Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16962g8.265ON33633615080.0
Suva_2.2738.265ON3763963335e-35
KLTH0G13618g8.265ON3023463242e-34
Kwal_56.237818.265ON2933403191e-33
YDR113C (PDS1)8.265ON3733903124e-32
Smik_4.3588.265ON3713963072e-31
TDEL0F039208.265ON3223612632e-25
Skud_4.3748.265ON3733442601e-24
Ecym_43058.265ON3112612235e-20
AGR083W8.265ON2952582173e-19
Kpol_543.418.265ON3063562121e-18
ZYRO0C01584g8.265ON2823542032e-17
KLLA0F19206g8.265ON2633291836e-15
NCAS0B038308.265ON3253601761e-13
CAGL0L12298g8.265ON2863291404e-09
TPHA0A017808.265ON3523621334e-08
KNAG0H032308.265ON2811501262e-07
NDAI0J013508.265ON4221351263e-07
TBLA0E044608.265ON277152850.031
KAFR0B055108.265ON27530760.42
KLLA0F17215g2.400ON20969740.58
YJR015W5.143ON51050741.2
Smik_10.2955.143ON51050712.4
Suva_12.100na 1ON42650703.2
Suva_12.1015.143ON29850693.2
Smik_12.1438.256ON122077703.7
Ecym_60662.400ON19289665.3
SAKL0E04752g2.400ON22065658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16962g
         (336 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...   585   0.0  
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...   132   5e-35
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...   129   2e-34
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...   127   1e-33
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...   124   4e-32
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...   122   2e-31
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...   105   2e-25
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...   104   1e-24
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    91   5e-20
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    88   3e-19
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    86   1e-18
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    83   2e-17
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    75   6e-15
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    72   1e-13
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    59   4e-09
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    56   4e-08
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    53   2e-07
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    53   3e-07
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    37   0.031
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    34   0.42 
KLLA0F17215g Chr6 (1576281..1576910) [630 bp, 209 aa] {ON} simil...    33   0.58 
YJR015W Chr10 (462721..464253) [1533 bp, 510 aa] {ON} Putative p...    33   1.2  
Smik_10.295 Chr10 (459708..461240) [1533 bp, 510 aa] {ON} YJR015...    32   2.4  
Suva_12.100 Chr12 (146211..146333,146358..146504,146519..147526)...    32   3.2  
Suva_12.101 Chr12 (146630..146791,146798..147532) [897 bp, 298 a...    31   3.2  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...    32   3.7  
Ecym_6066 Chr6 (124071..124649) [579 bp, 192 aa] {ON} similar to...    30   5.3  
SAKL0E04752g Chr5 complement(387164..387826) [663 bp, 220 aa] {O...    30   8.4  

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/336 (88%), Positives = 298/336 (88%)

Query: 1   MRTHENKENVIFSSENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNT 60
           MRTHENKENVIFSSENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNT
Sbjct: 1   MRTHENKENVIFSSENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNT 60

Query: 61  LINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYG 120
           LINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYG
Sbjct: 61  LINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYG 120

Query: 121 SVLGYNGLPRVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXXNNHNE 180
           SVLGYNGLPRVKSLVLKDVDERKVGKS                 NP         NNHNE
Sbjct: 121 SVLGYNGLPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNHNE 180

Query: 181 DDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESD 240
           DDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESD
Sbjct: 181 DDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESD 240

Query: 241 VIKLNTFTSPFSMHKXXXXXXXXXXXXGLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGL 300
           VIKLNTFTSPFSMHK            GLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGL
Sbjct: 241 VIKLNTFTSPFSMHKEDSDCEECDDYDGLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGL 300

Query: 301 ATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD 336
           ATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD
Sbjct: 301 ATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD 336

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score =  132 bits (333), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 129/396 (32%), Positives = 185/396 (46%), Gaps = 82/396 (20%)

Query: 1   MRTHENKENVIF------SSENLPTTPSHLLKRSQS-FMKP----------LASNS---- 39
           M  +E+KEN I       SS + P TP+HLLKRS S  +KP          + SNS    
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 40  ----------PTKK------SGKRLPLASKDNNKSNTLI------NNGQKSALV------ 71
                     PTK+         RLPLA+KDNN+S + +      N  + + +V      
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 72  -NLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSR-LKKYGSVLGYNGLP 129
            +   N+ L    ++ RNR    N G++           +L +SR L+KYGSVLGYN LP
Sbjct: 121 LSTRKNDQLRKLSQVSRNR----NRGNYNG---------MLNNSRKLQKYGSVLGYNALP 167

Query: 130 RVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXXNNHNEDDKEE--GS 187
           ++KSLVLKD+       +                              H+ +D+ E  G 
Sbjct: 168 KMKSLVLKDL----ADPAKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGG 223

Query: 188 IGLLGSNTGLQQLLKHRNVEEG-------ENSDFEIEIVPPHSEELPHVPNGYSPFKESD 240
           IGL  +  GLQQL+K  N  +G       +  D +IEI P   E LP+VP+GY PF++ D
Sbjct: 224 IGLFNNQGGLQQLIK--NTAKGKEGPGKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQED 281

Query: 241 VIKLNTFTSPFSMH-KXXXXXXXXXXXXGLLTISMVKSEDEEQDDDTNDRKRRKSWIDEG 299
           ++KL TF SP+ +  +            GLL++  V  ED E+D+ T+    ++   +  
Sbjct: 282 ILKLKTFNSPYGLDLEGNSNNTNSADKVGLLSLVEVNEED-EKDNTTHTIGDQQEPAELS 340

Query: 300 LATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLL 335
           LA  ++   D N     IE  YNGEGL+ E+LE LL
Sbjct: 341 LAL-QNSEDDDNAAMPLIESLYNGEGLDSEELEDLL 375

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score =  129 bits (324), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 114/346 (32%), Positives = 162/346 (46%), Gaps = 54/346 (15%)

Query: 1   MRTHENKENVIFSSENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNT 60
           M  HE+KEN I+S  N+P TP HLL RSQSFMK    N   K++  R PLASKDNN+S +
Sbjct: 1   MGRHEDKENSIWSESNVPVTPRHLLSRSQSFMK----NKSPKRAEARRPLASKDNNRSVS 56

Query: 61  LINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYG 120
            +  G K  L               KR RP V++ GSF+             ++RL    
Sbjct: 57  YL--GTKEPL--------------RKRTRPGVNHAGSFVG------------NARLGP-A 87

Query: 121 SVLGYNGLPRVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXXNNHNE 180
             L  +G P++KSLVLKD  E +  +S                                +
Sbjct: 88  PTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVDEDDDDDSNRLAAKLRTKLLS-----RD 142

Query: 181 DDKEEGSIGLLGSNTGLQQLLKHRNVEEGE--NSDFEIEIVPPHSEELPHVPNGYSPFKE 238
            D E    GLLG+  GLQ LL  +  +  E  +SD E+E++PP  E LPHVP GY+PF E
Sbjct: 143 RDAEGEQTGLLGATGGLQSLLGPKLSQRAEESDSDQEVEVIPPRPEPLPHVPEGYTPFGE 202

Query: 239 SDVIKLNTF-TSPFSMHKXXXXXXX---XXXXXGLLTISMVKSEDEEQDDDTNDRKR--- 291
            ++ KL     SPF ++                 L T++  + ++++ D D + RKR   
Sbjct: 203 QEIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQLFTLNFDRDDNDDTDADQSGRKRHHT 262

Query: 292 -RKSWIDEGLATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD 336
             ++ I   ++T +    D       +EP Y G GL  ++LESLL+
Sbjct: 263 PERTTIP--ISTGQRRKSDV----FELEPTYAGNGLTAKELESLLE 302

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score =  127 bits (319), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 113/340 (33%), Positives = 155/340 (45%), Gaps = 51/340 (15%)

Query: 1   MRTHENKENVIFSSENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNT 60
           M   ENKEN I+S  ++P TP+HLL RSQSFMK    N   K++ +R PLASKDNNKS  
Sbjct: 1   MGARENKENAIWSERSVPVTPTHLLSRSQSFMK----NISPKRAEQRKPLASKDNNKSTG 56

Query: 61  LINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYG 120
            +  G K  L               KR RP V++ GSFI  NT     P           
Sbjct: 57  FL--GAKEPL--------------RKRTRPTVNHAGSFIG-NTRPGVVP----------- 88

Query: 121 SVLGYNGLPRVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXXNNHNE 180
            +L  NG PR+KSLVLKD  E +  +S                 N          N  + 
Sbjct: 89  -ILNTNGAPRIKSLVLKDDIEEEQSQSDGGEAEDDES-------NSLAAKLRGKLNARDR 140

Query: 181 DDKEEGSIGLLGSNTGLQQLLKHRNVEE-GENSDFEIEIVPPHSEELPHVPNGYSPFKES 239
           DD  E    L  +           + E    +SD E+E++PP  E LPH+P+GY+PF + 
Sbjct: 141 DDSTEQGGLLGATGGLQGLANTKLHSETLDSDSDLEVEVIPPRPEPLPHIPHGYTPFTDE 200

Query: 240 DVIKL-NTFTSPFSMH-KXXXXXXXXXXXXGLLTISMVKSEDEEQDDDTNDRKRRKSWID 297
           D+ KL +T  SPF ++               L T+ +    D+   D  +DRKR  +   
Sbjct: 201 DIGKLQDTEASPFQLNFADDDDDASSQDSTQLFTLKL--DNDDNLGDQEHDRKRLHTPEK 258

Query: 298 EGL-ATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD 336
           +   A+      DF      ++P Y G GL+ ++LESLL+
Sbjct: 259 KPTRASIAQQAADFE-----LDPIYAGHGLSTKELESLLE 293

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score =  124 bits (312), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 124/390 (31%), Positives = 177/390 (45%), Gaps = 74/390 (18%)

Query: 1   MRTHENKENVIF------SSENLPTTPSHLLKRSQS-FMKP----------LASN----- 38
           M  +E+KEN I       S  N P TP+HLLKRS S  +KP            SN     
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 39  ---------SPTKK------SGKRLPLASKDNNKSNTLI-----NNGQKSALVNLAPNNS 78
                    SPTK+         RLPLA+KDNN+S + I     N  + + L  L    S
Sbjct: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLS 121

Query: 79  LLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSR-LKKYGSVLGYNGLPRVKSLVLK 137
           +    +L R    +S + S  N N       LL +SR L+KYGSVLGYN LP++KSLVLK
Sbjct: 122 IRKNDQL-RKLSQISRSRSRANHND------LLSNSRKLQKYGSVLGYNALPKMKSLVLK 174

Query: 138 DVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXXNNHNEDDKEEGSIGLLGSNTGL 197
           D+ +   GK+                            ++ + +++  G +GL     GL
Sbjct: 175 DLADS--GKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGL 232

Query: 198 QQLLKH--------RNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESDVIKLNTFTS 249
           QQL+K+        +N +  +  D++IEI P   E LP+VP GYSPF++ D+ KL TF S
Sbjct: 233 QQLIKNSTKNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNS 292

Query: 250 PFSMHKXXXXXXXXXXXXGLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGLATARHGLFD 309
           P+ +               LL +  +  E E+ + +   R +     +EG A     L  
Sbjct: 293 PYKLD--LEDEDDTPDKVDLLPLEQIDEEGEKDETECITRNQ-----EEGAALP---LLS 342

Query: 310 FNKPELYIEPH----YNGEGLNKEDLESLL 335
            N  E+   P     Y+ EGL+ E+LE L+
Sbjct: 343 KNFKEVAAVPTMELVYSEEGLDPEELEDLV 372

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score =  122 bits (307), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 125/396 (31%), Positives = 181/396 (45%), Gaps = 87/396 (21%)

Query: 1   MRTHENKEN-VIFSSE-----NLPTTPSHLLKRSQS-FMKP----------LASN----- 38
           M  +E+KEN +++S       N P TP+HLLKRS S  +KP          + SN     
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 39  ---------SPTKK------SGKRLPLASKDNNKSNTLI---NNGQKSALVNLAP----- 75
                    SPTK+         RLPLA+KDNN++ + I    N  +S   ++ P     
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 76  -----NNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPR 130
                N+ L    ++ RNR  V+++    NT             +L+KYGSVLGYN LP+
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNT------------RKLQKYGSVLGYNALPK 168

Query: 131 VKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXXNNHNEDDKEE--GSI 188
           +KSLVLKD+    V                                 H+ DD+ E  G I
Sbjct: 169 MKSLVLKDL----VDPGKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDI 224

Query: 189 GLLGSNTGLQQLLKHRNVEE----GENSD-FEIEIVPPHSEELPHVPNGYSPFKESDVIK 243
           GL  +  GLQQL+K+    E     +N+D +EIEI P   + LP+VP+GYSPF++ D+ K
Sbjct: 225 GLFNNQGGLQQLIKNSVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQK 284

Query: 244 LNTFTSPFSMHKXXXXXXXXXXXXGLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGLATA 303
           L +F SP+ +               LL +  + +E+ EQD+  +    R    +EG    
Sbjct: 285 LKSFNSPYEL--DLEDDGGSTDKVDLLPLEAI-NEESEQDEIVHIAGDR----EEGTPLP 337

Query: 304 RHGLFDFNKPEL----YIEPHYNGEGLNKEDLESLL 335
              L   N  ++     IE   NGEGL+ E+LE L+
Sbjct: 338 ---LLSKNLRKITAIPTIESLCNGEGLDPEELEDLI 370

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score =  105 bits (263), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 156/361 (43%), Gaps = 67/361 (18%)

Query: 1   MRTHENKENVIF------SSENLPTTPSHLLKRSQSFM------------------KPLA 36
           M  +ENKEN +          + P TP+HLLKRSQS M                   P+ 
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60

Query: 37  SNSPTKKSGK-RLPLASKDNNKSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNT 95
             SP+++  + R PLASKDNN+S   +   QK         N  L   K KRN  VV   
Sbjct: 61  RASPSRRVQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRN--LSQSK-KRNANVVD-- 115

Query: 96  GSFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGKSXXXXXXXX 155
           G  + TN            RLKKYGSVLGYN LP++KSLVLKDVD+  VG+         
Sbjct: 116 GQLL-TNPR----------RLKKYGSVLGYNALPKMKSLVLKDVDQ--VGEQGEDENDDE 162

Query: 156 XXXXXXXXXNPXXXXXXXXXNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFE 215
                               N  +  D+E   +G L   +GL  L++    +E +  D E
Sbjct: 163 DEDHILRLK---------LHNAIDRSDEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDRE 213

Query: 216 IEIVPPHSEELPHVPNGYSPFKESDVIKLNTFTSPFSMHKXXXXXXXXXXXXGLLTISMV 275
           IE  P   E LP++P G+    + D  KL TF SP+ + +            G L +  +
Sbjct: 214 IEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPY-LIEDDYSDSDDDKQDGFLQLEEI 272

Query: 276 KSEDEEQDDDTNDRKRRKSWIDEGLAT-ARHGLFDFNKPELYIEPHYNGEGLNKEDLESL 334
            S     DD+  +R        E L    R  L  ++  E  I+P Y GEGL+  DL  L
Sbjct: 273 GSAG---DDENIER--------ENLTVKQREMLPQYDTFE--IQPSYCGEGLDASDLNDL 319

Query: 335 L 335
           L
Sbjct: 320 L 320

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score =  104 bits (260), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 152/344 (44%), Gaps = 82/344 (23%)

Query: 1   MRTHENKENVIF------SSENLPTTPSHLLKRSQS-FMKP----------LASN----- 38
           M  +E+KEN I       S  N P TP+HLLKRS S  +KP          L SN     
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 39  ---------SPTKK------SGKRLPLASKDNNKSNTLINNGQKSAL------------- 70
                    SPTK+         RLPLA+KDNN+S + +   + + L             
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 71  VNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPR 130
           +++  N+ L    ++ RNR   +N    +N +            +L+KYGSVLGYN LP+
Sbjct: 121 LSIRKNDQLRQLSQISRNR-TRANYNELLNNS-----------RKLQKYGSVLGYNALPK 168

Query: 131 VKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXXNNHNEDDKEE--GSI 188
           +KSLVLKD+     G +                              H+ DD+ E  G I
Sbjct: 169 MKSLVLKDL----AGPAKNQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDI 224

Query: 189 GLLGSNTGLQQLLKHRNVEEGENSD---------FEIEIVPPHSEELPHVPNGYSPFKES 239
           GL  +  GLQQL+K  N  +G+            +EIEI P   E LP+VP+GY  F+  
Sbjct: 225 GLFNNQGGLQQLIK--NTTKGKQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQRE 282

Query: 240 DVIKLNTFTSPFSMHKXXXXXXXXXXXXGLLTISMVKSEDEEQD 283
           D+ KL TF SP+ +              GLL++ ++  E+ EQD
Sbjct: 283 DIEKLRTFNSPYEL--DLEDHGDSVDRVGLLSLEVI-DEEAEQD 323

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 90.5 bits (223), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 91/261 (34%), Positives = 124/261 (47%), Gaps = 42/261 (16%)

Query: 1   MRTHENKENVIFSSEN----LPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNN 56
           M+ HE+KEN+   SE     +P TP H LKRS S +  L +NS       RLPLASKD N
Sbjct: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVH-LKNNS-------RLPLASKDRN 52

Query: 57  KSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRL 116
           +S +  N  Q+   +        +  G+ K  RP    + SF+           +PDS+L
Sbjct: 53  RSQSGFNLKQQ---LVQGHVGGGVMVGQNKSKRPA---SNSFVKN---------MPDSKL 97

Query: 117 KKYGSVLG--YNGLPRVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXX 174
           KKYGSVLG  Y  L + KSLVLKD  +                       NP        
Sbjct: 98  KKYGSVLGVNYPHLTKTKSLVLKDASD------GSQDNGEESDDYDDEEGNPLAAKLRSR 151

Query: 175 XNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFE----IEIVPPHSEELPHVP 230
             +  ED+ E+     L    GL++L+K   + E +N D E    IE  P    EL H+P
Sbjct: 152 LTSGVEDENEDDGSSGLLLGGGLKKLIK---LHESDNQDTEEVPQIETAPEKVPELEHIP 208

Query: 231 NGYSPFKESDVIKLNTFTSPF 251
           NGY  F++ +++KL T+TSPF
Sbjct: 209 NGYEQFEDEEIVKLATYTSPF 229

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 113/258 (43%), Gaps = 50/258 (19%)

Query: 1   MRTHENKENVIFSS---ENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNK 57
           M+ HE+KEN++ S+     +P TP H LKRS S +          ++  R+PLASKD N+
Sbjct: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNL--------AGRNSTRMPLASKDRNQ 52

Query: 58  SNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLK 117
           S  +   G K++    A           +  RP  S+    I  N        +PDS+LK
Sbjct: 53  SQGVF--GLKTSGAGGAGGAQA------QSKRPASSS----IAKN--------MPDSKLK 92

Query: 118 KYGSVL--GYNGLPRVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXX 175
           KYGSVL  GY  L + KSLVLKD  +                       NP         
Sbjct: 93  KYGSVLGVGYGSLAKAKSLVLKDTSD----------CESANEESEEEEGNPLAAKLKSRL 142

Query: 176 NNHNEDDKE-EGSIGLLGSNTGLQQLLKHRNVEEGENSDF-EIEIVPPHSEELPHVPNGY 233
            +  E   E +GS GLL     L QL      +E    D   +E  P    ELPHVPNGY
Sbjct: 143 CSAEEGGNEDDGSSGLL-LGEALSQLAAAGETQE----DVPPVEYAPEKLPELPHVPNGY 197

Query: 234 SPFKESDVIKLNTFTSPF 251
              K +D+ KL  + SPF
Sbjct: 198 ESLKSADLAKLAKYHSPF 215

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 151/356 (42%), Gaps = 77/356 (21%)

Query: 5   ENKENVIFSS---ENLPTTPSHLLKRSQSFMKP------LASNSPTKKSGKRLPLASKDN 55
           +NKEN IF     +++P TP++LLKR+ S +K          N       KRLPLASKDN
Sbjct: 3   QNKENNIFRHAMLKDMPQTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASKDN 62

Query: 56  NKSNTLINNGQKSALVNLAPNNSLLHGGKLK---RNRPVVSNTGSFINTNTSKSSFPLLP 112
           N+SN+ +NN   +   N+  NN+  +        + + +     S I          L  
Sbjct: 63  NRSNSFLNNSNVNLNFNINNNNNNNNNNINNNNIKKQHIFQQNKSGI----------LAD 112

Query: 113 DSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXX 172
           D +LKKYGSVLGYN LP+VKSLVLKD+ + +                             
Sbjct: 113 DRKLKKYGSVLGYNALPKVKSLVLKDISDNEDDDDDLLSLKLRDSMNKKSINT------- 165

Query: 173 XXXNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELP---HV 229
                    +K    IGLL S   LQQL++  N +  E        +   S   P   ++
Sbjct: 166 ---------NKSNSGIGLL-SGGNLQQLIRDANEDVRE--------IEHKSNAFPDKEYI 207

Query: 230 PNGYSPFKESDVIKLNTFTSPFSMHKXXXXXXXXXXXXGLLTISMVKSEDEEQDDDTNDR 289
           P+ + PF E+D+ KL TF SPF + +             LL  +   S+DE   +D    
Sbjct: 208 PDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEEDSSELLLLANT---SDDEGTHNDK--- 261

Query: 290 KRRKSWIDEGLATARHGLFDFNKPE---------LYIEPHYNGEGLNKEDLESLLD 336
                       T    L   NKP          L IEP Y GEGL+  DLE LLD
Sbjct: 262 -----------ITTNKNLSINNKPNSKDVIPADILDIEPSY-GEGLDSNDLEDLLD 305

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 102/354 (28%), Positives = 148/354 (41%), Gaps = 96/354 (27%)

Query: 2   RTHENKEN--VIFSSEN----LPTTPSHLLKRSQ-SFMKPLASNSPTKKS--------GK 46
           +  +NKEN  V+   EN    LP TP HLLKRSQ + +KP   N+P KKS         +
Sbjct: 4   KVQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP-EENTPVKKSRSVSPVRGQR 62

Query: 47  RLPLASKDNNKSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKS 106
           RLPLASKD+NKS+                       G +K+ +P +   G  +       
Sbjct: 63  RLPLASKDHNKSSA---------------------AGPVKKRQPTLQ--GELL------- 92

Query: 107 SFPLLPDSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNP 166
           S P     +L+KYGSVLGY  LPR KSLVLKD                          N 
Sbjct: 93  SNP----RKLQKYGSVLGYTDLPRTKSLVLKD---------------GDDEDDDEEEENS 133

Query: 167 XXXXXXXXXNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEEL 226
                     N  ED  E    GL     GL +L++        ++  +IE  P     L
Sbjct: 134 ELQKKLQDAMNRREDSNE----GL----GGLAKLVR--------DTKDDIEYAPHRLPPL 177

Query: 227 PHVPNGYSPFKESDVIKLNTFTSPFSMHKXXXXXXX-XXXXXGLLTISMVKSEDEEQDDD 285
            + P+G++ +++ D++KL          +             GLL +  ++S +E+ +++
Sbjct: 178 EYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNEPQENDDGLLPLMSIESNNEDSNEN 237

Query: 286 TNDRKRRKSWIDEGLATARHGLFDFNKPELY----IEPHYNGEGLNKEDLESLL 335
             D           +    H +  F K  ++    +E  YNGEGLN E+LE LL
Sbjct: 238 EADE----------ILPKNHRIHPFPKLRVFDEDQVENIYNGEGLNAEELEDLL 281

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 75.1 bits (183), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 87/329 (26%), Positives = 133/329 (40%), Gaps = 100/329 (30%)

Query: 20  TPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNTLINNGQKSALVNLAPNNSL 79
           TP + +KR+ S ++           G R PLASKDNN++ ++++    +AL         
Sbjct: 23  TPLNQMKRTDSLVR-----------GNRRPLASKDNNRTQSILSVKNNAALG-------- 63

Query: 80  LHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYGSVLGYNG-LPRVKSLVLKD 138
                 K + P+     SF+           +P+++LKKYGSVLG N  +PR KSLVLKD
Sbjct: 64  ------KSDHPLKRPASSFMKN---------MPENKLKKYGSVLGMNTFMPRTKSLVLKD 108

Query: 139 --VDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXXNNHNEDDKEEGSIGLLGSNTG 196
             ++E+   +                  N                         LG   G
Sbjct: 109 TELNEKNDDEDEEDEEDDLPIFPSGKSLN-------------------------LGFGNG 143

Query: 197 LQQLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESDVIKLNTFTSPFSMHKX 256
           L+ L++ +  E        IE  P   +ELP++PNGY PF +  + KL    SPF     
Sbjct: 144 LKALIREKEDE------LNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQ---- 193

Query: 257 XXXXXXXXXXXGLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGLATA------RHGL-FD 309
                          +  +  + EE+D +        +  DE L +       +H L  D
Sbjct: 194 ---------------VESITFDTEERDPEL----ISLAATDEDLVSPTRYNNHKHNLELD 234

Query: 310 FNKPELYIE--PHYNGEGLNKEDLESLLD 336
            +   + IE    YNG+GL+  +L SLLD
Sbjct: 235 SDNESITIELGEEYNGQGLDTLELNSLLD 263

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 94/360 (26%), Positives = 135/360 (37%), Gaps = 99/360 (27%)

Query: 3   THENKENVIFSSENLPTTPSHLL-KRSQS-FMKP--------LASNSPTKKS----GKRL 48
           T+E+  +    S  +P TP+HLL KRS S  +KP        L + SP ++       RL
Sbjct: 14  TYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNISPRRRQLLQLQNRL 73

Query: 49  PLASKDNNKSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSF 108
           PLA KDNN S+    + +K+ L N+                                   
Sbjct: 74  PLAKKDNNNSSF---SSRKNGLNNIK---------------------------------- 96

Query: 109 PLLPDSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXX 168
                 +LKKYGSVLG + LPR KSL+LKDVD++                          
Sbjct: 97  ------KLKKYGSVLGMDALPRTKSLILKDVDDKPDDDEEDEDDNAFGLKLRNAMKQHEN 150

Query: 169 XXXXXXXNN---------HNEDDKEEGSIGLLGSNTGLQQLLKH--------------RN 205
                             H+ +D  +  +G      GLQQL++               + 
Sbjct: 151 NSNEEENEGMSGLGIGLFHDNEDNSKSKLG------GLQQLIRENTKERSTSKIRSPLKT 204

Query: 206 VEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESDVIKLNTFTSPFSMHKXXXXXXXXXX 265
           + +  +SD EIE  P   E LP VP GY+PF   D+ KL TF S + +            
Sbjct: 205 IGQDTDSDREIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDADK 264

Query: 266 XXGLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGLATARHGLFDFNKPELYIEPHYNGEG 325
              L TI     ++ E + +    +RR +              D N   + + P YNGEG
Sbjct: 265 LLALETIETSVDDEAEWEHEVRHHRRRPTR-------------DSNDDSIDLVPLYNGEG 311

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 86/329 (26%), Positives = 122/329 (37%), Gaps = 69/329 (20%)

Query: 6   NKENVIFSS--ENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNTLIN 63
           +KEN +  +  E  P TP+ LLKR++S + P       KK+G+R PLASKD N       
Sbjct: 7   DKENNVVGTLREKGPATPTQLLKRTRSTLLP-------KKNGQRQPLASKDKNY------ 53

Query: 64  NGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYGSVL 123
           N   S L       SL      K+ +P V+  GS  N                       
Sbjct: 54  NRSSSYL-------SLKRNSNQKKLKPAVTRAGSTAN----------------------- 83

Query: 124 GYNGLPRVKSLVLKDVDERKVGKSXXXXXXXXXXXXXXXXXNPXXXXXXXXXNNHNEDDK 183
             N   RV SL+LKD+                         NP          +      
Sbjct: 84  --NANRRVTSLILKDI-----ASGDEKESASESDSEDDEESNPLALKIKQALTHSIA--S 134

Query: 184 EEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESDVIK 243
            EG  GLL   +GL+++   R++      D EIE+      E P+ P GY P  +SD+ K
Sbjct: 135 AEGKTGLLNGKSGLRKIFNDRDL------DREIEVASVREPEKPYEPEGYEPLDDSDLEK 188

Query: 244 L---NTFTSP-FSMHKXXXXXXXXXXXXGLLTISMVKSEDEE---QDDDTNDRKRRKSWI 296
           L   N    P F M               LL + + +S+ EE    D +T D    ++  
Sbjct: 189 LKLKNAINRPTFIMDSPRAISIVGDDSPQLLPLDLEESKLEEGVLNDKNTTDEVITRANT 248

Query: 297 DEGLATARHGLFDFNKPELYIEPHYNGEG 325
               A     + D +  E  I+  Y+G G
Sbjct: 249 QAKNANITESIDDCSSVE--IDSIYDGRG 275

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 97/362 (26%), Positives = 143/362 (39%), Gaps = 78/362 (21%)

Query: 12  FSSENLPTTP-SHLLKRSQSFMKPLASNSPTKKSGK---------RLPLASKDNN---KS 58
            S+  +P TP   LLKR+ S     A     ++S +         RLPLASKDNN   +S
Sbjct: 31  ISNRTVPQTPMDKLLKRTHSKTLSTAVFKDAQQSKENNNNNIKLNRLPLASKDNNNSRRS 90

Query: 59  NTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKK 118
           N+ I                      L+ N+ V++   S +N N + +        +L+K
Sbjct: 91  NSFI----------------------LQNNKLVLNKQLSLLNNNQTSN--------KLRK 120

Query: 119 YGSVLGYNGLPR--------VKSLVLKDV------DERKVGKSXXXXXXXXXXXXXXXXX 164
           YGS+LG N            VKSL+LKD+      ++                       
Sbjct: 121 YGSILGVNNNGNNTNKTLNPVKSLILKDIPDNGNENDDDDDDDDDNIITLNLKNALQSKK 180

Query: 165 NPXXXXXXXXXNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSE 224
            P          N   D +EE  IGL G   GLQ+L+      + +     I  +   S 
Sbjct: 181 EPLLNQLKNAKKNSYSDSEEE-EIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSA 239

Query: 225 ELP---HVPNGYSPFKESDVIKLNTFTSPFS---MHKXXXXXXXXXXXXGLLTISMVKSE 278
             P   + P GY PF   D+ KLNTF SP+S   ++             GLL +  V S 
Sbjct: 240 AYPDLSYSPEGYIPFNNEDIKKLNTFKSPYSNLNVNDSLLADHNNNNNSGLLELENVGSS 299

Query: 279 DEEQDDDTNDRKRRKSWIDEGLATAR----HGLFDFNKPELYIEPHYNGEGLNKEDLESL 334
           D++     ++     S I +G  + +        DF      I+P YN +GL+  +LE+L
Sbjct: 300 DDD----DDNNLLNISNIQDGRGSRQTNDNETFIDFE-----IQPSYN-DGLDANELENL 349

Query: 335 LD 336
           LD
Sbjct: 350 LD 351

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 71/150 (47%), Gaps = 51/150 (34%)

Query: 1   MRTHENKENVIFSSENLPTTP-SHLLKRSQSFMKPLASN---------SPTKKSGKRLPL 50
           M+ +E+KEN +     +P TP S++L  S   +KP+ S          SPT+  G RLPL
Sbjct: 1   MQDNEDKENAVA----VPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTR--GGRLPL 54

Query: 51  ASKDNNKSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPL 110
           ASKDNN S  +++                   GKL R              N+S+     
Sbjct: 55  ASKDNNASGLVVS-------------------GKLGRQ-----PADQVREANSSR----- 85

Query: 111 LPDSRLKKYGSVLGYNG--LPRVKSLVLKD 138
               +LK+YGS+LGY+   L R KSL+LKD
Sbjct: 86  ----KLKRYGSLLGYDNRQLTRSKSLILKD 111

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 204 RNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESDVIKLNTFT 248
           R V + +N   E+EI P   +ELP++P+G+    E+D+ KL  + 
Sbjct: 161 RLVRQSQNR--ELEIRPQAQDELPYIPDGHIILHEADIAKLRDYA 203

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 63/135 (46%), Gaps = 30/135 (22%)

Query: 17  LPTTPSHLLKRSQSFMKPLASNSPTKKSGK-RLPLASKDNNKSNTLINNGQKSALVNLAP 75
            P TP+HLLKRS S    L+   P  K G   L L S          + G  +   N++P
Sbjct: 37  FPQTPAHLLKRSSSI---LSKQKPDIKPGNLELQLQS----------DAGAGAVPPNISP 83

Query: 76  NNSLLHGGKLKRNRPVV--SNTGSFINTNTSKSSFPLLPDSRLKKYGSVLG-------YN 126
              LL   +L+   P+    N  SFI     K         RLKKYGSVLG       +N
Sbjct: 84  RRQLL---QLQNRFPLSKKDNNNSFI----LKQQQQQFDHKRLKKYGSVLGLGTDGNNHN 136

Query: 127 GLPRVKSLVLKDVDE 141
            L R+KSLVLKD+D+
Sbjct: 137 NLTRIKSLVLKDIDD 151

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 215 EIEIVPPHSEELPHVPNGYSPFKESDVIKLNTFTSPFSMH 254
           +IE  P   + LP++P GY+PF   D+ KL  + SPF++H
Sbjct: 275 DIEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIH 314

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 68/152 (44%), Gaps = 43/152 (28%)

Query: 6   NKENVIFSSENLPTTPSHLLKRSQS------------FMKPLASNSPTKKSG--KRLPLA 51
           NKEN IF++   P TPS  LKR  S             +K   ++ P+  SG   R PLA
Sbjct: 4   NKEN-IFTA---PRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARRPLA 59

Query: 52  SKDNNKSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLL 111
           SKD N   T +  GQ  +                       +N+ +    N  K+   +L
Sbjct: 60  SKDKNVRRTAL--GQVKS-------------------SISSNNSNTNSTNNNDKNKNNML 98

Query: 112 PDSRLKKYGSVLGYNGLP----RVKSLVLKDV 139
           P +RLKKYGSVLGY+         K+L+LKD+
Sbjct: 99  PMNRLKKYGSVLGYSNNTINSNASKTLILKDI 130

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 5/30 (16%)

Query: 114 SRLKKYGSVLGYNG-----LPRVKSLVLKD 138
           +R+KKYGS+LG        LP+ KSL+LKD
Sbjct: 70  TRIKKYGSILGLENPGNFKLPKTKSLILKD 99

>KLLA0F17215g Chr6 (1576281..1576910) [630 bp, 209 aa] {ON} similar
           to uniprot|P40206 Saccharomyces cerevisiae YMR132C JLP2
           Hypothetical ORF
          Length = 209

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 16  NLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNTLINNGQKSALVNLAP 75
            + +TP H L++S  +MKP   +  + K+ +++   ++DN    T++N  QK+ +  +  
Sbjct: 93  TILSTPWHNLRKS-GYMKPGEVSYKSTKAVRKMDCFARDN----TILNRLQKTRIEIIDE 147

Query: 76  NNSLLHGGK 84
             SLLH  K
Sbjct: 148 IESLLHEAK 156

>YJR015W Chr10 (462721..464253) [1533 bp, 510 aa] {ON} Putative
           protein of unknown function; localizes to the
           endoplasmic reticulum and cytoplasm; predicted to encode
           a membrane transporter based on phylogenetic analysis;
           YJR015W is a non-essential gene
          Length = 510

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%)

Query: 97  SFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGK 146
           SF+  N + S FPL  ++ + +YG ++  + +  +  ++  DV  RK+G+
Sbjct: 423 SFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGR 472

>Smik_10.295 Chr10 (459708..461240) [1533 bp, 510 aa] {ON} YJR015W
           (REAL)
          Length = 510

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 28/50 (56%)

Query: 97  SFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGK 146
           SF+  N + S FPL  ++ + +YG ++  +    +  ++  DV  RK+G+
Sbjct: 423 SFVILNIAPSFFPLALNNNVYRYGYMMPVHNAIDIYRVIFFDVSRRKMGR 472

>Suva_12.100 Chr12 (146211..146333,146358..146504,146519..147526)
           [1278 bp, 426 aa] {ON} YJR015W (REAL)
          Length = 426

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 28/50 (56%)

Query: 97  SFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGK 146
           SF+  N + S FPL  +S   +YG ++  + +  +  ++  D+ + K+G+
Sbjct: 339 SFVIINIAPSFFPLALNSNFYRYGYMMPVHNIIDIYRVIFFDLTKNKMGR 388

>Suva_12.101 Chr12 (146630..146791,146798..147532) [897 bp, 298 aa]
           {ON} YJR015W (REAL)
          Length = 298

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 28/50 (56%)

Query: 97  SFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGK 146
           SF+  N + S FPL  +S   +YG ++  + +  +  ++  D+ + K+G+
Sbjct: 210 SFVIINIAPSFFPLALNSNFYRYGYMMPVHNIIDIYRVIFFDLTKNKMGR 259

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa]
           {ON} YLR084C (REAL)
          Length = 1220

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%)

Query: 14  SENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNTLINNGQKSALVNL 73
           S N   T + +L  +   M  ++S S +        L +     + TL +N + SALVN 
Sbjct: 846 SWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVSALVNF 905

Query: 74  APNNSLLHGGKLKRNRP 90
             N+S+L GG  +  +P
Sbjct: 906 EKNSSILVGGDFQITKP 922

>Ecym_6066 Chr6 (124071..124649) [579 bp, 192 aa] {ON} similar to
           Ashbya gossypii ADR243C
          Length = 192

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 5   ENKENVIFSSENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNTLINN 64
           E+KE    S   +  TP H L+++  +MKP   +  + K+ K++    +DN   N L   
Sbjct: 82  ESKEGNKLSQCTIIGTPWHNLRKA-GYMKPGEVSFKSTKAVKKMECFGRDNQTLNKL--- 137

Query: 65  GQKSALVNLAPN-NSLLHGGKLKRNRPVV 92
             K + V +  N  +LLH  K  ++R  +
Sbjct: 138 --KKSRVEIVNNVETLLHEAKRSKDREYL 164

>SAKL0E04752g Chr5 complement(387164..387826) [663 bp, 220 aa] {ON}
           similar to uniprot|P40206 Saccharomyces cerevisiae
           YMR132C JLP2 Hypothetical ORF
          Length = 220

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 20  TPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNTLINNGQKSALVNLAPNNSL 79
           TP H LK+S  +MKP   +  + KS K+L    +DNN  N L  N  +  LV+      L
Sbjct: 97  TPWHNLKKS-GYMKPGEVSFKSMKSVKKLECYGRDNNVLNRL--NKTRIELVD--DTERL 151

Query: 80  LHGGK 84
           LH  K
Sbjct: 152 LHEAK 156

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.130    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,900,363
Number of extensions: 1825110
Number of successful extensions: 7883
Number of sequences better than 10.0: 146
Number of HSP's gapped: 8036
Number of HSP's successfully gapped: 156
Length of query: 336
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 226
Effective length of database: 40,868,139
Effective search space: 9236199414
Effective search space used: 9236199414
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)