Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16940g8.266ON30330316070.0
Kwal_56.237778.266ON2673016332e-81
KLTH0G13596g8.266ON2672935933e-75
TDEL0F039308.266ON2802915482e-68
ZYRO0C01562g8.266ON2772734282e-50
NDAI0B020108.266ON2813074083e-47
Ecym_43048.266ON2892883789e-43
KLLA0F19228g8.266ON3052933711e-41
NCAS0B050408.266ON2733043654e-41
Kpol_392.48.266ON2813003612e-40
AGR082C8.266ON2662643491e-38
Suva_10.1758.266ON2993012705e-27
YLR091W (GEP5)8.266ON2932652697e-27
KAFR0B027408.266ON2562772651e-26
Smik_12.1508.266ON2922392513e-24
Skud_12.1598.266ON2943032461e-23
KNAG0G020608.266ON2863192136e-19
TPHA0J007608.266ON2492371642e-12
KLTH0H16170gna 1ON61992721.6
KAFR0A034801.265ON66765721.6
TDEL0G041806.52ON821119703.0
NOTE: 1 genes in the same pillar as SAKL0H16940g were not hit in these BLAST results
LIST: CAGL0L12320g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16940g
         (303 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   623   0.0  
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   248   2e-81
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   233   3e-75
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   215   2e-68
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   169   2e-50
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   161   3e-47
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...   150   9e-43
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...   147   1e-41
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   145   4e-41
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...   143   2e-40
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...   139   1e-38
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...   108   5e-27
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   108   7e-27
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   106   1e-26
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...   101   3e-24
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    99   1e-23
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    87   6e-19
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    68   2e-12
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    32   1.6  
KAFR0A03480 Chr1 complement(712598..714601) [2004 bp, 667 aa] {O...    32   1.6  
TDEL0G04180 Chr7 complement(758601..760801,760886..761150) [2466...    32   3.0  

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 1   MNRVKTLLNFLECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVY 60
           MNRVKTLLNFLECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVY
Sbjct: 1   MNRVKTLLNFLECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVY 60

Query: 61  NTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLS 120
           NTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLS
Sbjct: 61  NTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLS 120

Query: 121 SMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEI 180
           SMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEI
Sbjct: 121 SMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEI 180

Query: 181 FQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEEN 240
           FQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEEN
Sbjct: 181 FQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEEN 240

Query: 241 PVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISKLSK 300
           PVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISKLSK
Sbjct: 241 PVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISKLSK 300

Query: 301 NIS 303
           NIS
Sbjct: 301 NIS 303

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  248 bits (633), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 135/301 (44%), Positives = 187/301 (62%), Gaps = 37/301 (12%)

Query: 1   MNRVKTLLNFLECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVY 60
           MNR    +  LE LPLD RTL L+E  ++   S     L ++   Y+A ++ K+LE I++
Sbjct: 1   MNRG---IQVLEKLPLDVRTLKLIEKRLERAESLRFLELARQ---YEAKKDYKTLENIIH 54

Query: 61  NTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLS 120
           +TYF W N  P HI+ FR++Y++LR+ WPYE HR +L M +P+  SIR +W+  N +VL+
Sbjct: 55  HTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLA 114

Query: 121 SMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEI 180
           +MR+    W R    E+L                              ++LE TL FHEI
Sbjct: 115 AMRYGSYGWNREGGGERL------------------------------TELERTLRFHEI 144

Query: 181 FQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEEN 240
           FQH++FL+R P+LCK  K L +PIVEIPMKPLGQ+I  VRI+NLFKRK A  W++LA +N
Sbjct: 145 FQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDN 204

Query: 241 PVLSLENEALLLDIIASPH-HSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISKLS 299
           P LS ENE+LL+DII SP       S+R +KRLYQRAC+ +YVI    ++GL+ + SK+ 
Sbjct: 205 PALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVIKPHPTLGLEIEESKIL 264

Query: 300 K 300
           K
Sbjct: 265 K 265

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  233 bits (593), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 182/293 (62%), Gaps = 34/293 (11%)

Query: 11  LECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVYNTYFHWNNTT 70
           LE LPLD RTL+LLE  +   S      L Q+   Y A+ +SKSLE IV+ TYFHW N  
Sbjct: 8   LEKLPLDIRTLELLERKLLKKSLPGFQELAQQ---YTADGSSKSLESIVHLTYFHWCNED 64

Query: 71  PLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLSSMRFERNPWC 130
             HI+KFR++Y +LR+HWPYE HR +LSM  P+  SIR +W+ N+ KVLS M +E+    
Sbjct: 65  APHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEK---- 120

Query: 131 RNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLKRN 190
                             Y    EE+          ++++L+ T+ FHE+FQH++FLK  
Sbjct: 121 ------------------YAHDTEERPS--------RLTELQRTVQFHEVFQHFLFLKSR 154

Query: 191 PKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEENPVLSLENEAL 250
           P LCK  K L +PIVEIPMKPLGQ+IP VR+RNLFKRK A  WK+LA ++P LS +NE  
Sbjct: 155 PHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELS 214

Query: 251 LLDIIASPHHSTSVSN-RKIKRLYQRACKHSYVICEDRSIGLDFQISKLSKNI 302
           L  II SP     VS+ R++KRLYQRAC+ +Y I +   +GL+ + SKL K +
Sbjct: 215 LAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTIEQHPVLGLEIKESKLLKRL 267

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  215 bits (548), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 171/291 (58%), Gaps = 46/291 (15%)

Query: 4   VKTLLNFLECLPLDTRTLDLLE--------GTVKLCSSALLDTLEQKLFDYQANENSKSL 55
           V+ LL  LE LPL ++TLDLL          TV +  + L+  LE    + Q     K+L
Sbjct: 6   VQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQ---RIKAL 62

Query: 56  EWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNN 115
           E I+Y+T+F W +  P+H++ F+ +Y D+  HWPYERHR +L+M  P   S+R+ W D++
Sbjct: 63  ESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSS 122

Query: 116 KKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTL 175
           K VLS   + +NPW  ++ L +                             K++ ++  L
Sbjct: 123 KTVLSMAEYSKNPWIEDNILSK-----------------------------KLTIIQRDL 153

Query: 176 LFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKL 235
           LFH +F HY+FLK NP+LC  G+ LPIPIVEIPM+PLG DI + RI+NLFK K A T+++
Sbjct: 154 LFHSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRI 213

Query: 236 LAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICED 286
           LA ENPVLS  +E +L +II      +  S+RK +RLYQ +CK +YV+  D
Sbjct: 214 LAIENPVLSRGSENILSEII------SDASSRKQRRLYQASCKRAYVMEYD 258

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  169 bits (428), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 146/273 (53%), Gaps = 37/273 (13%)

Query: 14  LPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVYNTYFHWNNTTPLH 73
           LPL   T  +LE   +  S   L  + Q + +++ + + K LE ++  T+F W+N  P  
Sbjct: 20  LPLHIETQKVLEFYCRNSSYKSL-LVAQDISEFEKHNDHKYLEALIQKTHFLWDNPLPPF 78

Query: 74  IQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLSSMRFERNPWCRND 133
           +++F+  + +L  HWPYE  R LLSMS P + S  ++W D  +  LS++RFE++ W   +
Sbjct: 79  LKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLRFEKHRWADEN 138

Query: 134 PLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLKRNPKL 193
            +E+L                              S  + T L H IF  Y FLK + +L
Sbjct: 139 IIERL------------------------------SPEQGTQLLHSIFHQYFFLKSHARL 168

Query: 194 CKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEENPVLSLENEALLLD 253
           C   +K+P+PIVEIP++P+G D+   RIRNLFKRK A  W LLA EN  LS  NE LL +
Sbjct: 169 CYNNRKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGE 228

Query: 254 IIASPHHSTSVSNRKIKRLYQRACKHSYVICED 286
           II      T    R ++RLYQRA + +YV+  +
Sbjct: 229 II------TKSETRSMRRLYQRASRRAYVVTNE 255

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  161 bits (408), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 109/307 (35%), Positives = 163/307 (53%), Gaps = 54/307 (17%)

Query: 4   VKTLLNFLECLPLDTRTLDLLE-----------GTVKLCSSALLDTLEQKLFDYQANENS 52
            KTLL+ L+ LPL + TL  LE            + K+    L+++ E+     Q+  ++
Sbjct: 9   TKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSN 68

Query: 53  KSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWN 112
           K+LE I+Y+TYF W N    H++ F++ Y  L   WP+  H  + S    ++ SI   WN
Sbjct: 69  KTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKIDS----KKNSIILTWN 124

Query: 113 --DNNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQ 170
              N+K +L  +            L  LN          Q+L  +K              
Sbjct: 125 KSSNSKNMLREL------------LSHLNY--------TQSLVPQKK------------- 151

Query: 171 LELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAA 230
            +  ++F +I+QHY+FL  NP LC  GK+LP PIVEIPM  +G DIP  RI NL + K A
Sbjct: 152 -DFQVIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIA 210

Query: 231 ATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIG 290
            TW  LA  NP+L+LENEA L +II   + S+++ +R++++LY+RAC +SYVI  +    
Sbjct: 211 RTWNYLAITNPILNLENEAQLDEII---NGSSAIKSRQLRKLYRRACSNSYVIKNEDDNN 267

Query: 291 LDFQISK 297
           ++FQ SK
Sbjct: 268 IEFQKSK 274

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score =  150 bits (378), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 157/288 (54%), Gaps = 23/288 (7%)

Query: 1   MNRVKTLLNFLECLPLDTRTLDLLE---GTVKLCSSALLDTLEQKLFDYQANENSKSLEW 57
           MNR   +L  +  LPL   T  ++    G+V       +D +E  +  Y  +     L  
Sbjct: 4   MNR--KVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEP-INRYLLSGEVSYLRR 60

Query: 58  IVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKK 117
           ++++ YF   N    H+++F +   +L+  WPYERH  LLS   P + S R++W+ NN K
Sbjct: 61  VIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAK 120

Query: 118 VLSSMRFERNPWCRN-DPLEQLNA-FNVNKILNYQALEEEKNRGSMLSTLPKISQLELTL 175
           VL  MR++R+ W R+ +P   L++ F        Q L  EK++ ++  T  +I+ L+L  
Sbjct: 121 VLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGET-ERIALLKL-- 177

Query: 176 LFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKL 235
               IF HY+F+K  P LC + K LPIPIVE+ M PLG+D+P VRI NLF++++ AT K 
Sbjct: 178 ----IFSHYLFVKSRPTLCGH-KNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKT 232

Query: 236 LAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVI 283
           L  + P LS E E+LL  II          +R + RLY+ +C  +Y +
Sbjct: 233 LLHDFPPLSREVESLLHSIIKE-------CDRSMGRLYKWSCNGAYTM 273

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score =  147 bits (371), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 147/293 (50%), Gaps = 26/293 (8%)

Query: 19  RTLDLLEGTVKLCSSAL--LDTLEQ--------KLFDYQANENSKSLEWIVYNTYFHWNN 68
           RT  L +G   +   A+  +DT  +        +L  +  N   K+LE +VY+ +FH  N
Sbjct: 7   RTSKLYKGLHSITKDAISKVDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSVHFHLLN 66

Query: 69  TTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLSSMRFERNP 128
             P H+   RQ  ++L + WPYE    +L M  P   S   +W+ NNK  L  + F R+ 
Sbjct: 67  DPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFLSFNRHK 126

Query: 129 WCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLK 188
           W R    +  N   +  I     L+      + ++ + ++   ++     +IF+HY FLK
Sbjct: 127 WLRPKNWQTPNEELIKDITGIDGLQ-----STQITEVLRLPAEKIKETLRQIFEHYYFLK 181

Query: 189 RNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEENPVLSLENE 248
            NPKLC   KKL  PIVEI MKP G DI  +RI NLFK+K      LL  +NPVL+ + E
Sbjct: 182 TNPKLCA-TKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAE 240

Query: 249 ALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISKLSKN 301
           ++L  I+  P       NR+ KRLY+     SY+  + +     F+IS+L++ 
Sbjct: 241 SILTSIVNDPD-----LNRRTKRLYKNVASRSYLFKDGK-----FEISELARG 283

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  145 bits (365), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 155/304 (50%), Gaps = 56/304 (18%)

Query: 6   TLLNFLECLPLDTRTLDLLEGTVKLCSSA---------LLDTL-EQKLFDYQANENS--K 53
           TLL  L  +PL  +TLDLLE  ++  +           LL  L + + ++ Q ++    K
Sbjct: 8   TLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDKRGIEK 67

Query: 54  SLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWND 113
            LE I YNTYF WNN  P H+Q F++N   LR +WP   HR + +    +R SI   W  
Sbjct: 68  VLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDT----KRDSIIVQWAK 123

Query: 114 NNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLEL 173
           +N                          N + +L          +G+M    P  S  EL
Sbjct: 124 SN--------------------------NGDALL----------KGTMNHIQPGASAEEL 147

Query: 174 TLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATW 233
            L+F +IFQHY+FL  N ++    K+L  P+V +PM  +G+ IP VR++NLF++K + T 
Sbjct: 148 -LMFKKIFQHYIFLTLNARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTA 206

Query: 234 KLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDF 293
             L   NPVL++EN   L +II + + +TS   R ++RLYQRA K+++VI  +    + F
Sbjct: 207 NALCALNPVLNVENHGFLDEIINADYENTS---RSLRRLYQRASKNAHVIAGESPESIQF 263

Query: 294 QISK 297
            I+K
Sbjct: 264 AIAK 267

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score =  143 bits (361), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/300 (30%), Positives = 159/300 (53%), Gaps = 43/300 (14%)

Query: 7   LLNFLECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANE-------NSKSLEWIV 59
           LL  LE LPL   TLD+LE  + +     ++     L +Y+ ++        S++LE IV
Sbjct: 15  LLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKINSKVENESRALEKIV 74

Query: 60  YNTYFHWNNTT-PLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKV 118
             T+  WNN   P H++KF+ +Y +L  HWPYE H D+L+M+ P   S+ ++  +N+ + 
Sbjct: 75  KKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCLNNDDRF 134

Query: 119 LSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFH 178
            +  +             Q+N    N +  Y+  +E++                   +++
Sbjct: 135 FNFYK------------SQINNKWFNSVDQYKLTDEQR-----------------VSIYN 165

Query: 179 EIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAE 238
           +IF+   FLKR+  + +  K + +PIVE+P+KP+G DIP  RI+NLF +K    WKLL+ 
Sbjct: 166 DIFKQIFFLKRHTTISEVNKNM-VPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKLLSL 224

Query: 239 ENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISKL 298
            +P +SL +E ++++I+       +  NR+I RLY+R+ K+SYV  +   I + ++ +  
Sbjct: 225 SSPAISLSHEKIIMNILED-----TKDNRRINRLYRRSLKNSYVFDDTNPIEITYRYASF 279

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score =  139 bits (349), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/264 (32%), Positives = 133/264 (50%), Gaps = 37/264 (14%)

Query: 39  LEQKLFDYQANENSKSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLS 98
           L + L D+      + L+ +V++ +F      P H++  R++  +L+  WPYERH  LL+
Sbjct: 40  LVEPLNDFLRKGGHQGLQRLVFHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLA 99

Query: 99  MSAPERVSIRHMWNDNNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNR 158
           +S     S+R +W D  ++VL  M++ R+ W R   + +  A         QA  EE   
Sbjct: 100 LSDVRSQSLRRLWEDGQEEVLQQMQYCRHHWLREGDVPERYALT-------QAQREE--- 149

Query: 159 GSMLSTLPKISQLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPL 218
                            + H +F  YMFLK+ P L    ++LPIP+VEI M PLG DIP 
Sbjct: 150 -----------------VLHRVFAQYMFLKQRPALWSV-RRLPIPVVEIGMTPLGFDIPD 191

Query: 219 VRIRNLFKRKAAATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACK 278
           VR+  LFK K  +  +LL  E+P L+   E  +L IIA          R ++R+Y RAC+
Sbjct: 192 VRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIA------ECPTRAMRRIYLRACR 245

Query: 279 HSYVICEDRSIGLDFQISKLSKNI 302
            +YV+  D  +   F++S+L   I
Sbjct: 246 RAYVLDADAQL---FRVSRLRHFI 266

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score =  108 bits (270), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 92/301 (30%), Positives = 131/301 (43%), Gaps = 43/301 (14%)

Query: 7   LLNFLECLPL--------DTRTLDL------LEGTVKLCSSALLDTLEQKLFDYQANENS 52
           LL F++ LPL         TR  D+       E  V L  S  +    Q+  D + +   
Sbjct: 9   LLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQDLRTS--L 66

Query: 53  KSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWN 112
           K+LE IVY T+F WNN  P H   F+++YH L  HWP+E HR L+     +   +  + +
Sbjct: 67  KALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLTS 126

Query: 113 DNN--KKVLSSMRFERNPWCRNDPLEQLNAFNV--NKILNYQALEEEKNRGSMLSTLPKI 168
             N  K   +++   +NPW R  P     + ++  N I    A   E+            
Sbjct: 127 KGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFTAER------------ 174

Query: 169 SQLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMK-PLGQDIPLVRIRNLFKR 227
                T L   +  HY FL  N  L    KK P P+V+IP++  LG+  P  +I  LF R
Sbjct: 175 -----TFLVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFAR 229

Query: 228 KAAATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDR 287
           + A  +  L  ENP LS  NE  L+ +            R+  RLY RAC  +Y I    
Sbjct: 230 QLAQIYTSLFVENPPLSTANELALMTVF-----DDGTLERRHTRLYMRACARAYTIANAD 284

Query: 288 S 288
           S
Sbjct: 285 S 285

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  108 bits (269), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 124/265 (46%), Gaps = 28/265 (10%)

Query: 25  EGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDL 84
           E  V L  S  L    Q+  D +A+   K+LE I+Y T+F WNN  P H   F+++YH L
Sbjct: 41  EIAVPLTKSLQLYEKAQRRQDLRAS--LKALESIIYQTHFQWNNPLPRHAHLFQKHYHFL 98

Query: 85  REHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLSSMRFERNPWCRNDPLEQLNAFNVN 144
             HWP+E HRDL+     + +++      NN K+ S+    R+ W + D    +  FNV 
Sbjct: 99  LTHWPFENHRDLV-----DSIAV------NNGKLNSTS--SRSVWLKAD---WITLFNVK 142

Query: 145 KILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPI 204
                      +  G+ L T       E   L + +  HY FL  N  L    KK P P 
Sbjct: 143 NPWVQTPPSLMRLSGTDLDTFTP----ERIFLINSLGNHYKFLIANSHLSYNHKKYPSPG 198

Query: 205 VEIPMK-PLGQDIPLVRIRNLFKRKAAATWKLLAEENPVLSLENEALLLDIIASPHHSTS 263
           V+IP++  LG+  P  +I  LF R+ +  +K L  ENP LS ENE  L  +         
Sbjct: 199 VQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSPENELALTAVFYD-----E 253

Query: 264 VSNRKIKRLYQRACKHSYVICEDRS 288
              R+++RLY RAC  +Y      S
Sbjct: 254 TVERRLRRLYMRACARAYTTTNADS 278

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  106 bits (265), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 85/277 (30%), Positives = 126/277 (45%), Gaps = 59/277 (21%)

Query: 7   LLNFLECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVYNTYFHW 66
           + N +E LPL  +TL  L+ T+K  + AL   L + +  Y+    SK LE I+Y  YF W
Sbjct: 20  ITNAIEGLPLHQKTLLQLQDTLKR-NDALAIPLLRDVVSYETTGKSKFLESIIYRLYFQW 78

Query: 67  NNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLSSMRFER 126
            N  P H++     Y  L+ +WP ERH    + + PE +S+                  R
Sbjct: 79  LNEVPSHLKPLLNQYEHLKSNWPIERHIKFKN-AEPEAISL------------------R 119

Query: 127 NPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMF 186
           N W RN                       K     LST   +           I  H+ +
Sbjct: 120 NAWMRN-----------------------KATAVDLSTSDGV--------IKPILNHFRY 148

Query: 187 LKRN-PKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEENPVLSL 245
           L+ N  +LCK  KK+ +PI+E+P+   G +IP  R+ NL K++ A   K L E+NP+LS 
Sbjct: 149 LRVNEDRLCK--KKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSP 206

Query: 246 ENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYV 282
           + E  L  II     + S + R +KR+Y R+C  +Y 
Sbjct: 207 KLEDTLHSII-----NDSKNTRALKRVYLRSCSRAYT 238

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score =  101 bits (251), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 112/239 (46%), Gaps = 30/239 (12%)

Query: 53  KSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWN 112
           K+LE I+Y T+F WNN  P H   F+++YH L  HWP+E HR L+   A  +  +  + +
Sbjct: 67  KALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPS 126

Query: 113 DNN--KKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQ 170
                K   +++   +NPW +  P  +    N+++  +  A   E+              
Sbjct: 127 KTTWLKADWATLFQVKNPWVQTPPTPK----NLSET-DLDAFTPER-------------- 167

Query: 171 LELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMK-PLGQDIPLVRIRNLFKRKA 229
                L + +   Y FL  N  L    KK P P V+IP++  LG+  P  +I  LF R+ 
Sbjct: 168 ---AFLVNSLGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQL 224

Query: 230 AATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRS 288
           A  +  L EENP LS  N+  L+ I      +    +R+ KRLY RAC  +Y I    S
Sbjct: 225 AYIYTSLFEENPPLSPANDIALMAIF-----NDKTMDRRFKRLYMRACARAYTITNADS 278

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 99.4 bits (246), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 133/303 (43%), Gaps = 40/303 (13%)

Query: 2   NRVK-TLLNFLECLPLD-------TRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENS- 52
           +R+K  LL F+E LPL        T TL  ++   K    A+  T   ++++        
Sbjct: 3   SRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQDL 62

Query: 53  ----KSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIR 108
               K+LE I++ T+F WNN  P H   F+++++ L  HWP+E HR L+         + 
Sbjct: 63  RTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLN 122

Query: 109 HMWNDNN--KKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLP 166
            M +     K   +++   +N W +  P     A++     N  A   E+          
Sbjct: 123 SMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGA--NLDAFTPER---------- 170

Query: 167 KISQLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMK-PLGQDIPLVRIRNLF 225
                  T L + +  HY FL  N  L    KK P P V+IP++  LG+     +I  LF
Sbjct: 171 -------TFLVNSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLF 223

Query: 226 KRKAAATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICE 285
            R+    +  L  ENP LS +NE  L+ +     H  S+ +R+ KRLY RAC  +Y    
Sbjct: 224 SRQLTQIYTSLFVENPPLSADNELALMAVF----HDDSL-DRRHKRLYMRACARAYTTVN 278

Query: 286 DRS 288
             S
Sbjct: 279 SDS 281

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 86.7 bits (213), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 130/319 (40%), Gaps = 60/319 (18%)

Query: 1   MNRVKT-LLNFLECLPLDTRTLDLLEGTVKLCSSA-----LLDTLEQKLFDYQANENS-- 52
           MN V+T LL  L  LPL + TL  L   V    S      + +TL Q   D  + +    
Sbjct: 1   MNTVRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETL-QNFHDVPSTKKHTQ 59

Query: 53  -KSLEWIVYNTYFHWNNT------TPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERV 105
            K L  ++   Y  W+N+       P H+  F Q++  L   WP E H  L   S     
Sbjct: 60  YKILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSL-KQSTKGHA 118

Query: 106 SIRHMWNDNNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTL 165
           +++H W  NNK  L  M F+              A   N                     
Sbjct: 119 TLKHAWVTNNKHALQ-MSFD--------------AAAAN--------------------- 142

Query: 166 PKISQLELTLLFHEIFQHYMFLKRNPKLCKYGK-KLPIPIVEIPMKPLGQDIPLVRIRNL 224
           P    +EL     +I  HY  L  N ++  +GK KL +P+ EIP+   G++IP  R  NL
Sbjct: 143 PTSGNIELRGSLRQILSHYQLLYNNMRM--FGKIKLQVPVAEIPLNVFGEEIPACRTANL 200

Query: 225 FKRKAAATWKLLAEENPVL-SLENEALLLDIIAS---PHHSTSVSNRKIKRLYQRACKHS 280
            +RK     ++L EE P L + E  A L  IIA       S + S R+++RLY+RA    
Sbjct: 201 LQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGC 260

Query: 281 YVICEDRSIGLDFQISKLS 299
           Y +      G +  +   +
Sbjct: 261 YTLASTAQEGQNGGVHSFA 279

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 110/237 (46%), Gaps = 26/237 (10%)

Query: 5   KTLLNFLECLPLDTRTLDLLEGTV--KLCSSALLDTLEQKLFDY-------QANENSKSL 55
           + +L+ L  LPL   TLDLL+  V  KL  ++ L  L   LFDY       Q     K L
Sbjct: 19  QIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIEL---LFDYNNAFINKQKPGQLKCL 75

Query: 56  EWIVYNTYFHWNNTTP--LHIQKFRQNYHDLREHWPYERHRDLLSMS--APERVSIRHMW 111
           + I++ T+  +NN+     H++ F+  Y+ L  +WPYERH  L + +   PE  ++ ++W
Sbjct: 76  QRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLW 135

Query: 112 NDNNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQL 171
           N+ N     ++ F  + + +    +  N +       +  L+E  N      +     + 
Sbjct: 136 NNCNS---DNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKE 192

Query: 172 ELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRK 228
               LF E+F+   ++           KL IPIV +P+  LG  IP  R+ N FK+K
Sbjct: 193 IEINLFGELFKQLHYINT-------INKLQIPIVILPLNALGLKIPKSRLYNKFKKK 242

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 105 VSIRHMWNDNNKKVLSSMRFERNPWCRN---DPLEQLNAFNVNKI-LNYQALEEEKNRGS 160
           V +  +W      +     F R+P+ R    D  EQ  AF+  +  L  Q L E   R +
Sbjct: 96  VKVGGVWRSYYSPLSDVALFARDPFLRGLNADLFEQETAFHETQFNLKTQDLTETDPRTN 155

Query: 161 MLSTLP--KISQLELTLLFHEIFQHYMFLKRN 190
           +   LP  ++     T+ + +++QHY F +++
Sbjct: 156 IKRLLPDNEVFMKSKTIFYTQLYQHYTFFQKD 187

>KAFR0A03480 Chr1 complement(712598..714601) [2004 bp, 667 aa] {ON}
           Anc_1.265 YJL101C
          Length = 667

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 170 QLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKA 229
           +++LT   +  + ++MFL     L  Y +K+P     IPM  + +++    +R++  RK 
Sbjct: 467 EVQLTDFENAAYSNFMFLVVESILESYNEKIPY----IPMSKVWENMSFAHMRDVIGRKI 522

Query: 230 AATWK 234
              WK
Sbjct: 523 KFNWK 527

>TDEL0G04180 Chr7 complement(758601..760801,760886..761150) [2466
           bp, 821 aa] {ON} Anc_6.52 YLR263W intron location unsure
          Length = 821

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 52/119 (43%), Gaps = 21/119 (17%)

Query: 117 KVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLL 176
           K + S   ER+P         +  F  N  ++ +    EKN+   +  +  I   ++++L
Sbjct: 496 KGVDSKTVERSPSL------MITKFETNVKISEKPTVVEKNKTPKIKAVNSIGAKDISIL 549

Query: 177 FHEIFQHYMFLKRNPKLCKYGKKLP-----IPIVEIPMKPLGQDIPLVRIRNLFKRKAA 230
                 + +F K +    K  K+        P++E+P     QD+P+ ++RNL K+ A 
Sbjct: 550 ------NTIFGKTDSSTLKRSKRQQRLKNYKPVIEVP----SQDVPVTKVRNLSKKVAV 598

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,849,613
Number of extensions: 1525594
Number of successful extensions: 4505
Number of sequences better than 10.0: 41
Number of HSP's gapped: 4612
Number of HSP's successfully gapped: 48
Length of query: 303
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 194
Effective length of database: 40,982,805
Effective search space: 7950664170
Effective search space used: 7950664170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)