Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16852g8.270ON64464433610.0
Kwal_56.237668.270ON7405088241e-99
KLTH0G13508g8.270ON6455147361e-87
AGR078C8.270ON7155485142e-55
ZYRO0C01474g8.270ON5994245031e-54
Kpol_392.18.270ON4244304798e-53
Ecym_43008.270ON7155504912e-52
TDEL0F039708.270ON6194394644e-49
Smik_4.3628.270ON6484364408e-46
Suva_2.2778.270ON6494304391e-45
Skud_4.3788.270ON6524314339e-45
YDR118W (APC4)8.270ON6524294214e-43
TPHA0J007908.270ON6854534047e-41
KAFR0B054608.270ON6104253329e-32
TBLA0C045708.270ON6083463142e-29
KNAG0H031908.270ON6224923009e-28
CAGL0B01859g8.270ON6224802883e-26
NCAS0B037908.270ON6124282769e-25
NDAI0J012708.270ON7354822672e-23
KLLA0F19316g8.270ON6713451842e-13
Ecym_60672.401ON52258950.007
KLLA0F17237g2.401ON52361900.029
Sklu_YGOB_Anc_2.4012.401ON52061900.034
ADR242C2.401ON52162890.044
TPHA0G026502.401ON51658880.045
NDAI0H027502.401ON51260880.048
KAFR0A003802.401ON51658860.085
Smik_13.3292.401ON50960860.086
YMR131C (RRB1)2.401ON51160840.17
Skud_13.2912.401ON50960840.18
Suva_13.3112.401ON51060830.19
NCAS0F019702.401ON51161820.24
CAGL0K03861g2.401ON51358820.25
Kpol_1041.202.401ON51561800.50
TBLA0B092502.401ON52663800.50
KNAG0E021802.401ON51762780.74
Kwal_47.178272.401ON52358771.1
KLTH0E09394g2.401ON52258733.2
NCAS0B054608.155ON268873725.4
Kwal_26.80612.539ON126761716.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16852g
         (644 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...  1299   0.0  
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   322   1e-99
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   288   1e-87
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...   202   2e-55
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   198   1e-54
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   189   8e-53
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...   193   2e-52
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   183   4e-49
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   174   8e-46
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   173   1e-45
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   171   9e-45
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   166   4e-43
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   160   7e-41
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   132   9e-32
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   125   2e-29
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   120   9e-28
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   115   3e-26
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   110   9e-25
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   107   2e-23
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    75   2e-13
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    41   0.007
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    39   0.029
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    39   0.034
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    39   0.044
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    39   0.045
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    39   0.048
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    38   0.085
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    38   0.086
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    37   0.17 
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    37   0.18 
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    37   0.19 
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    36   0.24 
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    36   0.25 
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    35   0.50 
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    35   0.50 
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    35   0.74 
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    34   1.1  
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    33   3.2  
NCAS0B05460 Chr2 (1024533..1032599) [8067 bp, 2688 aa] {ON} Anc_...    32   5.4  
Kwal_26.8061 s26 complement(628772..632575) [3804 bp, 1267 aa] {...    32   6.4  

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score = 1299 bits (3361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/644 (98%), Positives = 632/644 (98%)

Query: 1   MVKWEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDY 60
           MVKWEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDY
Sbjct: 1   MVKWEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDY 60

Query: 61  QWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFS 120
           QWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFS
Sbjct: 61  QWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFS 120

Query: 121 NVFDHEITSLMPRLVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKIL 180
           NVFDHEITSLMPRLVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKIL
Sbjct: 121 NVFDHEITSLMPRLVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKIL 180

Query: 181 MAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDF 240
           MAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDF
Sbjct: 181 MAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDF 240

Query: 241 LNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLIGDLTEL 300
           LNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLIGDLTEL
Sbjct: 241 LNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLIGDLTEL 300

Query: 301 LFTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLH 360
           LFTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLH
Sbjct: 301 LFTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLH 360

Query: 361 XXXXXXXXXXXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHD 420
                       ELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHD
Sbjct: 361 GIIKGLKLIGLKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHD 420

Query: 421 MVMEAVDEDYKRKTSYNCDPLKIQQFMSGSLTGVHTYEWCQYSFPAVTNRLGKQFETVEQ 480
           MVMEAVDEDYKRKTSYNCDPLKIQQFMSGSLTGVHTYEWCQYSFPAVTNRLGKQFETVEQ
Sbjct: 421 MVMEAVDEDYKRKTSYNCDPLKIQQFMSGSLTGVHTYEWCQYSFPAVTNRLGKQFETVEQ 480

Query: 481 LYVANWVVQRVKFGEPICIKKGLEKTRVKDVGVDTGKQLLFLYQDNDSKELVVSKYSLDL 540
           LYVANWVVQRVKFGEPICIKKGLEKTRVKDVGVDTGKQLLFLYQDNDSKELVVSKYSLDL
Sbjct: 481 LYVANWVVQRVKFGEPICIKKGLEKTRVKDVGVDTGKQLLFLYQDNDSKELVVSKYSLDL 540

Query: 541 DPTTNHIAQESITLTIEDVSSVKDAKFSADYKSIFVLHENGSSLSQVELQVNPEGRLLAF 600
           DPTTNHIAQESITLTIEDVSSVKDAKFSADYKSIFVLHENGSSLSQVELQVNPEGRLLAF
Sbjct: 541 DPTTNHIAQESITLTIEDVSSVKDAKFSADYKSIFVLHENGSSLSQVELQVNPEGRLLAF 600

Query: 601 GRNSTLVDDLQNCDFDSIQINRHQIALVSSNRNRFGIASPPRQI 644
           GRNSTLVDDLQNCDFDSIQINRHQIALVSSNRNRFGIASPPRQI
Sbjct: 601 GRNSTLVDDLQNCDFDSIQINRHQIALVSSNRNRFGIASPPRQI 644

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  322 bits (824), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 183/508 (36%), Positives = 279/508 (54%), Gaps = 36/508 (7%)

Query: 4   WEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWE 63
           W++  V T P   ++VWNP LSL+LV T K IAVNR +DGQ+IA V+++D   IV  QWE
Sbjct: 5   WKLKGVVTLPKGHKVVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWE 64

Query: 64  QSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGD----SDCDVLKFCWSQDSWTFGSKF 119
           ++E ++FAV  SNG++R+YD S+ G     V L +    ++  V    W    W    + 
Sbjct: 65  KNESKLFAVFQSNGVVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPES 124

Query: 120 SNVFDHEITSLMPRLVKFVKDSRQLTMLPTDVGDGVPRWSKLDG--NKSFIFLGYDSKRQ 177
               D +IT+LMP +V+ V+DS+QL++ P D+G    + S LDG    + IFL +D +  
Sbjct: 125 YRGLDFDITTLMPGMVRLVRDSKQLSLAPLDLG----KLSWLDGKYGDAAIFLAHDCEST 180

Query: 178 KILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKY----DNGEYLVITDDWYI 233
           + ++AIDG   L F                  P+ +R++ K      +G +L +  D  +
Sbjct: 181 EYMVAIDGQLSLRF------------------PSGIRNVHKILPQGGSGSFLAVGKDGTL 222

Query: 234 QKIKFDFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEG-D 292
           Q +   FL C L RE++    +IR L + L E+VSL  TEL+EPY  F+ R++GAYEG D
Sbjct: 223 QWVTLKFLECALMRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDD 282

Query: 293 LIGDLTELLFTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERL 352
           L   L ++L TG +P +LE+WL N++GDKN +RWK+LS+ MY +   ++ L +VP CERL
Sbjct: 283 LATRLRDILLTGYIPDDLEEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERL 342

Query: 353 ILCGERLHXXXXXXXXXX-XXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLH 411
           IL  ER+              +    L  +E Q L+   Q  LE  +  I ++N D+ LH
Sbjct: 343 ILAAERMQGIHKSLKLQRFCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALH 402

Query: 412 EAFIDWFHDMVMEAVDEDYKRKT--SYNCDPLKIQQFMSGSLTGVHTYEWCQYSFPAVTN 469
           + F +WF+D+VME VDEDYKR +      D   + Q++S       T +  + S P +  
Sbjct: 403 QVFAEWFYDVVMETVDEDYKRPSRDGIPLDSYGLDQYLSYCWQSSETIQRFETSLPELAA 462

Query: 470 RLGKQFETVEQLYVANWVVQRVKFGEPI 497
           R G     +++ Y   W++  +   E +
Sbjct: 463 RPGVSAALLDRKYTREWLLADIHVTETV 490

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  288 bits (736), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/514 (32%), Positives = 264/514 (51%), Gaps = 41/514 (7%)

Query: 3   KWEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQW 62
           KW+   +   P  + +VWNP LSL+LV   K ++VNR +DGQRIA V+++  G ++  QW
Sbjct: 4   KWQFKRLIKLPKHRGVVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQW 63

Query: 63  EQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGD----SDCDVLKFCWSQDSWTFGSK 118
           E +EG++FA+   NG +R+YD +  G     V L D    +D  V    WS   W    +
Sbjct: 64  ELAEGKLFALFFGNGAVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQ 123

Query: 119 FSNVFDHEITSLMPRLVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQK 178
                + EIT  +P +V+ V+D++QL+++P + G    RW    G  + IFLG+D K   
Sbjct: 124 EYKGLNIEITKQLPGMVRLVRDAKQLSVVPLETGK--LRWLADPGKDAAIFLGHDEKSGD 181

Query: 179 ILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKY----DNGEYLVITDDWYIQ 234
            LM +DG   +                   VP+ ++ + K     ++G ++ +  D  +Q
Sbjct: 182 YLMTVDGLLSV------------------RVPSGIKKMHKILRQGEDGTFVGVGADGTVQ 223

Query: 235 KIKFDFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYE-GDL 293
            +   FLN  L RE+I    +IR L   L E++++ KT+L+EPY QF+ R+  AYE G+L
Sbjct: 224 WVVLRFLNSALMRELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGEL 283

Query: 294 IGDLTELLFTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLI 353
                +++ +G +P +LEDWL N+IGDKN +RWK+LS+ MY +   ++ L ++P CERLI
Sbjct: 284 ASRFRDIILSGYIPEDLEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLI 343

Query: 354 LCGERL---HXXXXXXXXXXXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNL 410
           L  E+L   H              E   E  E  +L+   Q  L   +  +  +N D+ L
Sbjct: 344 LAAEQLQGIHKGLKLQEFGLASPQE--FESAEVTELITGCQALLHASLELVVDLNRDTRL 401

Query: 411 HEAFIDWFHDMVMEAVDEDYKR-------KTSYNCDPLKIQQFMSGSLTGVHTYEWCQYS 463
           H  F DWF+D+VME VDEDYKR       +  Y    L + Q++S        +   +  
Sbjct: 402 HAIFADWFYDVVMETVDEDYKRPQNRDSHQDCYGDRALALDQYISHCWENSEVWTRFERL 461

Query: 464 FPAVTNRLGKQFETVEQLYVANWVVQRVKFGEPI 497
            P +          ++ +Y   WV+++V    P+
Sbjct: 462 LPQLAADADISATKLDHIYTRAWVLEQVHVTSPV 495

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score =  202 bits (514), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 142/548 (25%), Positives = 263/548 (47%), Gaps = 47/548 (8%)

Query: 1   MVKWEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVK--DHGTIV 58
           M +W+V   K + G+    WN  LSL+ V   + +++ R +DG+R+  + ++   +  ++
Sbjct: 1   MTQWKVKLTKQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL 60

Query: 59  DYQWEQSEGRIFAVCHSNGIIRLY---------DSSLAGKSVGSVILGDSDC-DVLKFCW 108
             QWE  +G +FAV   +G +++Y         + S   + VG+V+LG  D   + +F W
Sbjct: 61  RCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVW 120

Query: 109 SQDSWTFGSKFSNVFDHEITSLMPRLVKFVKDSRQLTMLPTDVGDGVPRW-SKLDGNKSF 167
           ++  W     F   FD  +   +PRL + +  S Q  +L T +G   P W + L  ++S 
Sbjct: 121 NRIKWRVREPFCGEFDSPLVQWLPRLTE-MSISAQGKLLCTPLGYEGPEWNAGLAADESN 179

Query: 168 IFLGYDSKRQKILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVI 227
           +FL +D+  +K++++IDG F              R  E    P  V  IL  +   Y+ I
Sbjct: 180 MFLTFDNNTRKVVLSIDGTFNF------------RYGEKSKFPTKVTSILPGNENHYVFI 227

Query: 228 TD-DWYIQKIKFDFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVL 286
            D DW +Q I+ +F   +   E++ CC+ I+ L K + ++  L+ T+L+EP+  F   + 
Sbjct: 228 NDEDWQLQVIRLEFTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLF 287

Query: 287 GAYE-GDLIGDLTELLFTG-SVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLT 344
              +    +  L ++ + G S    +E+W +  +G      WK+ + + + ++  ++V  
Sbjct: 288 PEEQFTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTC 347

Query: 345 MVPVCERLILCGERLHXXXXXXXXXXXXELEDN-LEVLEAQKLVCLSQEALENIIVSIKQ 403
           M+P CERLI+  +RL               +DN L  +E Q L+ +S   L+ ++  ++Q
Sbjct: 348 MIPACERLIVSAKRLLGLVKSLKLNVFGLDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQ 407

Query: 404 INVDSNLHE---AFIDWFHDMVMEAVDEDYKRKT------SYNCDP--------LKIQQF 446
            +V  N+ +   A+I++  D ++   DED           S + DP          +Q F
Sbjct: 408 FHVGENVSKDGLAWIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQLF 467

Query: 447 MSGSLTGVHTYEWCQYSFPAVTNRLGKQFETVEQLYVANWVVQRVKFGEPICIKKGLEKT 506
           ++  +     Y W +  FP+    L +QF+ V++ Y A W+ + +K   P+   K L   
Sbjct: 468 LNEYIIPKKPYSWIKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKVPGPVRKLKSLVGH 527

Query: 507 RVKDVGVD 514
           R++D  VD
Sbjct: 528 RLEDALVD 535

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  198 bits (503), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 124/424 (29%), Positives = 214/424 (50%), Gaps = 39/424 (9%)

Query: 20  WNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGII 79
           +NPV  L++    +G +V+R  D  RIAT+ V+D   +  YQW+   G+  ++ + +G +
Sbjct: 8   YNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDGTV 67

Query: 80  RLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNV----FDHEITSLMPRLV 135
           R+YD   +G+ V   +L  S    +   W  D         N+     DH++T +MP++V
Sbjct: 68  RIYDGFRSGRLVS--LLRASSNGAVSGIW--DRIELLHSEENIKDWSIDHDVTEMMPKMV 123

Query: 136 KFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKILMAIDGAFKLSFSVAA 195
           KF +DSRQL ++P  +   V R    D   + +          + +  DG F +S  +AA
Sbjct: 124 KFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLSVMFDGEFTISIQLAA 183

Query: 196 LVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDFLNC---NLTREMISC 252
                        +P+ +   +   + +YL    D  +++  FD  N      +  ++  
Sbjct: 184 -------------IPSPLVKFVSAQH-QYLAFYQDGSVER--FDLANLVKDPFSLRLLKN 227

Query: 253 CNRIRSLHKQLHESVSLVKTELVEPYTQFIERVL-GAYEG-DLIGD-LTELLFTGSVPPE 309
              +R LH+ L + + L++ +L++PY +F+ER   GA+ G DL+ + L +L+  G V PE
Sbjct: 228 VITMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPE 287

Query: 310 LEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXXXXXXXX 369
           LEDWL N++G+KNL+RW+KL +  Y   ++++ L  +P CERLI  G+R           
Sbjct: 288 LEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLSRQLT 347

Query: 370 XXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDED 429
               L   ++ L         Q  L+N++ +I  ++    L  +F+DWF D V E++DED
Sbjct: 348 LQLPLLPPIDCL---------QFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDED 398

Query: 430 YKRK 433
           YK +
Sbjct: 399 YKLR 402

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  189 bits (479), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 123/430 (28%), Positives = 218/430 (50%), Gaps = 37/430 (8%)

Query: 20  WNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGII 79
           +NP   L++  + +G+AV R  D  ++A + +KD  T+  Y+W+   GR  +V  ++G I
Sbjct: 14  YNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTI 73

Query: 80  RLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNVFDHEITSLMPRLVKFVK 139
           R+YD    G+ V S I   S  +V    W +  ++  SK   +FD  I   +P L+KFVK
Sbjct: 74  RIYDIFKNGRLV-SYIRSSSQKNVDSCLWDRAEFSIPSKLQ-LFDSNIIECLPTLIKFVK 131

Query: 140 DSRQLTML----PTDVGDGVPRWSKLDGNKSFIF-------LGYDSKRQKILMAIDGAFK 188
           DSR + ++    P      V + S+ D +K   F       + ++       + ++G ++
Sbjct: 132 DSRNINIIDYYPPNHSWRHVDKESQ-DTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYE 190

Query: 189 LSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNCNLTR 247
           ++  V   ++  E           V  +LK  NGEY+    + + +KI F+  L+CN++ 
Sbjct: 191 INGIVMPDISKSE-----------VYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSN 239

Query: 248 EMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERV-LGAYEGDLI---GDLTELLFT 303
            ++S    IR+L++ +++ + L+K EL+ PY+ F++++ + AY G +     +L  LL T
Sbjct: 240 GLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLT 299

Query: 304 GSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXX 363
           G +  E +DWL N IGD+N ++W+KL   M+E  VKI+ L ++P CER ++  ER     
Sbjct: 300 GEINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYL 359

Query: 364 XXXXXXXXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVM 423
                     ++ + +  +   L     + + N I  I  +N      E F +W +D + 
Sbjct: 360 NGY-------MKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKIN 412

Query: 424 EAVDEDYKRK 433
           E  DEDYK +
Sbjct: 413 EITDEDYKNR 422

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score =  193 bits (491), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 136/550 (24%), Positives = 262/550 (47%), Gaps = 51/550 (9%)

Query: 1   MVKWEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSV--KDHGTIV 58
           M +W+V   K + G     WN  LSL+ +     + + R +DG+++ ++ +  K +  I+
Sbjct: 1   MTQWKVKLTKQWDGLVDPFWNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEIL 60

Query: 59  DYQWEQSEGRIFAVCHSNGIIRLY---------DSSLAGKSVGSVILGDSD-CDVLKFCW 108
             Q E ++G +FAV   +G +++Y         D +     VG+++LG  +  ++ +F W
Sbjct: 61  TCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVW 120

Query: 109 SQDSWTFGSKFSNVFDHEITSLMPRLVKF-VKDSRQLTMLPTDVGDGVPRW-SKLDGNKS 166
           ++  W     F   FD  +T  +P+L +  V    +LT  P +  +G P W + L  N+S
Sbjct: 121 NRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEF-EG-PEWNASLSENES 178

Query: 167 FIFLGYDSKRQKILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLV 226
            +FL YD+  +K++++IDG F              R  E +  P  V +IL  +   Y+ 
Sbjct: 179 NMFLTYDNATRKVMVSIDGTFNF------------RYGEKNKFPTKVTNILSGNANNYVF 226

Query: 227 ITD-DWYIQKIKFDFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERV 285
           + D DW +Q IK +F   +   E++ CC++I+ L K L ++  ++  +L+EP+  FI  +
Sbjct: 227 LNDEDWQLQIIKLEFTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSL 286

Query: 286 LGAYEGD-LIGDLTELLFTG-SVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVL 343
               +   L+  L ++ + G S    +E+W +  +G   +  WK+ + + + ++  I+V 
Sbjct: 287 FPDEQASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVT 346

Query: 344 TMVPVCERLILCGERLHXXXXXXXXXXXXELEDNLEVL--EAQKLVCLSQEALENIIVSI 401
            M+P CERLI+  +RL              L+D+ E++  E  +L+ +  + L  I+  +
Sbjct: 347 CMIPACERLIVAVKRLQGLIKSLKLNIFG-LDDDEELIAPEVDELLQMGLDTLTEIVKQV 405

Query: 402 KQINVDSNLHEAFIDWFHDMVME-----------------AVDEDYKRKTSYNCDPLKIQ 444
           ++ ++  N+    + W   M+                   A+  D     +Y  +    Q
Sbjct: 406 EKFHIGENMSIDGLTWIEYMIDSLLRGEEDDGNNSNGQDCALSNDVDALDTYPKEHYSTQ 465

Query: 445 QFMSGSLTGVHTYEWCQYSFPAVTNRLGKQFETVEQLYVANWVVQRVKFGEPICIKKGLE 504
            F++  +    TY+W +  FP     L +QF+ V++ Y A W+ + +K   PI   + + 
Sbjct: 466 LFLNNFVLPTQTYKWIKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKVSGPIRKLRSIT 525

Query: 505 KTRVKDVGVD 514
             R+KD  +D
Sbjct: 526 GQRLKDAIMD 535

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  183 bits (464), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 134/439 (30%), Positives = 221/439 (50%), Gaps = 48/439 (10%)

Query: 20  WNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGII 79
           +NP+ SL+     KG+++ R  D  +IATV+V+D   +  +QW+   G+   V + +G  
Sbjct: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70

Query: 80  RLYDSSLAGKSVGSVILGDSDCDVL---KFCWSQDSWTFGSKFSNVFDHEITSLMPRLVK 136
           R+YD+  AGK +  + +  +  D     +   S+   TF       FDH + + MP++++
Sbjct: 71  RIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFK------FDHFVLNSMPKMIR 124

Query: 137 FVKDSRQLTMLP-----------TDVGDGVPRWSK-LDGNKSFIFLGYDSKRQKILMAID 184
           F +D+RQ+ +LP           T+  DGV R  + LD     + L +      +LM +D
Sbjct: 125 FARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILD-----VHLVHQEDNGLVLM-LD 178

Query: 185 GAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNC 243
           G F L            RL  G S P  ++DI+  D G Y    +D  ++ +  D  + C
Sbjct: 179 GDFIL------------RLAAGPSGPA-LKDIVVADRGLYHCFYEDATVESLSLDQLIQC 225

Query: 244 NLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEG--DLIGDLTELL 301
           + T ++I     I+ L+  L + + L+K +LV PYT+F+ ++  A  G   L  +L  LL
Sbjct: 226 DATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLL 285

Query: 302 FTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHX 361
             G +  ELE+W   T+G+KN ++WKK+   MY+  ++I+ L+ +P CER+IL  ER   
Sbjct: 286 LGGGLSVELENWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRA 345

Query: 362 XXXXXXXXXXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDM 421
                         D+ E      L  LSQ  L + + +I+ ++    L + F+ WF D 
Sbjct: 346 CLKALQLIESSTTTDSSEF---ANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDR 402

Query: 422 VMEAVDEDYKRKTSY--NC 438
           + EA+DEDYK+K S   NC
Sbjct: 403 LHEALDEDYKQKLSIDSNC 421

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  174 bits (440), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 120/436 (27%), Positives = 205/436 (47%), Gaps = 24/436 (5%)

Query: 13  PGEQRIV-WNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFA 71
           PG    + +NP   +F   T KG+A+NR  D  R+A + +++   + +Y W+   G+  +
Sbjct: 4   PGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLS 63

Query: 72  VCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNVFDHEITSLM 131
           +   +G IR++D    G+ V    L      + K  W +      S   N+  + I   +
Sbjct: 64  IFFKDGTIRIHDIFKDGRLVS--FLRIPSTKISKGTWDRIPLESESGNGNL-AYNIIDYL 120

Query: 132 PRLVKFVKDSRQLTMLPTDVGDGV---PRWSKLDGNKSF-IFLGYDSKRQKILMAIDGAF 187
           P+L+++VKDS+++ ++P    + +   P   + + N+   I + ++    KI +  +G +
Sbjct: 121 PKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDY 180

Query: 188 KLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKF-DFLNCNLT 246
            +   V A        DE +     V+ I+K  +G Y    DD  ++ +     L    +
Sbjct: 181 AIFVPVGA--------DENERF---VKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPS 229

Query: 247 REMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLG-AYEGD-LIGDLTELLFTG 304
             ++     I+ L   L   +  +  ELV PY +F+ R+   AY  D LI +L  L   G
Sbjct: 230 MNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLG 289

Query: 305 SVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXXX 364
            V  +LEDWL N++G+KN +RWK L    Y+   +I+ L  VP CER+I+  E+L     
Sbjct: 290 EVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLR--GI 347

Query: 365 XXXXXXXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVME 424
                   +  D+ ++     L+  SQE L   + SI  +  D  L E F  W +D + E
Sbjct: 348 LEAFSIQNKFNDSSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHE 407

Query: 425 AVDEDYKRKTSYNCDP 440
            +DEDYK K  +  DP
Sbjct: 408 VLDEDYKLKVQFEDDP 423

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  173 bits (439), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 117/430 (27%), Positives = 207/430 (48%), Gaps = 23/430 (5%)

Query: 18  IVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNG 77
           I +NP   +F +  VKG+A++R  D  R+A + V++   + +Y W+ S G+  ++   +G
Sbjct: 6   IDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDG 65

Query: 78  IIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNVFDHEITSLMPRLVKF 137
            IR++D    G+ V    L      + +  W +    + S   N F + +  ++P+L++F
Sbjct: 66  TIRIHDIFKDGRLVS--FLRIPRTKISRGIWDRIPLKYESSNRN-FANNVIDVLPKLIRF 122

Query: 138 VKDSRQLTMLPTDVGDGVPRWSKLDGNKSF----IFLGYDSKRQKILMAIDGAFKLSFSV 193
           VKDS+++T+ P    + + R    D  ++     I + ++    KI +  +G + +   V
Sbjct: 123 VKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILLPV 182

Query: 194 AALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNCNLTREMISC 252
           + +        E + +   ++ ++K  NG Y    +D  +     +  L    + +++  
Sbjct: 183 SDI--------ENEKI---LKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRY 231

Query: 253 CNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEG--DLIGDLTELLFTGSVPPEL 310
              I+ L   L   +  +  EL  PY  F++R+     G   L  +L  L   G VP +L
Sbjct: 232 MMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDL 291

Query: 311 EDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXXXXXXXXX 370
           +DWL N +G+KN +RWK L    Y+  V++  L  VP CER+I+  ++L           
Sbjct: 292 DDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQX 351

Query: 371 XXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDEDY 430
                 +L  +E   L+  SQE L   + SI  +  D  L E F+ WF+D + E +DEDY
Sbjct: 352 XXXXXXDLTAVEL--LLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDY 409

Query: 431 KRKTSYNCDP 440
           K K  +  DP
Sbjct: 410 KPKFEFEDDP 419

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  171 bits (433), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 116/431 (26%), Positives = 206/431 (47%), Gaps = 25/431 (5%)

Query: 18  IVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNG 77
           I +NP   +F     KG+A++R  D  RIA + V++   + +Y W+++ G+  ++   +G
Sbjct: 10  IDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDG 69

Query: 78  IIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKF-SNVFDHEITSLMPRLVK 136
            +R++D    G+ V    L      + +  W  D      ++ S  F + +  ++P+L++
Sbjct: 70  TVRIHDIFKDGRLVS--FLRVPSTKISRGIW--DRIPLKREYDSETFAYNVIDILPKLIR 125

Query: 137 FVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLG----YDSKRQKILMAIDGAFKLSFS 192
           FVKDS++++++P    +G+ R    D  +S   L     ++    KI +  +G + +   
Sbjct: 126 FVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILLP 185

Query: 193 VAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNCNLTREMIS 251
           +  +    ER+ E          ++K  +G Y    +D  ++ +     L    + +++ 
Sbjct: 186 MDDI--ENERILES---------VVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLH 234

Query: 252 CCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEG--DLIGDLTELLFTGSVPPE 309
               I+ L   L   V L+  EL+ PY  F++R+     G   L  +L  L   G V  +
Sbjct: 235 YIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCD 294

Query: 310 LEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXXXXXXXX 369
           LEDWL N++G+KNL++WK L    Y+   +I+ L  VP CER+I+  E+L          
Sbjct: 295 LEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQ 354

Query: 370 XXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDED 429
                  +L  +E   L+  SQE L N + SI  +  +  L E F  WF+D + E +DED
Sbjct: 355 NKSNNTSDLTAVEL--LLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDED 412

Query: 430 YKRKTSYNCDP 440
           YK K  +  DP
Sbjct: 413 YKLKFEFEDDP 423

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  166 bits (421), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 114/429 (26%), Positives = 202/429 (47%), Gaps = 23/429 (5%)

Query: 18  IVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNG 77
           I +NP+  +F     KG+A+ R  D  R+A + +++   + +Y W+ + G+  ++   +G
Sbjct: 10  IDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDG 69

Query: 78  IIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNVFDHEITSLMPRLVKF 137
            IR++D    G+ V    L      + K  W +    +     + F   I   +P+L++F
Sbjct: 70  TIRIHDIFKDGRLVS--FLRIPSTKISKGIWDRIPLRYEPNNRD-FACNIIDDLPKLIRF 126

Query: 138 VKDSRQLTMLPTDVGDGV---PRWSKLDGNKSF-IFLGYDSKRQKILMAIDGAFKLSFSV 193
           VKDS+++ ++P    + +   P    LD N+   + + ++    KI +  +G + +  SV
Sbjct: 127 VKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLSV 186

Query: 194 AALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKF-DFLNCNLTREMISC 252
             +              N+++ I+K  +G Y    +D  +Q +     L    +  +++ 
Sbjct: 187 DNI-----------ENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNY 235

Query: 253 CNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLG-AY-EGDLIGDLTELLFTGSVPPEL 310
              I+ L   +   +  +  EL  PY  F++R+   AY  G L  +L  L   G +  +L
Sbjct: 236 IMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDL 295

Query: 311 EDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXXXXXXXXX 370
           EDWL N++G+KN +RWK L    Y+  V+I+ L  VP CER+I+  E+L           
Sbjct: 296 EDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQN 355

Query: 371 XXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDEDY 430
                 +L  +E   L+  SQ+ L   + SI  +  D  L E F  WF+D + EA+DEDY
Sbjct: 356 KLSYTSDLTAVEV--LLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDY 413

Query: 431 KRKTSYNCD 439
           K K  +  D
Sbjct: 414 KLKFQFEDD 422

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  160 bits (404), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 132/453 (29%), Positives = 213/453 (47%), Gaps = 42/453 (9%)

Query: 21  NPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGIIR 80
           NP+  L+   + KG+A+    D   +AT+ +KD   +VD+ W+   G+      ++G IR
Sbjct: 15  NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGSIR 74

Query: 81  LYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSN---VFDHEITSLMPRLVKF 137
           +YD    G+ V       S    +K C   D             +FD+++T+ MP LVKF
Sbjct: 75  VYDIFKLGRLVS---FFRSPLKQIK-CVYWDRIIITETLDQQLKIFDYDLTNSMPTLVKF 130

Query: 138 VKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKILMAIDGAFKLSF------ 191
           VKD + L ++P  V      W ++D +     L    +  K  ++ D    +        
Sbjct: 131 VKDPQGLQLVP--VLKNTQAWRQIDVD-----LNLKLENSKTEVSTDDVLDIHLLYTESG 183

Query: 192 --SVAALVAAGERLDE---GDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDFLNCNLT 246
             + A LV     L +    +  PN V  ++K   G+YL   ++   + I     + N  
Sbjct: 184 MDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDI 243

Query: 247 R-EMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERV-LGAYEG--DLIGDLTELLF 302
           R  +++    +R+    L E + ++K EL+ P+  FI  V + AYEG  +L   +T LL 
Sbjct: 244 RVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLL 303

Query: 303 TGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXX 362
           TG +  E EDWL NTIG++NLR+WK L   + +  V+I+ L  +P+ E+ I+  ER+   
Sbjct: 304 TGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQ-- 361

Query: 363 XXXXXXXXXXELEDNLEVLEAQKLVCLSQEALENII-VSIKQI---NVDSNLHEAFIDWF 418
                      L DN ++LE    +      L NI+  SIKQI   N D    E FIDW 
Sbjct: 362 ----NYITAMRLSDNSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWI 417

Query: 419 HDMVMEAVDEDYKRKTSYNCD---PLKIQQFMS 448
            + +   +DE+YK K S +     P  IQ++++
Sbjct: 418 RNTIYLIIDENYKSKLSLSSSNSYPFDIQKYIN 450

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  132 bits (332), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 105/425 (24%), Positives = 195/425 (45%), Gaps = 24/425 (5%)

Query: 19  VWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGI 78
           V+N  L L+     KG+ V R  D   IA   +K    +    W++  G+  ++   +G 
Sbjct: 13  VYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGS 72

Query: 79  IRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNVFDHEITSLMPRLVKFV 138
           IR+ D    GK V  +     + D   +   ++  T   K    F+  I  LMP L++FV
Sbjct: 73  IRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMK---QFNKNIVDLMPSLIQFV 129

Query: 139 KDSRQLTMLPTDVGDGVPRWSKLDG----NKSF-IFLGYDSKRQKILMAIDGAFKLSFSV 193
             + +L+++P    +    W +LD     N+   +   + S+    LM ++G + L+   
Sbjct: 130 SSANKLSLIPYTPSNA--NWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTLKT 187

Query: 194 AALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNCNLTREMISC 252
                     D  + VP     ++K  N  Y  I  D   +KI    FL+     +++ C
Sbjct: 188 P-------ETDLSEKVP--ACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLEC 238

Query: 253 CNRIRSLHKQLHESVSLVKTELVEPYTQFIERVL-GAYEGD-LIGDLTELLFTGSVPPEL 310
              ++ + K     + L++  +++PY  F+E++  GA+  + LI +L      G++  EL
Sbjct: 239 ILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDEL 298

Query: 311 EDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXXXXXXXXX 370
           +DWL  ++GDKN+ +W+ L    Y+   ++  + ++  CER+IL  ER            
Sbjct: 299 QDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFES 358

Query: 371 XXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDEDY 430
               +DN  + E  +L+   Q+ L++II + ++      + + F+ W +D V E +D+DY
Sbjct: 359 GA--DDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDY 416

Query: 431 KRKTS 435
           K + S
Sbjct: 417 KPQLS 421

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 149/346 (43%), Gaps = 23/346 (6%)

Query: 21  NPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGIIR 80
           NP L L L  +  G+ V R  D   I    +++   I+ YQWE + G   A+    G + 
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 81  LYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTF-GSKFSNVFDHEITSLMPRLVKFVK 139
           +YD     + +  +  G  + D     W  D + F      ++FD +IT  MP L++ ++
Sbjct: 73  IYDGIKTSRLLAMLNGGKPNVDA--GIW--DRYYFPNDNEKDIFDSDITLYMPTLIQIIR 128

Query: 140 DSRQL---TMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKILMAIDGAFKLSFSVAAL 196
           D  ++   T  P        +   L      I L + S        ++G  KL F     
Sbjct: 129 DKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFP---- 184

Query: 197 VAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIK-FDFLNCNLTREMISCCNR 255
                     +S       I+K +N  ++    D  ++ I   D L       ++    R
Sbjct: 185 ---------SNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIR 235

Query: 256 IRSLHKQLHESVSLVKTELVEPYTQFIERVLG-AYEGDLIGDLTELLFTGSVPPELEDWL 314
           I  L K L E +  +K  +  P+ +F+  V G A +  ++ +L  +L +G +  ELE+W+
Sbjct: 236 INHLLKYLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWI 295

Query: 315 SNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLH 360
            NTIG KNL RW  L  + YE  V I+ L ++P CER ++   RL 
Sbjct: 296 RNTIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQ 341

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  120 bits (300), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 122/492 (24%), Positives = 213/492 (43%), Gaps = 33/492 (6%)

Query: 21  NPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGIIR 80
           N VL L++    K + VNR  D   IA+  ++D   +V YQW+   G I +V   +G IR
Sbjct: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIR 75

Query: 81  LYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNV-FDHEI-TSLMPRLVKFV 138
           + D     K V  +    +  D    C   D     S+  ++ +D +I T  +PRLVKF+
Sbjct: 76  INDVMYDAKLVALLRTQRTGLD----CVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFM 131

Query: 139 KDSRQLTM---LPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKILMAIDGAFKLSFSVAA 195
                 +M   LPT+     P      G     FL +      ++  ++G ++L  +   
Sbjct: 132 GSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFL-HQKLGDTLVALLNGEYQLQLT--- 187

Query: 196 LVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIK-FDFLNCNLTREMISCCN 254
                 + D+ +     +R I+   + +  V    +    ++  D       ++ I    
Sbjct: 188 ---GPHQEDQSE-----LRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLE 239

Query: 255 RIRSLHKQLH---ESVSLVKTELVEPYTQFIERVLGAYEGD--LIGDLTELLFTGSVPPE 309
           R       L      +  ++TE VEPY +FIER+     G   L   LT+    GS+  E
Sbjct: 240 RFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEE 299

Query: 310 LEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXXXXXXXX 369
           L DWL  ++G++NL  WK L +  Y    +++++ +VPV ERLI+  E+L          
Sbjct: 300 LRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLS 359

Query: 370 XXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDED 429
               + D+LE+ E   L+   QE L+ ++ ++KQ+  D    + F+ W  +++   +++D
Sbjct: 360 EGM-VGDSLEISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKD 418

Query: 430 YKRKTSYN-CDPLKIQQFMSGSLTGVHTYEWCQYSFPA---VTNRLGKQFETVEQLYVAN 485
           Y    + + C       F SG    +   +     F     +    G     V+ LYV +
Sbjct: 419 YPPNFNVSECGKFGF-LFTSGLALTLEPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRD 477

Query: 486 WVVQRVKFGEPI 497
            ++ +V  G+PI
Sbjct: 478 LLLSKVIVGDPI 489

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  115 bits (288), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 105/480 (21%), Positives = 219/480 (45%), Gaps = 43/480 (8%)

Query: 20  WNPVLSLF-LVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGI 78
           +NP   LF +      + + R  D   I  ++V++   ++DY W+  +G+  A+   +G 
Sbjct: 13  YNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGS 72

Query: 79  IRLYDSSLAGKSVG-----SVILGDSDCDVLKFCWSQDSW-TFGSKFSNVFDHEITSLMP 132
           +R+YD    GK +       V+LG +   +    W +      GS    + ++++T  MP
Sbjct: 73  VRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMP 132

Query: 133 RLVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIF---LGYDSKRQKILMAIDGAFKL 189
            LVKFV+D++Q+ ++P         W  +  N+  +    LGY     ++ + I+G + +
Sbjct: 133 TLVKFVQDAKQIDIIPN--RSITKLWRSIGNNEKKVVDVHLGYSCSSAQVTILINGEYLI 190

Query: 190 SFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDFLNCNLTR-E 248
             SV+ +    +++     +  N ++  +     Y +  DD+   +I    +  N  + +
Sbjct: 191 EKSVSDINQIQKKI----PISLNKKEFCE---AIYEIHFDDYSRLQIDLTGILLNDDKLD 243

Query: 249 MISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLIGDLTELLFTGSVPP 308
           +I    ++ +    + +  +L++  ++ PY +F+E + G  + D+   L  L   G +  
Sbjct: 244 LIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLDV---LERLFLIGELDT 300

Query: 309 ELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXXXXXXX 368
           +L +W   TI +KNL++W +L +  Y N  +++++  VP+CERL++   R++        
Sbjct: 301 KLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDL 360

Query: 369 XXXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSN-LHEAFIDWFHDMVMEAVD 427
               E    L++ E Q  + L       ++  + ++N D     + F+ W  D V E+++
Sbjct: 361 QESQE-TSLLDISELQSFLNL-------VLKLLAELNEDETYFKQDFLPWLTDKVYESIN 412

Query: 428 EDYKR---KTSY--NCDPLKIQQFMSGSLTGVHTYEWCQYSFPAVTNRLGKQFETVEQLY 482
            +YK    K  Y  N   L I ++   ++  +       YS     N+L  + E +  L+
Sbjct: 413 NEYKSVFFKAEYGNNKRILNIIKYFEATVIEI------DYSLRTHLNKLKDENEKIINLF 466

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  110 bits (276), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 100/428 (23%), Positives = 179/428 (41%), Gaps = 31/428 (7%)

Query: 15  EQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCH 74
           E+ + +NP     L  T  G AV R  D  +I  + +++   ++   W         V  
Sbjct: 6   EELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMF 65

Query: 75  SNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWT----FGSKFSNVFDHEITSL 130
           ++G  R++D    GK +  + L D      + C     W+            FD +I+ L
Sbjct: 66  NDGSARIHDIFREGKLMTLLRLQDG----FQKCMDTGIWSKLEVRQKPNEGEFDRDISGL 121

Query: 131 MPRLVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSF-----IFLGYDSKRQKILMAIDG 185
           MP  +KFV ++ QL ++P  V     +W  +D          I + ++S   + L+ I+G
Sbjct: 122 MPSPIKFVNNAGQLEVVPYVVTQT--QWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMING 179

Query: 186 AFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGE-YLVITDDWYIQKIKFDFLNCN 244
            +KL+             DE  S  N +  I+  +    +     D     I    L  +
Sbjct: 180 VYKLTIQ-------PNSTDENAS--NQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMES 230

Query: 245 LTR-EMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLIGDLTELLFT 303
                +++    ++ LH+ + + + ++  +L +P   F+E        DL   L   +  
Sbjct: 231 TPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNILNIKDLSKSLKSFILY 290

Query: 304 GSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHXXX 363
           G +   L  WL N +G+KNL++WK+LS   Y+  ++I+ L ++P  E+L L   R     
Sbjct: 291 GLMAKSLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALV 350

Query: 364 XXXXXXXXXELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLH-EAFIDWFHDMV 422
                     +++ LE  ++ K    +  AL N  ++I Q   +       FI W  D++
Sbjct: 351 VAIALPASGHMQE-LEYFDSLK---RTTAALCNQALNITQKTSEEEKKCSVFILWIQDLI 406

Query: 423 MEAVDEDY 430
            E VDEDY
Sbjct: 407 FECVDEDY 414

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 101/482 (20%), Positives = 202/482 (41%), Gaps = 70/482 (14%)

Query: 21  NPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGIIR 80
           NP   L+L  T   I   R +DG +I+ + +++   ++   W+   G+   +   +G  R
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 81  LYDSSLAGKSVGSVILGDSDCDVLKFCWSQDS-WTFGSKFSNV----FDHEITSLMPRLV 135
           +YD    GK +  V    +  D+ +     ++ W      +++    F+H+IT LMP L+
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147

Query: 136 KFVKDSRQLTMLPTDVGDG---------VPRWSKLDGNKSFIFLGYDSKRQKIL------ 180
           KFVKDS  + ++P    +          V  +  +  N   I +  + + +K +      
Sbjct: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207

Query: 181 -----------MAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYD-NGEYLVIT 228
                      +AI+G ++++  V   +    R        N +  ILK   +G Y    
Sbjct: 208 IIHVIDPDCFTIAINGTYQINL-VRKTINTTNR--------NKIVRILKSTVHGVYHCFH 258

Query: 229 DDWYIQKIKFD-FLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFI----- 282
           ++  I+ + F  F +  L  E++     I  + K     + L+   L++ +T F+     
Sbjct: 259 ENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIF 318

Query: 283 ERVLGAYEGDLIGDLTELLFTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMV 342
           E         ++  L   L +G +  EL +WL+ +IG+KNL++WK+LS  +Y  +++I  
Sbjct: 319 EEKQNGGGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFS 378

Query: 343 LTMVPVCERLILCGERLHXXXXXXXXXXXXEL-----------EDNLEVLEAQ------- 384
           L ++P CE  +L  ++               +             N+E+   Q       
Sbjct: 379 LALIPACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEF 438

Query: 385 -----KLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDEDYKRKTSYNCD 439
                +L+ + Q+     + ++++I+        F+ W  +M+  A+DED+  K     +
Sbjct: 439 SPSFLELIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSN 498

Query: 440 PL 441
           P+
Sbjct: 499 PI 500

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/345 (22%), Positives = 152/345 (44%), Gaps = 49/345 (14%)

Query: 19  VWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGI 78
           +WN   ++ +  T  G  +NR  D        +++H  ++D  W    G     C+++G 
Sbjct: 31  LWNVHNNIEIYRTNGGYLINRLND-------EIQNH-RLIDVVWH---GNDLFCCYNSGT 79

Query: 79  IRLY-DSSLAGKSVGSVILGDSD----CDVLKFCWSQDSWTFGSKFSNVFDHEITSLMPR 133
           + +Y +     K +  +  G       CD L    S D ++         D  + + MP+
Sbjct: 80  VSIYREGRELVKQLTFIPKGAKTKCILCDNL--VPSDDRYSLS-------DGNLLNSMPK 130

Query: 134 LVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSF-IFLGYDSKRQKILMAIDGAFKLSFS 192
           L K+        M+  ++ + +   S+L   K   IF+  DSK  K++++I+G       
Sbjct: 131 LNKW-------DMIKNELDNELILNSELGKKKPIDIFMAIDSKTNKLILSIEGTLN---- 179

Query: 193 VAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDFLNCNLTREMISC 252
               +  GE+L     +P +++ I+K  +G+Y+ +  DW  Q +   FL      ++I  
Sbjct: 180 ----IKVGEKL----KLPKDIKRIIKVSSGKYMCLGKDWSYQVLDLTFLQDPNIYKLIKT 231

Query: 253 CNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLIGDLTELLFTGSVPPE-LE 311
                +L + L +    ++ +L EPY +F+E +L     +    L EL + G    E +E
Sbjct: 232 TQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEHKNA---LQELFYIGVTKLEVME 288

Query: 312 DWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCG 356
           +     +    L +W  LS+ +  N++ +MV   +P+ ER+I+  
Sbjct: 289 ELHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVLA 333

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDS-SLAGKSVGSVILGDSDCDVLKF 106
           +V ++ +I D QW ++E  +FA C  +G IR++D+ S   K   SV++ D+D +V+ +
Sbjct: 328 TVGNNKSIEDIQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSW 385

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWS 109
           +V ++ +I D QW ++E  +FA C  +G IR++D+  + K   ++ +  S+ DV    WS
Sbjct: 329 TVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTR-SKKHKPAISVKASNTDVNVISWS 387

Query: 110 Q 110
           +
Sbjct: 388 E 388

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWS 109
           +V ++ ++ D QW ++E  +FA C  +G IR++D+  + K   ++ +  S+ DV    WS
Sbjct: 326 TVANNQSVEDIQWSRTESTVFASCGCDGYIRVWDTR-SKKHKPAISVKASNTDVNVISWS 384

Query: 110 Q 110
           +
Sbjct: 385 E 385

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYD-SSLAGKSVGSVILGDSDCDVLKFCW 108
           +V ++ +I D +W  SE  +FA C  +G +R++D  S   K   SV + D+D +V+   W
Sbjct: 328 TVDNNKSIEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVM--SW 385

Query: 109 SQ 110
           +Q
Sbjct: 386 NQ 387

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDS-SLAGKSVGSVILGDSDCDVLKF 106
           +V ++ +I D QW ++E  +FA    +G IR++D+ S   K V S ++ ++D +V+ +
Sbjct: 323 TVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISW 380

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWS 109
           +V ++ +I D QW ++EG +FA    +G IR++D+  + K   ++ +  S+ DV    WS
Sbjct: 318 TVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTR-SKKHKPAISVKASNTDVNVISWS 376

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDS-SLAGKSVGSVILGDSDCDVLKF 106
           +V ++ ++ D QW ++E  +FA C  +G +R++D+ S   K   SV   ++D +V+ +
Sbjct: 322 TVGNNKSVEDIQWSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISW 379

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWS 109
           +V ++ +I D QW +SE  +FA    +G IR++D+  + K   ++ +  S+ DV    WS
Sbjct: 315 TVSNNKSIEDIQWSRSESTVFATAGCDGYIRIWDTR-SKKHKPAISVKASNTDVNVISWS 373

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWS 109
           +V ++ +I D QW ++E  +FA    +G IR++D+  + K   ++ +  S+ DV    WS
Sbjct: 317 TVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR-SKKHKPAISVKASNTDVNVISWS 375

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWS 109
           +V ++ +I D QW ++E  +FA    +G IR++D+  + K   ++ +  S+ DV    WS
Sbjct: 315 TVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR-SKKHKPAISVKASNTDVNVISWS 373

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWS 109
           +V ++ +I D QW ++E  +FA    +G IR++D+  + K   ++ +  S+ DV    WS
Sbjct: 316 TVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTR-SKKHKPAISVKASNTDVNVISWS 374

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWS 109
           +V ++ +I D QW ++E  +FA    +G IR++D+  + K   ++ +  S+ DV    WS
Sbjct: 317 TVANNQSIEDIQWSRTESTVFASAGCDGYIRIWDTR-SKKHKPAISVKASNTDVNVISWS 375

Query: 110 Q 110
           +
Sbjct: 376 E 376

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDS-SLAGKSVGSVILGDSDCDVLKF 106
           SV ++ +I D QW ++E  +FA    +G IR++D+ S   K   SV   ++D +V+ +
Sbjct: 319 SVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISW 376

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWS 109
           +V ++ +I D QW ++E  +FA    +G IR++D+  + K   ++    S+ DV    W+
Sbjct: 322 TVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTR-SKKHKPAISTKASNTDVNVISWN 380

Query: 110 Q 110
           +
Sbjct: 381 E 381

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 48  TVSVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFC 107
           + SV ++ +I D QW ++E  +FA    +G IR++D+  + K   ++    S+ DV    
Sbjct: 331 SFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDTR-SKKHKPAISTRASNVDVNVIS 389

Query: 108 WSQ 110
           W++
Sbjct: 390 WNE 392

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDS-SLAGKSVGSVILGDSDCDVLKFCW 108
           + +++ ++ D QW ++E  +FA    +G IR++D+ S   K   SV   ++D +V+   W
Sbjct: 323 TAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVI--SW 380

Query: 109 SQ 110
           S+
Sbjct: 381 SE 382

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDS-SLAGKSVGSVILGDSDCDVLKF 106
           S  ++ +I D Q+ ++E  +FA C  +G IR++D+ S   K   SV    +D +V+ +
Sbjct: 329 SAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISW 386

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 50  SVKDHGTIVDYQWEQSEGRIFAVCHSNGIIRLYDS-SLAGKSVGSVILGDSDCDVLKF 106
           S  ++ +I D Q+ ++E  +FA C  +G IR++D+ S   K   SV    +D +V+ +
Sbjct: 328 SAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISW 385

>NCAS0B05460 Chr2 (1024533..1032599) [8067 bp, 2688 aa] {ON}
           Anc_8.155 YGL195W
          Length = 2688

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 503 LEKTRVKDVGVDTGKQLLFLYQDNDSKELVVSKYSLDLDPTTNHIAQESITLTIEDVSSV 562
           LE  ++  + ++  K  + +YQD  SK+LV+S +   L P    + ++ IT  +E VS  
Sbjct: 59  LETPQLAQISMNLLKTFV-IYQDTKSKDLVISIFHAIL-PLEPRLLEKYITFILEQVSKY 116

Query: 563 KDAKFSADYKSIF 575
              +  +DY ++F
Sbjct: 117 PGTRALSDYLNLF 129

>Kwal_26.8061 s26 complement(628772..632575) [3804 bp, 1267 aa] {ON}
           YMR076C (PDS5) - (putative) involved in sister
           chromosome cohesion during mitosis [contig 55] FULL
          Length = 1267

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 235 KIKFDFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLI 294
           +++FD    +  ++ IS    +  L +QLHE +S +K ELV+P T  +ER    Y GDL+
Sbjct: 7   RLEFDLSIVSTIKDNISTQQLLERL-EQLHEELSSLKQELVDPST--LER----YRGDLV 59

Query: 295 G 295
            
Sbjct: 60  N 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,039,342
Number of extensions: 2899024
Number of successful extensions: 8108
Number of sequences better than 10.0: 52
Number of HSP's gapped: 8298
Number of HSP's successfully gapped: 57
Length of query: 644
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 528
Effective length of database: 40,180,143
Effective search space: 21215115504
Effective search space used: 21215115504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)