Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16896g8.268ON28528513480.0
KLTH0G13552g8.268ON2812859871e-135
Kwal_56.237758.268ON2812619721e-133
TDEL0F039508.268ON2762678731e-118
ZYRO0C01518g8.268ON2772678651e-116
KLLA0F19272g8.268ON2662458581e-115
Ecym_43028.268ON2752678391e-112
Smik_4.3608.268ON2852828371e-112
TPHA0J007708.268ON2782738351e-112
YDR116C (MRPL1)8.268ON2852828351e-112
Kpol_392.38.268ON2812868251e-110
Skud_4.3768.268ON2852738111e-108
Suva_2.2758.268ON2852728051e-107
NCAS0B038108.268ON3142817971e-106
NDAI0J013308.268ON3142937571e-99
AGR080W8.268ON2752517182e-94
KNAG0H032108.268ON2852436821e-88
KAFR0B054808.268ON2802516671e-86
CAGL0B01815g8.268ON2902476133e-78
TBLA0I031908.268ON2412214147e-49
ZYRO0E06798gna 1ON39861675.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16896g
         (285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   523   0.0  
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   384   e-135
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   379   e-133
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   340   e-118
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   337   e-116
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   335   e-115
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   327   e-112
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   327   e-112
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   326   e-112
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   326   e-112
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   322   e-110
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   317   e-108
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   314   e-107
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   311   e-106
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   296   1e-99
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   281   2e-94
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   267   1e-88
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   261   1e-86
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   240   3e-78
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   164   7e-49
ZYRO0E06798g Chr5 (513129..514325) [1197 bp, 398 aa] {ON} conser...    30   5.9  

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/285 (95%), Positives = 273/285 (95%)

Query: 1   MSLLTKLSSSYGIITLPISCTRTSLFHTFTALKSEEPSTIATKLSKDQLKRRELRRLVQR 60
           MSLLTKLSSSYGIITLPISCTRTSLFHTFTALKSEEPSTIATKLSKDQLKRRELRRLVQR
Sbjct: 1   MSLLTKLSSSYGIITLPISCTRTSLFHTFTALKSEEPSTIATKLSKDQLKRRELRRLVQR 60

Query: 61  KAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFP 120
           KAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFP
Sbjct: 61  KAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFP 120

Query: 121 KPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAIS 180
           KPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAIS
Sbjct: 121 KPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAIS 180

Query: 181 LTSQXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQ 240
           LTSQ            NAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQ
Sbjct: 181 LTSQLGRILGPRGLLPNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQ 240

Query: 241 VLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285
           VLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA
Sbjct: 241 VLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  384 bits (987), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 191/285 (67%), Positives = 232/285 (81%), Gaps = 6/285 (2%)

Query: 3   LLTKLSSSYGIITLP-ISCTRTSLFHTFTALKSEEPSTIAT-KLSKDQLKRRELRRLVQR 60
           + + LSS +    LP +  +     H   +L++EEP   AT KLSKDQLK+RE+RR  Q+
Sbjct: 1   MFSGLSSRF----LPLVRASPVRRLHVSASLRAEEPVGNATSKLSKDQLKKREVRRFAQK 56

Query: 61  KAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFP 120
           KAAAR+PA++HPLYMPV +ALRFLRAAEVGQPQSQQT+S+TT+VISERGAP L+GN+SFP
Sbjct: 57  KAAARRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFP 116

Query: 121 KPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAIS 180
             LK++KIAVFTNDE + +IAR++FNCH+VGGSEL+EKIK+G+VPLDFDK+FATP+IA  
Sbjct: 117 NALKELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATL 176

Query: 181 LTSQXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQ 240
           L SQ             AKKGTV+E++ SLIKDSMGTLPFRQRGN ISIAV +CSFTD Q
Sbjct: 177 LASQLGRILGPRGLLPAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQ 236

Query: 241 VLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285
           +LENI+AAQKS K ALANQKAKKPS+LGQTTLT+T GPG+VIDFA
Sbjct: 237 LLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  379 bits (972), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 180/261 (68%), Positives = 217/261 (83%), Gaps = 1/261 (0%)

Query: 26  FHTFTALKSEE-PSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFL 84
            H F+AL++EE PS + +KLSKDQL++RE+R+L Q+KAAAR+PA DHPLYMPV +ALRFL
Sbjct: 21  LHAFSALRAEETPSPVVSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFL 80

Query: 85  RAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQ 144
           RAAE GQP SQQT+S+TT+VISERGAP L+GN+SFPKPLKD+KIAVFTNDE + +IAR++
Sbjct: 81  RAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREK 140

Query: 145 FNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQXXXXXXXXXXXXNAKKGTVT 204
           F CHLVGGS+L+EKIK+G V LDFDK+FATP+I   L SQ             AKKGTV 
Sbjct: 141 FGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKGTVA 200

Query: 205 EDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKP 264
           E++  L+K+SMGTLPFRQRGN +S+AV KCSFTD Q+LENILAAQK  K ALA QK KKP
Sbjct: 201 ENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKP 260

Query: 265 SILGQTTLTTTHGPGLVIDFA 285
           S+LGQTTLT+THGPG+VIDFA
Sbjct: 261 SLLGQTTLTSTHGPGIVIDFA 281

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  340 bits (873), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 172/267 (64%), Positives = 213/267 (79%)

Query: 19  SCTRTSLFHTFTALKSEEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVT 78
           S  R S  HT   L++EE +   +KLSKDQLK+RE+RRL QRKAAA+K  +DHPLYM + 
Sbjct: 10  SVLRRSFLHTGNVLRAEEAAANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIP 69

Query: 79  QALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKL 138
            ALRFLRAAEVGQPQ+QQTI+LTT V++ERG P L G++SFPKPLK+VKIAVF+ DED+L
Sbjct: 70  MALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQL 129

Query: 139 KIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQXXXXXXXXXXXXNA 198
           K+AR++FNCHLVGG+E+IEKIK GE+P+DFDKAFATPDIA +LTSQ              
Sbjct: 130 KVAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTV 189

Query: 199 KKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALAN 258
           KKGTV  D+S L++DSMG++PFRQRGN ISIAV K SF+D Q+LEN +A   + K ALAN
Sbjct: 190 KKGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALAN 249

Query: 259 QKAKKPSILGQTTLTTTHGPGLVIDFA 285
           Q +KK S+LG+TTL++THGPG+VIDFA
Sbjct: 250 QVSKKTSLLGKTTLSSTHGPGIVIDFA 276

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  337 bits (865), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 160/267 (59%), Positives = 203/267 (76%), Gaps = 3/267 (1%)

Query: 18  ISCTRTSLFHTFTALKSEEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPV 77
           +  T   LFHT   L++EE     +KL+K+QL++RE+RR  +RK  A+KPA  HPLYMP 
Sbjct: 13  LGSTSRCLFHTAALLRAEE---AGSKLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPT 69

Query: 78  TQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDK 137
             ALR+LRA EVG P SQQ I++TT V+++RG P + GN+S P PLKDV +AVF+NDE +
Sbjct: 70  PLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQ 129

Query: 138 LKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQXXXXXXXXXXXXN 197
           L +ARD+F CHLVGGS++I KIK+GE+P+DFDKAFATPDIA  LTSQ             
Sbjct: 130 LSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPM 189

Query: 198 AKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALA 257
           AK+GTV  D+  LIKDS G++PFRQ+GN IS+AVAKC F+D QVLEN+LA Q +FK A++
Sbjct: 190 AKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVS 249

Query: 258 NQKAKKPSILGQTTLTTTHGPGLVIDF 284
           NQKAK+PSILG+TTLTTTHGPG+VID 
Sbjct: 250 NQKAKRPSILGRTTLTTTHGPGIVIDL 276

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  335 bits (858), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 196/245 (80%)

Query: 41  ATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISL 100
            TKL+K+QL++RELR++VQR+  A+ PA+DHPLYMPV++ALR+LRA EVGQP SQQTI+L
Sbjct: 22  GTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITL 81

Query: 101 TTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIK 160
           TTLV++ERG P L GN+SF KPLKDVK+AVFTNDE +  + +D+++ HLVGGS+L+ +IK
Sbjct: 82  TTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIK 141

Query: 161 KGEVPLDFDKAFATPDIAISLTSQXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPF 220
            GEV +DFDKAFATPDI   L SQ             AKKGTV ED+  LIKDSM ++PF
Sbjct: 142 AGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPF 201

Query: 221 RQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGL 280
           RQRGN IS+ VAK  FTD +VLEN+LA QK+FK ++ NQ+ KKPSIL QTTLT+THGPG+
Sbjct: 202 RQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGI 261

Query: 281 VIDFA 285
           VIDFA
Sbjct: 262 VIDFA 266

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  327 bits (839), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 209/267 (78%), Gaps = 1/267 (0%)

Query: 18  ISCTRTSLFHTFTALKSEEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPV 77
           ++  R   F +     +  PS+  TKLSK+Q+K++ELR L+Q++AAA+K   +HPLYMPV
Sbjct: 9   VTVRRGLNFTSVRCAANNSPSS-TTKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPV 67

Query: 78  TQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDK 137
            QA RFLRAAEVGQP SQQTISLTT+V+S++GAP L+GNI FP PL+DVK+AVFTN++++
Sbjct: 68  QQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQ 127

Query: 138 LKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQXXXXXXXXXXXXN 197
            ++AR+QF CHLVGG+ELIE IK G+ P+DFDKA ATPD+   LTSQ             
Sbjct: 128 EEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPA 187

Query: 198 AKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALA 257
            KKGTV+E+I++LI+++M T+PFRQRG  +S+AV KC F+D Q+L+NI+A QK+FK ALA
Sbjct: 188 VKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALA 247

Query: 258 NQKAKKPSILGQTTLTTTHGPGLVIDF 284
           +Q+ KK SILG+TT+T+THGPG+VIDF
Sbjct: 248 DQQGKKSSILGKTTVTSTHGPGIVIDF 274

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  327 bits (837), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 216/282 (76%), Gaps = 9/282 (3%)

Query: 13  IITLPISC----TRTSLFHTFTALKSEEP-----STIATKLSKDQLKRRELRRLVQRKAA 63
           ++ +P  C    TR  L HT   L +EE      S+ A  L+KDQ K+REL+RL QRKA 
Sbjct: 4   VVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAE 63

Query: 64  ARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPL 123
           A++PAA +PLYMPVT ALR+LRAAEVG+PQSQQTI+LTTLV+ ERG   L+G+++FPKPL
Sbjct: 64  AKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPL 123

Query: 124 KDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTS 183
           + +K+A FTNDE+KL+  R ++  HL+GG++L+ +IK GE+P+DFDKAFATPDI  +L S
Sbjct: 124 RYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQS 183

Query: 184 QXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLE 243
           Q            + KKGTV++DI+SL+++S+G++PFRQRGN IS+ V KC F+D ++L+
Sbjct: 184 QVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQ 243

Query: 244 NILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285
           NI++A+ +FK A+ NQK+KKP++L +TTL++THGPG+VIDFA
Sbjct: 244 NIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  326 bits (835), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/273 (57%), Positives = 207/273 (75%), Gaps = 6/273 (2%)

Query: 18  ISCTRTSLFHTFTALK-----SEEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHP 72
           +  TR + FH    ++     +E P    +KLSKDQLK+RELRR   RK  A+ PA  HP
Sbjct: 7   LQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHP 66

Query: 73  LYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFT 132
           LYM V QALRFLRAAEVGQP SQQTI+LTTLV+SE+G+P L G+I+F  PLK+VKIA+FT
Sbjct: 67  LYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFT 126

Query: 133 NDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQXXXXXXXX 192
           NDE ++KIA+++FNC++VGGSELI KIK GE+ +DFDKAFATPDI   L S         
Sbjct: 127 NDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPR 185

Query: 193 XXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSF 252
               + KKGTV+E++  LIK ++G++PFRQ GNCIS+A+ KC+F+D Q+LEN+++ +K+F
Sbjct: 186 GVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAF 245

Query: 253 KLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285
           K +++ QK KKPSILG+T L+TTHGPG+VIDF+
Sbjct: 246 KDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  326 bits (835), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 214/282 (75%), Gaps = 9/282 (3%)

Query: 13  IITLPISCT----RTSLFHTFTALKSEEP-----STIATKLSKDQLKRRELRRLVQRKAA 63
           ++ +P  C     R   FHT   L +++      S+ A  L+KDQ K+REL+RLVQRKA 
Sbjct: 4   VVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAE 63

Query: 64  ARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPL 123
           A++PA   PLYMPVT+ALR+LRAAEVG+PQSQQTI+LTTLV+ ERG   L+G+++FPKPL
Sbjct: 64  AKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPL 123

Query: 124 KDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTS 183
           + +KIA FTNDE KL+  R+++  HL+GG++L+ KIK GE+ +DFDKAFATPDI  +L S
Sbjct: 124 RYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQS 183

Query: 184 QXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLE 243
           Q            + KKGTV++DISSL+++S+G++PFRQRGN ISI V KC FTD ++L+
Sbjct: 184 QVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQ 243

Query: 244 NILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285
           NI++A+ +FK A+ NQK+KKP+IL +TTL++THGPG+VIDFA
Sbjct: 244 NIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  322 bits (825), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 211/286 (73%), Gaps = 13/286 (4%)

Query: 7   LSSSYGIITLPISCTRTSLFHTFTALKSEEPSTIAT-------KLSKDQLKRRELRRLVQ 59
           LS S+GI++      R   +H+   L +E  +   T       K  KD+LKRRELRR  +
Sbjct: 2   LSRSFGILS------RRCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSK 55

Query: 60  RKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISF 119
           RKA ARKPA+ +PLYMP++QALR+LRAAEVGQP SQQ I++TT V+SERG   LNGNIS+
Sbjct: 56  RKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISY 115

Query: 120 PKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAI 179
             P+KDVKIAVF+ND +KL   +++ NCHL+GG++L+EKIK G+ P+DFDKAFATPDI+ 
Sbjct: 116 NTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISP 175

Query: 180 SLTSQXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDT 239
            LTSQ              KKGTV+ED+SSLIK S+G +PFRQ GN IS++V +C+F+D 
Sbjct: 176 MLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDK 235

Query: 240 QVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285
           Q+LENI+A + ++   L++QK+KKPS+LG+TT+T+THGPG+ IDFA
Sbjct: 236 QILENIIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGITIDFA 281

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  317 bits (811), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 216/273 (79%), Gaps = 5/273 (1%)

Query: 18  ISCTRTSLFHTFTALKSEEP-----STIATKLSKDQLKRRELRRLVQRKAAARKPAADHP 72
           +S TR  L HT + L +EE      S+ A  L+K+Q K+REL+RL QR+A A++PAA +P
Sbjct: 13  VSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNP 72

Query: 73  LYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFT 132
           LYMPVT ALR+LRAAEVG+PQSQQTI+LTTLV+ ERG   L+G+++FPKPL+ +K+AVFT
Sbjct: 73  LYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFT 132

Query: 133 NDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQXXXXXXXX 192
           NDE+KLK  R+++  HL+GG++L+ +IK GE+P+DFDKA+AT DI  +L SQ        
Sbjct: 133 NDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPR 192

Query: 193 XXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSF 252
               + KKGTV++DI+SL+++S+G++PFRQRGN IS+ + KC FTD +VL+NI+AA+ +F
Sbjct: 193 GVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAAF 252

Query: 253 KLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285
           K A+++QK+KKP+IL +TTL++THGPG+VIDFA
Sbjct: 253 KAAVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  314 bits (805), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 153/272 (56%), Positives = 206/272 (75%), Gaps = 5/272 (1%)

Query: 19  SCTRTSLFHTFTALKSEEPSTIATK-----LSKDQLKRRELRRLVQRKAAARKPAADHPL 73
           S  R  L HT   L +EE  T A       L+KDQ K+REL+RL QR+A A++PAA  PL
Sbjct: 14  SPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPL 73

Query: 74  YMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTN 133
           +MPVT ALR+LRAAEVG+PQSQQTI+LTTLV+ ERG   ++GN++F KPL+ VK+AVFTN
Sbjct: 74  HMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTN 133

Query: 134 DEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQXXXXXXXXX 193
           DE KLK  R+++   +VGG++L+ KIK  E P+DFDKAFATPDI  +L SQ         
Sbjct: 134 DEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRG 193

Query: 194 XXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFK 253
              + KKGTV++DI+SL+++S+G++PFRQRGN IS+ + KC FTD ++L+NI++A+ +F+
Sbjct: 194 VLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFR 253

Query: 254 LALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285
            A+ NQKAKKPS+L +TTL++THGPG+VIDFA
Sbjct: 254 AAVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA 285

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  311 bits (797), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 207/281 (73%), Gaps = 8/281 (2%)

Query: 12  GIITLPISCTRTSLFHTFTALKSEEPSTIATK--------LSKDQLKRRELRRLVQRKAA 63
           G++    S +++   H+ + + +EE ++  T         LSK+QLK+RELRRL QRK  
Sbjct: 33  GLLAQCTSSSQSRGIHSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELRRLSQRKTE 92

Query: 64  ARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPL 123
           A++PA+ HPLYMPV +ALR++RAAEVG+P  QQTI+LT+LV++E+G   LNG+IS P+PL
Sbjct: 93  AKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPL 152

Query: 124 KDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTS 183
           K +K+AVF+ +E+ L   +++++CHLVGG ELI KIK GEV  DFDKAFA+ D+A  L++
Sbjct: 153 KALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSA 212

Query: 184 QXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLE 243
           Q            NAKKGTV++D+ SL+ D +G+LPFRQ GNCISI + KC F+D ++L 
Sbjct: 213 QLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILR 272

Query: 244 NILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDF 284
           NI+AA+ +   AL+ QK+KKPSILG+TTL++THGPG+VIDF
Sbjct: 273 NIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDF 313

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  296 bits (757), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 152/293 (51%), Positives = 203/293 (69%), Gaps = 16/293 (5%)

Query: 8   SSSYGIITLPIS-----CTRTSLFHTFTALK--SEEPSTI---------ATKLSKDQLKR 51
           S++YG+IT  ++      +RTS      A +  SE  ST          ATKLSK+QLK+
Sbjct: 21  SNNYGVITRMLNTRSFHISRTSSLAAVAATEDASESKSTTSGTNMPPANATKLSKEQLKK 80

Query: 52  RELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAP 111
           RE+RRL QRK  AR+PA  HPLYM V  ALRF+RAAEVG+P+ QQTI+LTTL++SE+G  
Sbjct: 81  REIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTS 140

Query: 112 QLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKA 171
            LNGN+   +PLK++KIAVF+ D++ L+  + QFNC LVGG+E +E IK G +  +FD A
Sbjct: 141 LLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVA 200

Query: 172 FATPDIAISLTSQXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAV 231
           FATP+I   + SQ            N KKGTV++D+ +L+   MG +PF+Q GN ISI +
Sbjct: 201 FATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPI 260

Query: 232 AKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDF 284
            KC F+D  +L NI+AA+ +FK ALANQKAK+PSIL +TTL++THGPG+VIDF
Sbjct: 261 GKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVIDF 313

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  281 bits (718), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 193/251 (76%)

Query: 34  SEEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQ 93
           S+E +  ++KLSKDQLK+RELRRL QRKAAAR+PA+  PLYMPV QALRFLRAAEVGQP 
Sbjct: 23  SQEAAATSSKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPVQQALRFLRAAEVGQPA 82

Query: 94  SQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGS 153
           +QQTIS+ T+VI ++GA  L+G ++ P P+++ K+AVFTND ++ + AR ++ C+LVGG+
Sbjct: 83  TQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETARTKYGCYLVGGA 142

Query: 154 ELIEKIKKGEVPLDFDKAFATPDIAISLTSQXXXXXXXXXXXXNAKKGTVTEDISSLIKD 213
           EL+E++K GEV +DFDKAFATPDIA  + ++            + KKGTV  D+S L+ D
Sbjct: 143 ELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGTVAGDLSELLGD 202

Query: 214 SMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLT 273
            + + PF+QR NCIS+A+ KC F+D Q++EN+LA Q +F+ A+ +QK KK S+ G TTLT
Sbjct: 203 DINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQKTKKTSLFGTTTLT 262

Query: 274 TTHGPGLVIDF 284
           +THGPG+VIDF
Sbjct: 263 STHGPGIVIDF 273

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  267 bits (682), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 181/243 (74%)

Query: 43  KLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTT 102
           KL+K+QL+RRELR++++ K  A++PA+   +Y+ V +A+R LRA EVGQP SQQTI+LTT
Sbjct: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102

Query: 103 LVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKG 162
           +V+SE+G P L+G++  P PLK V+IA F+ D + LK  +++    +VGG+ELI+++K G
Sbjct: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162

Query: 163 EVPLDFDKAFATPDIAISLTSQXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPFRQ 222
           EVP+ FDKAFATPDIA  L S+            N KKGTV  D+ ++I+  +G +PFRQ
Sbjct: 163 EVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222

Query: 223 RGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVI 282
           R   ++  +AKC F+D QVL N++AA+++F+LA+ NQK+KK SILG++TL++THGPG+VI
Sbjct: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282

Query: 283 DFA 285
           D A
Sbjct: 283 DLA 285

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  261 bits (667), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 173/251 (68%), Gaps = 1/251 (0%)

Query: 35  EEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQS 94
           EE S   +K +K Q K++ LR  ++ +  AR+PA++HPLYM V  ALRFLRA EVGQP+S
Sbjct: 29  EEASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRS 88

Query: 95  QQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQF-NCHLVGGS 153
           QQTI+LTTLVISE+G P + GN+  P PL++ K+ V ++D  KL+  +D F N HLVGG 
Sbjct: 89  QQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGR 148

Query: 154 ELIEKIKKGEVPLDFDKAFATPDIAISLTSQXXXXXXXXXXXXNAKKGTVTEDISSLIKD 213
           EL++K K  ++ +DFDK  ATPDI                   N KKGTV+E++  L+ +
Sbjct: 149 ELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNE 208

Query: 214 SMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLT 273
           ++ ++PFRQR  CIS+ + K  F+D Q+LENI+A +++F   L+NQK KK S LG+TTLT
Sbjct: 209 NVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLT 268

Query: 274 TTHGPGLVIDF 284
           +THGPG+VIDF
Sbjct: 269 STHGPGIVIDF 279

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  240 bits (613), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 179/247 (72%), Gaps = 6/247 (2%)

Query: 44  LSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTL 103
           L+K+Q K+RE++RL  +KA A+KPA  HPLYMP+  ALR+LR+AEVG+P   QTI++TTL
Sbjct: 43  LTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTL 102

Query: 104 VISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFN--CHLVGGSELIEKIKK 161
           V++++G   L GNI FP PLK +KIA+F+++++KL   + +++    + GG ++I  IK 
Sbjct: 103 VVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKS 162

Query: 162 GEVPLD-FDKAFATPDIAISLTSQXXXXXXXXXXXXNAKK---GTVTEDISSLIKDSMGT 217
           G++ +D  +K FATP+I  ++ SQ            N KK    TV ED+ SLI++++G 
Sbjct: 163 GKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQ 222

Query: 218 LPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHG 277
           + FRQRGN +S++V +C+F+D  +LENI+A + +FK ++++Q AKKPSILG+TT++TT G
Sbjct: 223 VSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAG 282

Query: 278 PGLVIDF 284
           PG+VIDF
Sbjct: 283 PGIVIDF 289

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  164 bits (414), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 134/221 (60%), Gaps = 2/221 (0%)

Query: 64  ARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPL 123
           AR  + +HPL M V  ALR+LRA E G+  S+QT++L T+V + RG   L G I+F   +
Sbjct: 22  ARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLI 81

Query: 124 KDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTS 183
           +   IAVFT D ++ KIA++     ++GGSELI+KI  GE  + F  AFAT D+   L +
Sbjct: 82  RKPVIAVFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-A 139

Query: 184 QXXXXXXXXXXXXNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLE 243
           +              KK TV ++I  L++D +  +PF ++ + IS  V KCSFTD ++L 
Sbjct: 140 RVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILR 199

Query: 244 NILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDF 284
           N++ A++  + AL  Q  KKPS + + TLT+THGPG+ ID 
Sbjct: 200 NLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>ZYRO0E06798g Chr5 (513129..514325) [1197 bp, 398 aa] {ON} conserved
           hypothetical protein
          Length = 398

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 30/61 (49%)

Query: 112 QLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKA 171
           ++  N++F KPL +   A+F N    L  A D    H +    L +++   ++P +F+  
Sbjct: 112 EITHNLAFKKPLYNKMFAIFVNTPVPLPYAADFGPYHQLHHKFLGDELYDTDIPTEFEAK 171

Query: 172 F 172
           F
Sbjct: 172 F 172

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,691,605
Number of extensions: 964159
Number of successful extensions: 2811
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2878
Number of HSP's successfully gapped: 26
Length of query: 285
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 177
Effective length of database: 41,097,471
Effective search space: 7274252367
Effective search space used: 7274252367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)