Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16874g8.269ON56356328030.0
Kwal_56.237718.269ON56255318750.0
KLTH0G13530g8.269ON57456318560.0
TDEL0F039608.269ON55855616650.0
Suva_2.2768.269ON56556116320.0
YDR117C (TMA64)8.269ON56555816100.0
ZYRO0C01496g8.269ON56755415980.0
TPHA0J007808.269ON58356715900.0
Skud_4.3778.269ON56256115820.0
NCAS0B038008.269ON56556115470.0
Smik_4.3618.269ON56556315360.0
NDAI0J013108.269ON57957614660.0
CAGL0B01837g8.269ON56956314350.0
Kpol_392.28.269ON56655914030.0
KAFR0B054708.269ON56256013700.0
Ecym_43018.269ON56456113211e-177
KLLA0F19294g8.269ON57057012861e-171
AGR079W8.269ON54255012501e-166
TBLA0I032008.269ON56355712061e-160
KNAG0H032008.269ON56156211261e-147
Skud_15.4498.747ON14942740.74
YOR286W (RDL2)8.747ON14942721.6
KLTH0F16786g5.632ON34762732.4
Smik_3.691.406ON164055742.5
Suva_8.3348.747ON14942702.9
Smik_15.4668.747ON14922703.0
Skud_3.461.406ON161855733.0
ZYRO0D09636g7.152ON181114703.6
KAFR0D018905.31ON1962114707.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16874g
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...  1084   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   726   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   719   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   645   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   633   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   624   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   620   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   617   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   613   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   600   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   596   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   569   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   557   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   545   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   532   0.0  
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   513   e-177
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   499   e-171
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   486   e-166
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   469   e-160
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   438   e-147
Skud_15.449 Chr15 (789127..789576) [450 bp, 149 aa] {ON} YOR286W...    33   0.74 
YOR286W Chr15 (850280..850729) [450 bp, 149 aa] {ON}  RDL2Protei...    32   1.6  
KLTH0F16786g Chr6 (1359602..1360645) [1044 bp, 347 aa] {ON} weak...    33   2.4  
Smik_3.69 Chr3 (94751..99673) [4923 bp, 1640 aa] {ON} YCL014W (R...    33   2.5  
Suva_8.334 Chr8 (590004..590453) [450 bp, 149 aa] {ON} YOR286W (...    32   2.9  
Smik_15.466 Chr15 (800319..800768) [450 bp, 149 aa] {ON} YOR286W...    32   3.0  
Skud_3.46 Chr3 (75252..80108) [4857 bp, 1618 aa] {ON} YCL014W (R...    33   3.0  
ZYRO0D09636g Chr4 complement(819030..819564,819630..819640) [546...    32   3.6  
KAFR0D01890 Chr4 complement(376752..382640) [5889 bp, 1962 aa] {...    32   7.4  

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score = 1084 bits (2803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/563 (95%), Positives = 539/563 (95%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
           QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSAEDIDHF 240
           LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSAEDIDHF
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSAEDIDHF 240

Query: 241 LTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHFEK 300
           LTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHFEK
Sbjct: 241 LTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHFEK 300

Query: 301 ANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNMMQAVSLYK 360
           ANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNMMQAVSLYK
Sbjct: 301 ANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNMMQAVSLYK 360

Query: 361 PISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTLFPMINRS 420
           PISSAKEFSKAVDLPPNKIFTAQELKAALDSYI              LLDDTLFPMINRS
Sbjct: 361 PISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLFPMINRS 420

Query: 421 TKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLFKTALKGAIPEIQIVTEMKIGRK 480
           TKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLFKTALKGAIPEIQIVTEMKIGRK
Sbjct: 421 TKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLFKTALKGAIPEIQIVTEMKIGRK 480

Query: 481 VVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVIGMLNE 540
           VVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVIGMLNE
Sbjct: 481 VVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVIGMLNE 540

Query: 541 YGIPTKWINFQXXXXXXXXXXPT 563
           YGIPTKWINFQ          PT
Sbjct: 541 YGIPTKWINFQNKLKNKKKRKPT 563

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/553 (64%), Positives = 430/553 (77%), Gaps = 5/553 (0%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+P IKALSNLKNSERKKL +  REQ + SDY FP+QV+KQTTFK   + GTVYTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
           +N+PIWFKEK   L++PTVF+CWSN D++P+V  H++VVEEKLLKGA+LMLPG VPPF  
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +C K  +VGVAST SP V+KAIGIVQL+LP Y+RVIGE+GVAV I+HTFDD LCKAFK+K
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 LEPPEAIEDTS-SKTEEQEEEHVDSADEAKAIATT-TQARMVNTEDASEQLNELSAEDID 238
           L+PPE  +  + S +EE  +  V  A + +   +   Q  +VN +DA+EQL++LS ED+D
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240

Query: 239 HFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHF 298
           HF TR+LYYTLTQD +L++P +ASNFVSNHIL NLPP+DH Q+NMKK+SWKK+AKFLKHF
Sbjct: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHF 300

Query: 299 EKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNMMQAVSL 358
           EK  FLKLKGKGDDL +VG++K KDELK FVPYR G +   +      Q  ++MM+A+ +
Sbjct: 301 EKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSESEQ--NSMMKALVI 358

Query: 359 YKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTLFPMIN 418
           YKP+SSAK F  A DL PN +F+ QELK A+D+YI               LDD LF ++N
Sbjct: 359 YKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSLVN 418

Query: 419 RSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIPEIQIVTEMKI 477
           RSTKKENA+RTI RAQIMPP L  NF EHF +LK D  PLFK  +KG IP+IQIVTEMKI
Sbjct: 419 RSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEMKI 478

Query: 478 GRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVIGM 537
           GRKVVTKVSNFEKFQ+DA+ LA  LRK+CSGSTTIGET +SPKT EVTVQGPHG  VI +
Sbjct: 479 GRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPAVIEL 538

Query: 538 LNEYGIPTKWINF 550
           LN+  IPTKWINF
Sbjct: 539 LNQLAIPTKWINF 551

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/563 (61%), Positives = 431/563 (76%), Gaps = 13/563 (2%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+P IKALSNLKNSERK + +  +EQ   S+Y FP+QV+KQTTFK   + GTV+TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
           +NVPIWFKEK   L++PTVFTCWSN  +LP+V  H++VVEEKLLKGA+LMLPG VPPF  
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +C K  +V VAST +P V+KAIGIVQ++LP Y+RVIGE+GVAV I+HTF D LCK FK+K
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 LEPPE---AIEDTSSKTEE--QEEEHVDSADEAKAIATT---TQARMVNTEDASEQLNEL 232
           L+PPE   AI D+ S+ E   +++  V SA E+ A   +    Q  +VN ED SEQL EL
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 233 SAEDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSA 292
             ED+DHF TRSLYY+L  D +L+ P++ASNFVSNHIL NLPP+DH Q+NMKK+SWKK+A
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 293 KFLKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKA----QE 348
           KFLK+FEK  FLKLKGKGDDL ++G+++ K ELK F PYRIG     ++  A +    +E
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 349 NSNMMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXL 408
            +++M+AVSLY+PISS K F  A DLPPN++FT Q++K+A+D YI               
Sbjct: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420

Query: 409 LDDTLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIP 467
           LDD L+ ++NRS+KKENA+RTI+RAQIM P L  NF+EHF ILK D  PLFK  +KG+IP
Sbjct: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480

Query: 468 EIQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQ 527
           ++QIVTEMKIGRKVVTKVSNFEKFQ+DA+ LA  LRK+CSGSTTIGE  +SPKTLEVTVQ
Sbjct: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540

Query: 528 GPHGAIVIGMLNEYGIPTKWINF 550
           GPHG  VI +LNE GIPTKWINF
Sbjct: 541 GPHGPAVIELLNESGIPTKWINF 563

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/556 (56%), Positives = 401/556 (72%), Gaps = 14/556 (2%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+PHIKALSNLKNSERKKLL S +EQ   SDY F T +VKQT +KGQ S GTVYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            NVPIWFKEKHG L+FPTV++CW+ P++LP+V TH  V+EE+L  GA+LML G +PPF  
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +C    + G+AS   P+VI AIG+VQL+LPSY+ VIG+ G+AV ++H F DGLC+AFK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSAEDIDHF 240
           +EP  A+   SS+  E+EEE        ++    T    ++ ED ++ L+ELS ED+DHF
Sbjct: 181 IEP--AV--LSSEPVEEEEEEEGKEKLTESPKRETFHTEISIEDVAQVLDELSVEDVDHF 236

Query: 241 LTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHFEK 300
            TR+LYYT T D  L +P+NASNF+SNHIL NLPPVD +Q+NMKK+SWKK+AKFLKHFEK
Sbjct: 237 FTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEK 296

Query: 301 ANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSN----MMQAV 356
             FL+LKGKGDDLV+VG+NK+KDELK FVPY+        QT +K   N +    MM + 
Sbjct: 297 VGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSG-----QTASKKNSNKDSSPGMMYSE 351

Query: 357 SLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTLFPM 416
            LYKPI+  K+F +  DLPP  ++T  ELK +++ YI              LLDD LF M
Sbjct: 352 KLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFDM 411

Query: 417 INRSTKKENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIPEIQIVTEM 475
             R  K +   R +SRAQIM PF+ANNFTE +Q+ K  D PLFK  ++G +P ++IVTEM
Sbjct: 412 FYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEM 471

Query: 476 KIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVI 535
           KIGRKVVT+VS+FE F+LD E LAA LRK CSGSTTIGET++SPK  EV VQG HG ++I
Sbjct: 472 KIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLII 531

Query: 536 GMLNEYGIPTKWINFQ 551
             LN+ GIPTKWI+F+
Sbjct: 532 DYLNKQGIPTKWIDFE 547

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/561 (54%), Positives = 402/561 (71%), Gaps = 15/561 (2%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+PHIKALSNLKNSERKKLL + ++Q    +Y FPT  +KQT F GQ S GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            N PI FKEKH   +FPTV++CW N  +LP+V TH  V+EE L  GA+LM+ G +PPF  
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +C  G+L GVAS ++P+++ A+GIV++DLPSY+RVIGETGVAV I+H F+DGL KAFK+K
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATT---TQARMVNTEDASEQLNELSAEDI 237
           LEPP A  D +S+ E+ +   ++  +  K    T    Q   +N E+ +E L+ LS  D+
Sbjct: 181 LEPPAAF-DVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDV 239

Query: 238 DHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKH 297
           D+F+TR+LYYTLTQD  L LP++ASNF+SNHI+ NLPP+DHN++N+K++SWKKSAKFLKH
Sbjct: 240 DYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKH 299

Query: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSH------GEPTQTKAKAQENSN 351
           FEK  FLKLKGKGDDL +VG N DKDELK FVPY++G +      GE T +K K    S 
Sbjct: 300 FEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKT---SG 356

Query: 352 MMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDD 411
           MM +++LYKP + AK+  K  +LP    +T+Q++++A+  YI              ++DD
Sbjct: 357 MMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDD 416

Query: 412 TLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLF-KTALKGAIPEIQ 470
            L+ M+N+  K  +  R I RAQI+ P LANNFTE +QI K D  L  +T +KG+ P I+
Sbjct: 417 LLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIK 476

Query: 471 IVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPH 530
           I+TEMKIGRKV+TKVSNFE  Q+D E LAA+LRK CSGSTTIGE+ +  K+ EV VQGPH
Sbjct: 477 IITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPH 535

Query: 531 GAIVIGMLNEYGIPTKWINFQ 551
           G ++I  LN+ G+P KWI+F+
Sbjct: 536 GQLIIDHLNKSGVPNKWIDFE 556

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/558 (53%), Positives = 399/558 (71%), Gaps = 9/558 (1%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+PHIKALSNLKNSERKKLL + ++Q    +Y F T  +KQT F GQ S GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            N PI FKEKH   +FPTV++CW  P +LP+V TH  V+EE L  GA+LM+ G +PPF  
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +C  G+L G+AS ++P  + AIGIV+LDLPS+ +VIGETGVAV IIH F+DGL K FKMK
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIAT---TTQARMVNTEDASEQLNELSAEDI 237
           LEPP  +  T SK      + ++S+++ KA+       +   V+ E+ +E L+  +  D+
Sbjct: 181 LEPPFVL-STQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDV 239

Query: 238 DHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKH 297
           D+F+TR+LYYTLTQD  L+LP++ASNF+SNHI+ NLPP+DHN++N+KK+SWKKSAKFLKH
Sbjct: 240 DYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKH 299

Query: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTK---AKAQENSNMMQ 354
           FEK  FLKLKGKGDDL +VG N DKDELK FVPY++G     T+++      ++ S MM 
Sbjct: 300 FEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMY 359

Query: 355 AVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTLF 414
           +++LYKP + AK+  K V+L  +  +T+Q++++A+  YI              ++DD LF
Sbjct: 360 SLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLF 419

Query: 415 PMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIPEIQIVT 473
            M+N+  K  NA R I+R +I+ P L NNFTE +QI K  D  LFK  +KG++P I+I+T
Sbjct: 420 DMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIIT 479

Query: 474 EMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAI 533
           EMKIGRKV+T+VSNFE FQ+D E+LAA+LRK CSGSTTI E+ +  K  EV VQGPHG  
Sbjct: 480 EMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQS 538

Query: 534 VIGMLNEYGIPTKWINFQ 551
           +I  LN+ GIP+KWI+F+
Sbjct: 539 IIDHLNKLGIPSKWIDFE 556

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/554 (55%), Positives = 396/554 (71%), Gaps = 4/554 (0%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKKDPH+KALSNLKNSE KKLLA+ R Q    +Y FPT V+KQT F+ Q+  GTVYTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            N PIWFKEKHG+L++PTVF CWS+P +LPVV TH  VVEE+L  GA+LML G V PF S
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +   G++ G+AS  +P V+ A+G+VQLDLPSY  V+G+TGVAV ++H   DGL K FK+ 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSAEDIDHF 240
            EPP ++ED+  + EE+EE   +SA +  +    +Q + V+ +D +E L+E   ED+D F
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRLEDVDQF 240

Query: 241 LTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHFEK 300
           LTR+LYYTLT D +L+LP++ASNF+SNHI HNLP VDH ++N+KKSSWKK+AKFLK+FEK
Sbjct: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNFEK 300

Query: 301 ANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKA---QENSNMMQAVS 357
             FLKLKGKGDDL ++GINK K EL+ F PY+I          +     ++ S  ++  +
Sbjct: 301 EGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQLRCET 360

Query: 358 LYKPISSAKEFSKAVDLPPNKI-FTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTLFPM 416
           LYKPI+ AK+F +  DL P  I +TAQELK AL+ YI              +LDD L+ +
Sbjct: 361 LYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYHL 420

Query: 417 INRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLFKTALKGAIPEIQIVTEMK 476
           +N+  K   A R +SRA I+ P LAN+FT HFQI KGD+PLFK   +G +P I+IVTEMK
Sbjct: 421 VNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLPNIEIVTEMK 480

Query: 477 IGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVIG 536
           IGRKV+T+VS FE F +D + LAA LR+ CSGSTTIGETM+SPK  EVTVQGPHG ++I 
Sbjct: 481 IGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLIID 540

Query: 537 MLNEYGIPTKWINF 550
            LN  GIPTKWI F
Sbjct: 541 HLNSLGIPTKWIKF 554

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/567 (53%), Positives = 405/567 (71%), Gaps = 24/567 (4%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK P++KA SNLKNSERKKLL S +EQR  SDY FP+ ++KQ  +KGQTSAGTVYTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
           QNVPIWFKEKH  ++FP+V+TCW NP +LP++ T+ +V+EEK+L GA+LM+ G + PF  
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +   G+L G+AS + P V+ AIGIVQLDL SYT+V+GETGVAVN++H   DGL  +FKM 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 LEPPEA---IEDTSSKTEEQEEEHVDS--ADEAKAIATTTQARMVNTEDASEQLNELSAE 235
           LEPPE    +++T+     Q+++ V++   +  K +A   +      +D +E L  L  +
Sbjct: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARP----NDDLAEVLETLPVD 236

Query: 236 DIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFL 295
            ID F+T+SLYY+LT D +L+ P++ASNF+SN+I+ NLPPVD++ +N+KKSSWKK+AKFL
Sbjct: 237 IIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFL 296

Query: 296 KHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKA----KAQENSN 351
           +HFEK  F+KLKGK DDLV+ G NK+K ELK FVPYR G +G  T++K        +N +
Sbjct: 297 RHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTG-NGNSTKSKKDKTNDTSDNGD 355

Query: 352 MMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDD 411
           MMQ+VS YKPIS  K+  +    P   ++TA EL+  +  YI              L+DD
Sbjct: 356 MMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDD 415

Query: 412 TLFPMINRSTKKENAL--RTISRAQIMPPFLANNFTEHFQIL-KGD----VPLFKTALKG 464
            ++ ++    KK+N+   R ISRA ++ P   NNF EHFQI  KGD    VPLFK  ++G
Sbjct: 416 LMYSLV---YKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRG 472

Query: 465 AIPEIQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEV 524
           +IP+++IVTEMKIGRKV+T+VSNFE F +DAETLAA+LRK C+G+TTIGET++SPKT EV
Sbjct: 473 SIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEV 532

Query: 525 TVQGPHGAIVIGMLNEYGIPTKWINFQ 551
            VQGPH  ++I  LN   IPTKWI+F+
Sbjct: 533 QVQGPHSQVIIKHLNSLSIPTKWIDFK 559

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/561 (53%), Positives = 390/561 (69%), Gaps = 18/561 (3%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+PHIKALSNLKNSERKKLL + ++Q    +Y FPT  +KQT F  Q S G VYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            N PI FKEKH   +FPTV++CW NP +LP++ TH  V+EE L  GA+LM+ G +PPF  
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +   G+L GVAS  +P+V+ AIGIV++DLPSY RV+GETGVAV +IH F+DGL KA K+K
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIAT---TTQARMVNTEDASEQLNELSAEDI 237
           L+PP A     S  E+   + V   +EAK +       Q   V+ E+ +E L+  S  D+
Sbjct: 181 LDPPIA----KSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDV 236

Query: 238 DHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKH 297
           D+F+TR+LYYTLTQD  L LP++ SNF+SNHI+ NLPP+DHN++N+KK+SW+KSAKFLKH
Sbjct: 237 DYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKH 296

Query: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGS------HGEPTQTKAKAQENSN 351
           FEK  FLKLKGKGDDL +VG   DKDELK FVPY++GS       GE   +K K      
Sbjct: 297 FEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKT---PG 353

Query: 352 MMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDD 411
           MM +++LYKP S AK+F K  +L     +T+Q++++AL  YI              ++DD
Sbjct: 354 MMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413

Query: 412 TLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGDVP-LFKTALKGAIPEIQ 470
            LF M+N+  K  NA R + RAQI+ P LANNFTE +QI K D   LFK  +KG+ P I+
Sbjct: 414 LLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIK 473

Query: 471 IVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPH 530
           I TEMKIGRKV+T+VSNFE FQ+D E+LA +LRK CSGSTTIGE+ +  K+ EV VQGPH
Sbjct: 474 ITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGPH 532

Query: 531 GAIVIGMLNEYGIPTKWINFQ 551
           G ++I  LN  G+P KWI+F+
Sbjct: 533 GQLIIDHLNNLGVPNKWIDFE 553

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/561 (53%), Positives = 399/561 (71%), Gaps = 16/561 (2%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MF+K+PHIKALSNLKNS+RKKL  ++  Q     Y  P+ +VKQT F+  T+ GT+YTDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
           +N+PIWFKEKH   ++ TV+TCW+  D+LP+  +H  V++EKL  GA+LM+ G +PPF  
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 KCSKGSLVGVASTRSP-RVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKM 179
           K   G+L GVAS + P RV+ AIGIV +DLP + +V+GE+GVAV IIH F+D L K+FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KLEPP------EAIEDTSSKTEEQEEEHVDSADEA-KAIATTTQARMVNTEDASEQLNEL 232
            L+PP       ++ D   + EE+E+E  +  DE  K ++T T     N ED +E L+ L
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTAT-----NVEDLAEVLDHL 234

Query: 233 SAEDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSA 292
           S +D+D+F+TR+LYYT+T D +L LP++ASNF+S HI  NLP VDHN++N+KKSSWKK+A
Sbjct: 235 SVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTA 294

Query: 293 KFLKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIG-SHGEPTQTKAKAQENSN 351
           KFLKHFEK  FLKLKGKGDDL VVG+NK KDELK FVPY++G S+GE    K +    S 
Sbjct: 295 KFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSG 354

Query: 352 MMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDD 411
           MM +++ YKPI+ AK+  K   +P   ++   E++  +++YI              LLDD
Sbjct: 355 MMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDD 414

Query: 412 TLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIPEIQ 470
            LF M+N+        R+ISRAQI+ P L NNFTEHFQI      PLFK+ ++G+ P I+
Sbjct: 415 LLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIK 474

Query: 471 IVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPH 530
           I+TEMKIGRKV+TKVSNFE+F ++ ETLAA+LRK CSGSTTIGETM+SPKT EV VQGPH
Sbjct: 475 ILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPH 534

Query: 531 GAIVIGMLNEYGIPTKWINFQ 551
           G I+I  LN+ G+PTKWI+++
Sbjct: 535 GQIIIDHLNKLGVPTKWIDYE 555

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/563 (53%), Positives = 400/563 (71%), Gaps = 19/563 (3%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+PHIKALSNLKNSERKKLL +  +Q    +Y FPT ++KQT F GQ S GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            N+PI FKEKH   ++PTV++CW NP +LP+V TH  V+EE L  GA+LM+ G +PPF S
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +C+ G+L GVA  +SP+V+ AIG+V+LDLPSY RVIGETGVAV +IH F+DGL KAFK+K
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 LEPPEAI----EDTSSKTEEQEE-EHVDSADEAKAIATTTQARMVNTEDASEQLNELSAE 235
           LEPP  +    ED +  +++ E  E V SAD+++     T   +   E+ +E L+ L+  
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDL---EEVAEVLDHLTVS 237

Query: 236 DIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFL 295
           D+D+F+TR+LYY+LTQD  L LP++AS F+SNHI+ NLPP+DHN++N+KKSSWKKSAKFL
Sbjct: 238 DVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFL 297

Query: 296 KHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGS------HGEPTQTKAKAQEN 349
           KHFEK   LKLKGKGDDL +VG N DKDELK FVPY++G        GE   +K +    
Sbjct: 298 KHFEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRT--- 354

Query: 350 SNMMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLL 409
           S MM +++LYKP S AK+  +   L  +  +T+Q+++ A+  YI              ++
Sbjct: 355 SGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVM 414

Query: 410 DDTLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIPE 468
           DD LF M+N+  K  +  R I+R++I+ P L+NNFTE +QI +  D  LF+  +KG  P 
Sbjct: 415 DDLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPR 474

Query: 469 IQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQG 528
           I+IVTEMKIGRKV+TKVSNFE F +D E LAA+LRK CSGSTTIGE+ +  K+ EV VQG
Sbjct: 475 IKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQG 533

Query: 529 PHGAIVIGMLNEYGIPTKWINFQ 551
           PHG  +I  LN+ GIP+KWI+F+
Sbjct: 534 PHGQFIIDYLNKSGIPSKWIDFE 556

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/576 (50%), Positives = 398/576 (69%), Gaps = 34/576 (5%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFP-TQVVKQTTFKGQT--SAGTVY 57
           MFKK+PHIKALSNLKNS+RKKLL +++ Q  +  Y F  + ++KQT F+     S GT++
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDEQNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPP 117
           T++ N+PIWFK KH  L++PTVFTCW+N DILP + +H  V++EKL  GA+LM+ G +PP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FSSKCSKGSLVGVASTRSP-RVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKA 176
           F S+   G+L G+AS + P R++ AIG+V++++PS+ +V+GETGVAV +IH F+D L K 
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKMK-LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDAS---EQLNEL 232
           FK   L+P E +++  +    Q+    D ADE      TT+ +  N E      E L+  
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHPQDN---DVADED-----TTRKKEENRESNEPDFEVLDHF 232

Query: 233 SAEDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSA 292
             ED+D+F+TRSLYYT+TQD +++LP++ASNF+S HI  NLP + HN++N+KK+SWKK+A
Sbjct: 233 KTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTA 292

Query: 293 KFLKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENS-- 350
           KFLKHFEK  FLKLKGKGDDL VVG+NK KDELK FVPY+IG    P+ + +    N   
Sbjct: 293 KFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKS 352

Query: 351 ---NMMQAVSLYKPISSAKEFSKAVDLPPNK-IFTAQELKAALDSYIXXXXXXXXXXXXX 406
               MM + + YKPI+ AK+  KAV   P K ++T QE++  + SYI             
Sbjct: 353 DTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKM 412

Query: 407 XLLDDTLFPMINRSTKKENAL-RTISRAQIMPPFLANNFTEHFQIL-----KGDV----- 455
            LLDD LF M+++   + NA  RT+ R  I+ P LANNFTEH+QI      KG++     
Sbjct: 413 ILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVE 472

Query: 456 PLFKTALKGAIPEIQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGET 515
           PLFK+  +G +P+I I+TEMKIGRKV+TKVSNFE F + ++ LAA+LRK CSGSTTIGET
Sbjct: 473 PLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGET 532

Query: 516 MSSPKTLEVTVQGPHGAIVIGMLN-EYGIPTKWINF 550
           M+SPKT EV VQGPHG I+I  LN ++G+PTKWIN+
Sbjct: 533 MTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/563 (51%), Positives = 384/563 (68%), Gaps = 16/563 (2%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+PHIKALSNLKNSERKKL    R Q    +Y F +  +KQT FKG T+ GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            N PIWFKEKH   ++PTV  CW  P+++PVV TH  V+E+ +  GA+LM+ G +PPF  
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           + + G++ G+A  R+P +I A+GIVQ++LPS+TRVIGETGVAV I+H  +D L K FK+K
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 LEPPEAIEDTSSKTEEQEEEHVD-SADEAKAIATT-TQARMVNTEDASEQLNELSAEDID 238
            EPP  +  T S + E+ E   D   DE K  + + T+    N +D +E L+EL  EDID
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240

Query: 239 HFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPP-VDHNQINMKKSSWKKSAKFLKH 297
           +F+TR+LYYT++QD +L+ P +ASNFVSNHI HNLP   +  ++N+KKSSWKK+AKFLKH
Sbjct: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300

Query: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPY-RIGSHGEPTQTKAKAQENSNMMQAV 356
           FEK  FLKLKG GDDL +V +NKDKDE+K+F+PY  IG+ G  + T ++       ++ V
Sbjct: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQG--SNTGSEGGNAKTTIKIV 358

Query: 357 SLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTLFPM 416
           +LYKPI+ AK+F  +  +P  +++   E+K  ++ YI              L+DD L  M
Sbjct: 359 TLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDMLMTM 418

Query: 417 INRSTKKENAL---RTISRAQIMPPFLANNFTEHFQILK----GDVPLFKTALKGAIPEI 469
           I +  KKE+     R I RA I+ P L NNF +++ + +       PL KT LKG  P+I
Sbjct: 419 IYK--KKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKI 476

Query: 470 QIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSP-KTLEVTVQG 528
            IVTEMKIGRKV+TKVSNFE FQ+D E  AA++RK+CSGSTTIGET SS  KT EV VQG
Sbjct: 477 NIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQG 536

Query: 529 PHGAIVIGMLNEYGIPTKWINFQ 551
           PHG +++  LN+ GIP KWI+F+
Sbjct: 537 PHGQLIMSYLNDLGIPNKWIDFE 559

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/559 (51%), Positives = 380/559 (67%), Gaps = 11/559 (1%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK PHIK+LSNLKNSERKKLL S + Q   +DY FPT V+KQT F  QTS G +YTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
           +  P+WFKEKH  L+FPTV+TCW +P +LP+V TH  V+ E +  GA+LM+ G +PPF S
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +    ++ G+A+  +P  I A+G+VQLD+PSY+ VIG+TGVAVN++H + DG+  AFKMK
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 LEPPEAI--EDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNE---LSAE 235
            + P  +  +D S    E ++  V   +E K    +     +++ D SE   E   L+ E
Sbjct: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPE--ISSNDVSELAQEESALTVE 238

Query: 236 DIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFL 295
           DIDHF+TRSLYYTLT D +L  P+ +S+F+SNHI+ NLPPVDHN +N+KK+SWKKS+KFL
Sbjct: 239 DIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFL 298

Query: 296 KHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKA--QENSNMM 353
           KHFEK  F+KLKGKG+DL +VG NK+K+ELKKF PYRI +    +  K  +  QE+ NMM
Sbjct: 299 KHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESENMM 358

Query: 354 QAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTL 413
            ++  Y P  SAK+F    +LP    +TA ELK A+  YI               LDD L
Sbjct: 359 YSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRL 418

Query: 414 FPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIPEIQIV 472
           + M   + K  N  R I+RA ++  F  NNFTE +Q+ K  D PL K  ++G+ P I+IV
Sbjct: 419 YDMC-YTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIV 477

Query: 473 TEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGA 532
           TEMKIGRK+VT+VSNFE F +DA+ LA +LR+ CSGSTTIGET +SPKT EV VQGPH  
Sbjct: 478 TEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHSK 537

Query: 533 IVIGMLNEYGIPTKWINFQ 551
           I+I  LN   IPTKWI+F+
Sbjct: 538 IIIDHLNSLSIPTKWIDFE 556

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/560 (48%), Positives = 373/560 (66%), Gaps = 17/560 (3%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQ-REVSDYQFPTQVVKQTTFKGQTSAGTVYTD 59
           MFKK+P IKALS LKNS+RKKL+ S++ Q +   D       + QT F   T+AGT+YTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  EQNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFS 119
             ++PI FK KH   ++PT F  WSN  +L  V+TH  VVE  +  GADLM+ G VPPF 
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 SKCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKM 179
           S  + G++  VA+  +P V  A+GIV+L+LP Y +V+G+TGVAV I+H F+D L   FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KLEPPEAIEDTSSKTEEQEEEHVDSADEAKA-----IATTTQARMVNTEDASEQLNELSA 234
           KLE P ++     K+  QEE   D A E+ A       T   +     +D +E L+EL+ 
Sbjct: 181 KLEIPASV-----KSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTV 235

Query: 235 EDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKF 294
           ED+D+F+ R+LY+T+ QD+ L LPV AS F+SNHI+ NLP VDH ++N+K++SWKK+AKF
Sbjct: 236 EDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKF 295

Query: 295 LKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNM-M 353
           LK+FEK  FLKLKGKGDDL++VG+NKDKDELK FVPY+IG+  +   +K+ + +   + +
Sbjct: 296 LKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGVSV 355

Query: 354 QAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTL 413
            +V+LYKPI+  ++F K  ++    ++T+ E++  ++ YI              +LDD L
Sbjct: 356 SSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLL 415

Query: 414 FPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIPEIQIV 472
           F M+NR  +     R I RA I+ P +ANNF E+FQ+ KGD  PLFK  +KG  P+I IV
Sbjct: 416 FAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIV 475

Query: 473 TEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTL-EVTVQGPHG 531
           TEMKIGRKVVT+VSNFE F++  E LAA+LRK CSGSTTI ET   PK + EV VQGPHG
Sbjct: 476 TEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISET---PKKVSEVQVQGPHG 532

Query: 532 AIVIGMLNEYGIPTKWINFQ 551
            ++I   N+ GIP+K+I F+
Sbjct: 533 QLIIDHFNKSGIPSKFIQFE 552

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  513 bits (1321), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 259/561 (46%), Positives = 362/561 (64%), Gaps = 17/561 (3%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK P IK+ SNLKNSERKKLL +VR Q    ++QF T +VKQ TFK  T+ GT++TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            N PI+FKEKH   + PT+ TCW  P +L VV THKHV++ KL  GADLMLPG +PPFS 
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
            C++G LVGVAS+ +P V++AIG+ QL+L    +V+GETGVAV ++HT +DGL + FKM 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNT-----------EDASEQL 229
           +EPP  +    S+  E E E +  AD+A  I          T            + +EQL
Sbjct: 181 VEPPSQL--LVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQL 238

Query: 230 NELSAEDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWK 289
            ELS E +DHFLT+++YYTL  D+ L+LP+ ASNF++NH++ NLP +   Q+++K+SSW 
Sbjct: 239 EELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWA 298

Query: 290 KSAKFLKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQEN 349
           +++KFLK+FE   FLKLKGK ++L VV +NKDK E+K F PYR       T +K   + +
Sbjct: 299 RASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNNDKHD 358

Query: 350 SNMMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLL 409
              ++ V  Y+P+++AK    A+   PN +  A+++KA L+ Y+              LL
Sbjct: 359 ---VEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILL 415

Query: 410 DDTLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLFKTALKGAIPEI 469
           DDTLF +  + +  ++  R + RA++    L+ +FTE F I K   PL    LK     +
Sbjct: 416 DDTLFSLAYKKSASDST-RKVLRAKMFDLILSTSFTEVFFIFKDGKPLSSKPLKSKNRNV 474

Query: 470 QIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGP 529
            ++TEMKI RK+VT++SNFE + +D E L+ ELRKRCSGS+T+ E  +   T EV VQGP
Sbjct: 475 SVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGP 534

Query: 530 HGAIVIGMLNEYGIPTKWINF 550
           HG   I +LNE+GIP+K+I+F
Sbjct: 535 HGNTAINILNEHGIPSKYIDF 555

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  499 bits (1286), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 263/570 (46%), Positives = 368/570 (64%), Gaps = 30/570 (5%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MF K+PHIK LSNLKNS+RKKL ++++ Q    +Y  PT V+KQT+F+    AG++YTDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWS-NPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFS 119
            N PIWFK K    ++PT+F+ W+    +LP++ TH  V+E+ +L GA LMLPG VPPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 SKCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKM 179
           S   +GS+VG+AST+ P ++KAIGI ++DL   + VIG  G+AV ++H  DDGL KAFK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KLEPPE-----------AIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQ 228
           +LEPP            AIE  +SK  EQ +E      E+  +  ++    VN  + +++
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDE------ESNHLERSSSQSPVN--EIADE 231

Query: 229 LNELSAEDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSW 288
           L E+S ED+DH L R++ Y++  DD++ LP+ AS F+SNH++ NLP VD N +N+KKSSW
Sbjct: 232 LEEMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSW 291

Query: 289 KKSAKFLKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYR-IGSHGEPTQTKAKAQ 347
           KK+ K LK+ E   FLKLKGK D   V+ +NK+  +L     Y+ + +  + +      Q
Sbjct: 292 KKATKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQ 351

Query: 348 ENSNMMQAVS---LYKPISSAKEFSKAVDLP-PNKIFTAQELKAALDSYIXXXXXXXXXX 403
            N N + A S   LYKP+S+ + F   +    P   +T QELK  LD Y+          
Sbjct: 352 SNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPEN 411

Query: 404 XXXXLLDDTLFPMINRSTKKENALRTISRAQIMPP-FLANNFTEHFQILKGD-VPLFKTA 461
                 DDTL+ M NR+  +   ++ I+R  I+ P FL+ NF  + QI K +  PL K  
Sbjct: 412 KSLVKYDDTLYQMSNRA-PQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVP 470

Query: 462 LKGAIPEIQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKT 521
            KG IP ++IVTE KIGRKV+T+V+NFEKF++D+E LAA LRK+CSGSTTIGE+ S+ KT
Sbjct: 471 EKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKST-KT 529

Query: 522 LEVTVQGPHGAIVIGMLNEYGIPTKWINFQ 551
            EV VQGPHG+IVI +LN+YGIPTKWI+F+
Sbjct: 530 AEVQVQGPHGSIVISILNDYGIPTKWISFE 559

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  486 bits (1250), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 243/550 (44%), Positives = 344/550 (62%), Gaps = 18/550 (3%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+P++   SN KNSERK+L AS+REQ E   YQF +  +K  TFK Q++ GTVYTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            N+P+WF+ KH     PTV++CW +PD+LPVV TH+HVVE KL  GADLMLPG VPPFSS
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
              +G +VG+ASTR+P V+KA+GI ++DL   T V   TGVAV ++HT+ DGLC+ FK++
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSAEDIDHF 240
            E PEA E   +  E +E E                 +    E  +E+L  L+ ED+DH 
Sbjct: 181 REAPEASEAKGASPEAREPE-------------AEPPKTAPGEGLAEELERLTMEDVDHL 227

Query: 241 LTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHFEK 300
           LTR++YYT+  D RLQLPV AS F++ H+L NLPP+D +Q+ +K+SSW K+AK LKHFE 
Sbjct: 228 LTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEA 287

Query: 301 ANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNMMQAVSLYK 360
              L LKGK +   VV +N   + LK F PYR  S  +   T +K    +  ++ V  Y 
Sbjct: 288 QGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVS--DKASTGSKNSSTTQSLEIVYHYV 345

Query: 361 PISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTLFPMINRS 420
           P  +       + +      +A++++  L+ Y+               LDDTL  +++++
Sbjct: 346 PNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLHKN 405

Query: 421 TKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLFKTALKGAIPEIQIVTEMKIGRK 480
              +   R++ R + +   L+ +F+E+F +++GD PL K   KG  P I++  E KI +K
Sbjct: 406 VNADTP-RSLPRPEALAALLSRSFSEYFVVMRGDAPLSKPQ-KGRAPPIKVTNERKIYKK 463

Query: 481 VVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVIGMLNE 540
           VVTKVSNFE + +D E LAAELR RCSGSTTI +  ++ K +EV VQGPH A ++ +LN+
Sbjct: 464 VVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT-KAVEVQVQGPHEATIVSILNK 522

Query: 541 YGIPTKWINF 550
           +GIP+K+I  
Sbjct: 523 HGIPSKYITL 532

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  469 bits (1206), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 242/557 (43%), Positives = 342/557 (61%), Gaps = 12/557 (2%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK+  I  LSNLKNSE + +  + R+    ++Y+FP   VKQTTF+   + G +YTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120
            NVPIWFK+K+ + + PTV+T W  P+ +P+++TH  ++E K+  GA+LM+PG V P   
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180
           +   G + G+AST+ P  I AIG+   D+ +    +G+TGVAV ++H + D L   FK+K
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 LEPPEAIEDTSSKT------EEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSA 234
           L PP  +  ++ KT      E   +E  ++  E K  A        N +D +E L +L  
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240

Query: 235 EDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKF 294
           EDID+FLT+SLYYT+TQ+  LQLP+ +S FVS +++ NLP VDHNQ+N+KKSSWKK+AKF
Sbjct: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300

Query: 295 LKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNMMQ 354
           LKHFEK  FLKLKGKGDDL + G NK+K +LK FVPYRIG       +K K Q+N N ++
Sbjct: 301 LKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDK-QDNKNFLK 359

Query: 355 AVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDDTLF 414
            V+LY P         A+ L     FT+ E+ +A+  YI               +DD LF
Sbjct: 360 VVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLF 419

Query: 415 PMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIPEIQIVT 473
            ++  +  K NA R I R+Q++ P L NNF  + Q+   D + L K   KG+ P +++VT
Sbjct: 420 DLV-ITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMVT 478

Query: 474 EMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAI 533
           E     KV+T+VSNFE F +DA+ ++ EL+  CSGST+I E    P   EV VQGPHG I
Sbjct: 479 EKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEVQVQGPHGDI 535

Query: 534 VIGMLNEYGIPTKWINF 550
           V+    ++GIP KW ++
Sbjct: 536 VMEYFEKHGIPRKWFDY 552

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  438 bits (1126), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 249/562 (44%), Positives = 360/562 (64%), Gaps = 22/562 (3%)

Query: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60
           MFKK PHIK LSNLKNSE++KL   V++Q  V ++ F    VKQT F+  TS GT+Y ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  QN--VPIWFKEKHGS-LMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPP 117
           +   VP++FKEKHGS  ++P+V+ CWS+P +LP++ TH  V+E+ L  GA+LM+ G +PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FS-SKCSKGSLVGVASTRSPRVIKAIGIVQLDLPSY--TRVIGETGVAVNIIHTFDDGLC 174
           F  +   KG   G+A+ +SP VI A+G +++DL  +  T V+G +GV V + H F DGL 
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 KAFKMKLEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSA 234
            AF++KL+ P+ +E  S+ T+E  EE      EAK  +  T    V  +D +E L  LS 
Sbjct: 181 DAFRLKLDIPDKLE--SATTQEVAEE---PPVEAKPTSPVTNP--VAVDDLAEVLETLSV 233

Query: 235 EDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPP-VDHNQINMKKSSWKKSAK 293
           ED+D+F+TR+LYYTLTQ+ +L LP+NASNF+S H++  LP  +D  ++N+KKSSWKK+AK
Sbjct: 234 EDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAK 293

Query: 294 FLKHFEKANFLKLKGKGDDLVVVGINKDKDE--LKKFVPYRIGSHGEPTQTKAKAQENSN 351
           +LKHFEK   LKLKGKGDDLVVVG    K    LK FVPY +G+    +  K++   N  
Sbjct: 294 YLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTT-NGP 352

Query: 352 MMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYIXXXXXXXXXXXXXXLLDD 411
           +M AV+ ++P S+A+    A+ L   + F+  E++  L+ YI              LL+D
Sbjct: 353 VMFAVTSFQPDSTAQ---TALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLND 409

Query: 412 TLFPMINRSTK-KENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIPEI 469
           TLF M+ +  + K+   R ++R +I+   +  +F   +Q+ K  D PL K   KG  P++
Sbjct: 410 TLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKV 469

Query: 470 QIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGP 529
            I+TEMKIGRKVVT+V NF+   +     AA+LRK CS STTIG+T+S+P   E+ VQG 
Sbjct: 470 HIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQGA 529

Query: 530 HGAIVIGMLNEYGIPTKWINFQ 551
           HG ++I  L E G+P+ W+ F+
Sbjct: 530 HGPLIIDHLRELGVPSSWVVFE 551

>Skud_15.449 Chr15 (789127..789576) [450 bp, 149 aa] {ON} YOR286W
          (REAL)
          Length = 149

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 4  KDPHIKALSNLKN----SERKKLLASVREQREVSDYQFPTQV 41
          K P I     +KN       KKLL  VRE +EV DY+ PT +
Sbjct: 28 KAPKIYTFEQVKNLVEHPNDKKLLVDVREPKEVKDYEMPTTI 69

>YOR286W Chr15 (850280..850729) [450 bp, 149 aa] {ON}  RDL2Protein
          with rhodanese activity; contains a rhodanese-like
          domain similar to Rdl1p, Uba4p, Tum1p, and Ych1p;
          overexpression causes a cell cycle delay; null mutant
          displays elevated frequency of mitochondrial genome
          loss
          Length = 149

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 4  KDPHIKALSNLKN----SERKKLLASVREQREVSDYQFPTQV 41
          K P I     ++N       KKLL  VRE +EV DY+ PT +
Sbjct: 28 KAPKIYTFDQVRNLVEHPNDKKLLVDVREPKEVKDYKMPTTI 69

>KLTH0F16786g Chr6 (1359602..1360645) [1044 bp, 347 aa] {ON} weakly
           similar to uniprot|P38909 Saccharomyces cerevisiae
           YOR037W CYC2 Mitochondrial protein required for normal
           abundance of mitochondrial cytochrome c (Cyc1p) and for
           mitochondrial osmotic stability may be involved in
           regulating the activity of cytochrome c heme lyase
           (Cyc3p) potential Cdc28p substrate
          Length = 347

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%)

Query: 473 TEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGA 532
           T +++     TK    +  Q+D E    EL+  C  ST I + M S K   V V+ P   
Sbjct: 53  TNVELSEDYFTKYQVTQNMQIDDEHFMLELKPLCPQSTNIWDLMKSKKLWSVQVKQPEIM 112

Query: 533 IV 534
           +V
Sbjct: 113 VV 114

>Smik_3.69 Chr3 (94751..99673) [4923 bp, 1640 aa] {ON} YCL014W
           (REAL)
          Length = 1640

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 426 ALRTISRAQIMPPFLANNFTEHFQILKG---DVPLFKTALKGAIPEIQIVTEMKI 477
           +L  +    I  P+    +T H    K    D+ LF      AIPE ++ TEMKI
Sbjct: 338 SLEVLKACSITIPYFYKAYTRHEAATKNFSKDIKLFIRHFHSAIPEREVYTEMKI 392

>Suva_8.334 Chr8 (590004..590453) [450 bp, 149 aa] {ON} YOR286W
          (REAL)
          Length = 149

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 4  KDPHIKALSNLKN----SERKKLLASVREQREVSDYQFPTQV 41
          K P I +   +KN        KLL  VRE +EV DY+ PT +
Sbjct: 28 KAPKIYSFEQVKNLVEHPNDTKLLVDVREPKEVEDYKMPTTI 69

>Smik_15.466 Chr15 (800319..800768) [450 bp, 149 aa] {ON} YOR286W
          (REAL)
          Length = 149

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (72%)

Query: 20 KKLLASVREQREVSDYQFPTQV 41
          KKLL  VRE +EV DY+ PT +
Sbjct: 48 KKLLVDVREPKEVKDYKMPTAI 69

>Skud_3.46 Chr3 (75252..80108) [4857 bp, 1618 aa] {ON} YCL014W
           (REAL)
          Length = 1618

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 3/55 (5%)

Query: 426 ALRTISRAQIMPPFLANNFTEHFQILKG---DVPLFKTALKGAIPEIQIVTEMKI 477
           +L  +    +  P+    +T H    K    DV LF      AIPE  I TEMKI
Sbjct: 338 SLEVLKACSMTIPYFYKAYTRHEAATKNFSKDVKLFTRHFSNAIPERDIYTEMKI 392

>ZYRO0D09636g Chr4 complement(819030..819564,819630..819640) [546
           bp, 181 aa] {ON} similar to uniprot|P89886 Saccharomyces
           cerevisiae YER007C-A TMA20 Protein of unknown function
           that associates with ribosomes
          Length = 181

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 10/114 (8%)

Query: 65  IWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS---- 120
           I F +K   L+ PT+      PD  P VQ  +  ++  +L GA++M PG+  P +S    
Sbjct: 67  ILFFQKFAELI-PTLKLVHKFPDAYPTVQVDRGAIK-FVLSGANIMCPGLTSPGASLPEA 124

Query: 121 -KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGL 173
               K S+V + +      + AIG + +       +    G  V +IH   D L
Sbjct: 125 PGYEKDSVVVINAENKESAL-AIGKLMMSTEEIKSI--NKGHGVEMIHHLSDPL 175

>KAFR0D01890 Chr4 complement(376752..382640) [5889 bp, 1962 aa] {ON}
            Anc_5.31 YGR271W
          Length = 1962

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 7/114 (6%)

Query: 4    KDPHIKALSNLKNSERKKLLASVREQREVSDY--QFPTQVVKQTTFKGQTSAGTVYTDEQ 61
            K+P ++ L +L+  E  +L+ + +  R++     +FP  +++   F   T+   ++   +
Sbjct: 957  KNPSMEHLLDLEEDELGELVHNQKMGRKLYTLLSRFPKIIIESEIFPITTNVMRIHVSLE 1016

Query: 62   NVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGA---DLMLP 112
               IW    HG   F  VF   SN     ++   K ++  + LK A   D M+P
Sbjct: 1017 PAFIWDIRIHGDAQFFWVFVEESNKS--EILHFEKFILNRRQLKHAHEMDFMIP 1068

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,839,377
Number of extensions: 2360636
Number of successful extensions: 12133
Number of sequences better than 10.0: 75
Number of HSP's gapped: 12455
Number of HSP's successfully gapped: 76
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)