Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16918g8.267ON1111114853e-64
Kwal_56.237768.267ON1301123372e-41
KLLA0F19250g8.267ON1161163083e-37
TDEL0F039408.267ON1101132798e-33
Ecym_43038.267ON1091122675e-31
AGR081C8.267ON1301082695e-31
KLTH0G13574g8.267ON1121122632e-30
ZYRO0C01540g8.267ON971112362e-26
TPHA0A017708.267ON104582362e-26
Suva_2.2748.267ON1051062302e-25
KAFR0B054908.267ON85562273e-25
CAGL0B01793g8.267ON98952232e-24
Kpol_543.428.267ON112552182e-23
Smik_4.3598.267ON105522172e-23
Skud_4.3758.267ON105522153e-23
NCAS0B038208.267ON115612155e-23
YDR115W8.267ON105522145e-23
NDAI0J013408.267ON141522081e-21
KNAG0H032208.267ON86491971e-20
TBLA0E044708.267ON94961972e-20
TPHA0J016803.53ON56227642.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16918g
         (111 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...   191   3e-64
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...   134   2e-41
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...   123   3e-37
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...   112   8e-33
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...   107   5e-31
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...   108   5e-31
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...   105   2e-30
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    96   2e-26
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    96   2e-26
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    93   2e-25
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    92   3e-25
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    91   2e-24
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    89   2e-23
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    88   2e-23
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    87   3e-23
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    87   5e-23
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    87   5e-23
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    85   1e-21
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    80   1e-20
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    80   2e-20
TPHA0J01680 Chr10 (388361..390049) [1689 bp, 562 aa] {ON}              29   2.3  

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score =  191 bits (485), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 98/111 (88%)

Query: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNHNNXXXXXXXXXXXXXIMNILLGL 60
           MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNHNN             IMNILLGL
Sbjct: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNHNNPLLSQSQSQQPSSIMNILLGL 60

Query: 61  TQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           TQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH
Sbjct: 61  TQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score =  134 bits (337), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 80/112 (71%), Gaps = 1/112 (0%)

Query: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNH-NNXXXXXXXXXXXXXIMNILLG 59
           MSFLS  LF FSARR+ TT SSFSPL     ++ V+  NN              ++ L G
Sbjct: 19  MSFLSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSIATGSSSSAMPSYLSSLFG 78

Query: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           LTQ+RWKSRGNTYQPSTLKRKRRVGFLAR K+KQ SKILK R+EKGRWYLTH
Sbjct: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score =  123 bits (308), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 82/116 (70%), Gaps = 5/116 (4%)

Query: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQ-----ALVNHNNXXXXXXXXXXXXXIMN 55
           MSF++++L  ++++RT T+FSSFSPLR+L+S+     A VN                I  
Sbjct: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60

Query: 56  ILLGLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           +L  LTQRRWKSRGNT+QPSTLKRKRRVGFLARA+++   +ILK RK KGRWYLT+
Sbjct: 61  MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score =  112 bits (279), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 78/113 (69%), Gaps = 5/113 (4%)

Query: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNHNNXXXXXXXXXXXXXIMNILL-- 58
           MSFL++     +ARRT T+ SSFSPLRSL +Q   N +               +++L   
Sbjct: 1   MSFLARKPLQLNARRTLTSLSSFSPLRSLFAQ---NKSQGLLGVPETHSPLSSISLLFPF 57

Query: 59  GLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           G+ QRRWKSRGNT+QPSTLKRKRR+GFLARA++K  S++L+ RK KGRWYLT+
Sbjct: 58  GIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score =  107 bits (267), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 74/112 (66%), Gaps = 4/112 (3%)

Query: 1   MSFLSKHLFHFSARRTFTTF-SSFSPLRSLNSQALVNHNNXXXXXXXXXXXXXIMNILLG 59
           M + S+ L  +  RR+  T  SSFSP++SL      +  N             +++++ G
Sbjct: 1   MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPS---VISLVFG 57

Query: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           L QRRWKSRGNT+QPSTLKRKRRVGFLARA++K   KILK RKEKGRWYLT+
Sbjct: 58  LNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score =  108 bits (269), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 4   LSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNHNNXXXXXXXXXXXXXIMNILLGLTQR 63
           + + +  +S+RRT  T    SP+R +     + +               ++++LLGLTQ+
Sbjct: 25  MYRSMLQWSSRRTIMTV--VSPVRKMAPVPQIQYGAIGAFTPAAAPKPSMLSMLLGLTQK 82

Query: 64  RWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           RWKSRGNTYQPSTLKRKRRVGFLARA+++    ILK R+EKGRWYLTH
Sbjct: 83  RWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score =  105 bits (263), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 77/112 (68%), Gaps = 1/112 (0%)

Query: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQALV-NHNNXXXXXXXXXXXXXIMNILLG 59
           MSF+   LF FSARR+ ++ SSFSPL +++ +  V                  + + L G
Sbjct: 1   MSFIYNRLFQFSARRSLSSLSSFSPLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFG 60

Query: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
            TQRRWKSRGNTYQPSTLKRKRRVGFLARAK+KQ  K+LK R+EKGRWYLTH
Sbjct: 61  FTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/111 (46%), Positives = 70/111 (63%), Gaps = 14/111 (12%)

Query: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNHNNXXXXXXXXXXXXXIMNILLGL 60
           M   ++++F   ARR+  T  +++P      Q L+  +               ++   G+
Sbjct: 1   MWSFARNIFQVGARRSLFTMGNWTPTTVSPLQRLLGPSP--------------LSSGFGM 46

Query: 61  TQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
            QRRWKSRGNT+QPSTLKRKRRVGFLARA++KQ SKIL+ RK KGRW+LTH
Sbjct: 47  GQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 1/58 (1%)

Query: 54  MNILLGLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           +N+ LGL QRRWKSRGNTYQPSTLKRKRR+GFLARA++KQ +KIL+ RK KGRWYLTH
Sbjct: 48  LNLDLGL-QRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 93.2 bits (230), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/106 (51%), Positives = 64/106 (60%), Gaps = 9/106 (8%)

Query: 8   LFHFSARRTFTTFSSFSPLRSLNSQA--LVNHNNXXXXXXXXXXXXXIMNILLGLTQRRW 65
           L+ F +RR F++ S  S L  L  Q   L+N +              I        QRRW
Sbjct: 7   LYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFI-------GQRRW 59

Query: 66  KSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           KSRGNTYQPSTLKRKR  GFLARAK+KQ SKILK RK KGRW+L+H
Sbjct: 60  KSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 92.0 bits (227), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 44/56 (78%), Positives = 49/56 (87%)

Query: 56  ILLGLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           IL    Q+RWKSRGNTYQPSTLKRKR+ GFL+RAK+KQ SKILK RKEKGRWYL+H
Sbjct: 30  ILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 90.5 bits (223), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 60/95 (63%), Gaps = 4/95 (4%)

Query: 21  SSFSPLRSLN---SQALVNHNNXXXXXXXXXXXXXIMNIL-LGLTQRRWKSRGNTYQPST 76
           SSF  LR +N      ++  N+               +IL L   QRRWKSRGNTYQPST
Sbjct: 4   SSFGVLRPMNLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPST 63

Query: 77  LKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           LKRKR+ GFLAR  NK+ +KI+K RKEKGRWYLTH
Sbjct: 64  LKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 88.6 bits (218), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 1/55 (1%)

Query: 57  LLGLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           LLGL QRRWKSRGNTYQPSTLKRKR+ GFLARA+++  SKIL+ RK KGRWYL+H
Sbjct: 59  LLGL-QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 88.2 bits (217), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 46/52 (88%)

Query: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           + QRRWKSRGNTYQPSTLKRKR  GFLARAK+KQ SKILK RK KGRW+L+H
Sbjct: 54  IDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 87.4 bits (215), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 46/52 (88%)

Query: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           + QRRWKSRGNTYQPSTLKRKR  GFLARAK+KQ SKILK RK KGRW+L+H
Sbjct: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 87.4 bits (215), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (81%), Gaps = 2/61 (3%)

Query: 53  IMNILL--GLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLT 110
           +M  LL  G+ QRRWKSRGNTYQPSTLKRKR+ GFLA+A++ Q  KILK R+ KGRWYLT
Sbjct: 55  MMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLT 114

Query: 111 H 111
           H
Sbjct: 115 H 115

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 87.0 bits (214), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 46/52 (88%)

Query: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           + QRRWKSRGNTYQPSTLKRKR  GFLARAK+KQ SKILK RK KGRW+L+H
Sbjct: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 84.7 bits (208), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%)

Query: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           + Q+RWKSRGNTYQPSTLKRKR+ GFL+R +++QASKILK RK KGRW+L+H
Sbjct: 90  INQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 80.5 bits (197), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 38/49 (77%), Positives = 42/49 (85%)

Query: 63  RRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           RRWKSRGNTYQPSTLKRKR+ GFLAR +    SK+LK RKEKGRWYL+H
Sbjct: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 80.5 bits (197), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 59/96 (61%), Gaps = 7/96 (7%)

Query: 16  TFTTFSSFSPLRSLNSQALVNHNNXXXXXXXXXXXXXIMNILLGLTQRRWKSRGNTYQPS 75
           + T  + FS   +LNS +L+N +                   L +  RRWKSRGNTYQPS
Sbjct: 6   SLTRIACFSKSTALNSMSLLNKSLLINNNIIGNNK-------LMIDSRRWKSRGNTYQPS 58

Query: 76  TLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111
           TLKRKR+ GFL+RAK+   +KILK RK KGRW+L+H
Sbjct: 59  TLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>TPHA0J01680 Chr10 (388361..390049) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 29.3 bits (64), Expect = 2.3,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 84  GFLARAKNKQASKILKSRKEKGRWYLT 110
            FLA+ + K+ ++   SRKE   WYLT
Sbjct: 333 AFLAKERGKEDAEPFNSRKEMISWYLT 359

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.131    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,673,474
Number of extensions: 286609
Number of successful extensions: 1054
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1047
Number of HSP's successfully gapped: 23
Length of query: 111
Length of database: 53,481,399
Length adjustment: 81
Effective length of query: 30
Effective length of database: 44,193,453
Effective search space: 1325803590
Effective search space used: 1325803590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)