTARRTITPSGSSAKDNSSSADKDTVENNEGTI 454

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 49/66 (74%), Gaps = 4/66 (6%)

Query: 5  YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64
          Y+VLG+  ++SQ++IKKAY KLA ++HPD   +    E+S+ KF ++  AYEILSDED R
Sbjct: 27 YKVLGINKNSSQSDIKKAYYKLAKKYHPDINKE----EDSQKKFHDLQNAYEILSDEDKR 82

Query: 65 KKYDVY 70
          K+YD +
Sbjct: 83 KQYDQF 88

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y VLG+  DA+  +I+K+Y KLA + HPDK   EV  E     FK +  A+ IL+D 
Sbjct: 11 TTYYSVLGLPFDATDAQIRKSYMKLARELHPDKSKSEVAAE----LFKVVAHAHSILTDR 66

Query: 62 DSRKKYD 68
          + R KYD
Sbjct: 67 EKRLKYD 73

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y +LG+  +A+ +E+ K+Y KLA   HPDK       ++SE  FK +  A+ IL+DE
Sbjct: 12 TTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKS----DKSEELFKAVVHAHSILTDE 67

Query: 62 DSRKKYD 68
          D + +YD
Sbjct: 68 DQKLRYD 74

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 4/67 (5%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y  LG++ +A++ EI K+Y  LA Q HPDK   E   E+    FK I+ A+ +L DE
Sbjct: 12 TTYYSTLGLSSNANEAEIHKSYMMLARQLHPDKSKSEASAEQ----FKLISHAHSVLMDE 67

Query: 62 DSRKKYD 68
            R KYD
Sbjct: 68 AKRLKYD 74

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 3  KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62
          + YE+L V   A+  EIKK+YRKLA++ HPDK       E     FK I  A+E+L D +
Sbjct: 22 QFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASE----AFKLINRAFEVLGDSE 77

Query: 63 SRKKYD 68
           R  YD
Sbjct: 78 KRSLYD 83

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVA--DEVLREESEMKFKEITAAYEILSDED 62
           Y++LGV  ++   EI+K+Y  L  ++HPDK     E  +E +  K ++I  AYE LSDE 
Sbjct: 606 YKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYECLSDES 665

Query: 63  SRKKYDV 69
            RK+YD+
Sbjct: 666 KRKEYDL 672

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEM--KFKEITAAYEILSDED 62
           Y++L V+ DA   +I+K+Y  L  + HPDK      +E+ ++  K  EI  AYE+LSDE 
Sbjct: 529 YKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSDET 588

Query: 63  SRKKYDV 69
            R +YD+
Sbjct: 589 KRNEYDL 595

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T+ Y++L +   A+  EIKKAYRK +++ HPDK  ++    E   +F+ I+ AY++LSD+
Sbjct: 5  TEYYDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATE---RFQAISEAYQVLSDK 61

Query: 62 DSRKKYDVY 70
          + R  YD +
Sbjct: 62 NLRANYDKF 70

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREE--SEMKFKEITAAYEILSDED 62
           Y++L V  +A+  +I+KAY +L  ++HPDK       E+  +E K   I  AYEILSDE 
Sbjct: 509 YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSDES 568

Query: 63  SRKKYDV 69
            RK+YD+
Sbjct: 569 KRKEYDL 575

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 4  LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63
           Y++L V   A   EIKK+YRKLA++ HPDK       E     FK I  A+E+L DE  
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASE----AFKRINRAFEVLGDEKK 80

Query: 64 RKKYD 68
          R  +D
Sbjct: 81 RVLFD 85

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVA--DEVLREESEMKFKEITAAYEILSDED 62
           Y++LG++ +A+  +I+KAY +L  ++HPDK     E  ++++  K  EI  AYE LSDE 
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSDEA 620

Query: 63  SRKKYD 68
            + +YD
Sbjct: 621 KKSEYD 626

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y++LGV P A   +  KAYR  A+Q HPD          +  KF+E++ AY++LSD 
Sbjct: 5  TTYYDILGVTPSAFAEQNNKAYRMKAIQTHPDM---NPTHPYAHAKFQEVSKAYKVLSDP 61

Query: 62 DSRKKYDVY 70
          D + +Y  +
Sbjct: 62 DLKNRYTEF 70

>Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa]
          {ON} YJL162C (REAL)
          Length = 560

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y +LG+A +A+ +E+ K+Y KLA   HPDK       ++ E  FK +  A+ IL+DE
Sbjct: 12 TTYYSILGLASNATSSEVHKSYLKLARLLHPDKTKS----DKCEELFKAVVHAHSILTDE 67

Query: 62 DSRKKYD 68
          + + +YD
Sbjct: 68 NQKLRYD 74

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y +LG+ P+A+  EI+K+Y  LA + HPDK   E   E     FK +  A+ IL+D 
Sbjct: 12 TTHYSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGE----LFKLVVHAHSILTDV 67

Query: 62 DSRKKYDV 69
          + ++ YD 
Sbjct: 68 EKKRAYDA 75

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa]
          {ON} weakly similar to uniprot|P46997 Saccharomyces
          cerevisiae YJL162C JJJ2 Protein that may function as a
          cochaperone as suggested by the presence of a DnaJ-like
          domain
          Length = 590

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61
          T  Y VLG+  DAS+++IKKAYR++A+  HPDK         +EM FK ++ A  +L D+
Sbjct: 11 TTHYSVLGLKSDASESQIKKAYRRIAMAIHPDKNKSA---SAAEM-FKLVSHAQSVLIDK 66

Query: 62 DSRKKYD 68
          + R+ Y+
Sbjct: 67 ELRRTYN 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,463,996
Number of extensions: 2033907
Number of successful extensions: 6741
Number of sequences better than 10.0: 389
Number of HSP's gapped: 6170
Number of HSP's successfully gapped: 456
Length of query: 435
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 322
Effective length of database: 40,524,141
Effective search space: 13048773402
Effective search space used: 13048773402
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)