Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16830g8.271ON86286241910.0
KLLA0F19338g8.271ON89188426100.0
NCAS0B050508.271ON92389025460.0
TDEL0F039808.271ON86786025100.0
KNAG0G020708.271ON89987424920.0
Skud_12.1608.271ON89388824920.0
YLR092W (SUL2)8.271ON89389324920.0
NDAI0B020208.271ON90589924870.0
Suva_10.1768.271ON89387824840.0
Suva_4.554na 1ON85086024830.0
Smik_2.435na 1ON86379724810.0
YBR294W (SUL1)na 1ON85988124800.0
Skud_2.424na 1ON86387924790.0
Smik_12.1518.271ON89388124600.0
Kwal_56.237598.271ON86186324550.0
KLTH0G13486g8.271ON90291524450.0
CAGL0L12342g8.271ON89189823660.0
Kpol_543.438.271ON86685823520.0
AGR077C8.271ON84883823460.0
KAFR0B027508.271ON83485723390.0
ZYRO0C01452g8.271ON90687723240.0
TPHA0J008008.271ON91789122950.0
Ecym_42998.271ON87485522490.0
TPHA0A017608.271ON89389422310.0
TBLA0F030508.271ON89752712151e-152
YPR003C8.99ON7544782834e-25
KNAG0D023908.99ON7165062825e-25
Suva_16.3228.99ON7424812754e-24
Smik_16.2418.99ON7444782682e-23
NCAS0B048008.99ON7244792657e-23
TPHA0H007208.99ON7874782532e-21
Skud_16.2868.99ON7454782522e-21
ZYRO0F04796g8.99ON7355012504e-21
Kpol_467.118.99ON7445162442e-20
KLLA0E14059g8.99ON7064802406e-20
KLTH0G16764g8.99ON7104602398e-20
SAKL0H08800gna 2ON6204431978e-15
NDAI0B022108.99ON7062261791e-12
CAGL0L09207g8.99ON7251681782e-12
Kwal_27.110398.99ON7261591745e-12
TBLA0C052708.99ON7761391711e-11
Ecym_7084na 2ON6891621673e-11
TDEL0C012808.99ON7271631647e-11
AGR213Cna 2ON689861541e-09
SAKL0B03124g8.99ON7441391532e-09
AFR304W3.485ON101586880.093
KLLA0E04731g3.485ON1060160870.11
KAFR0C019103.485ON1020161850.20
YGR125W3.485ON1036161810.56
TBLA0C044403.485ON1150176790.92
KAFR0B003607.535ON643100771.6
SAKL0F02926g3.485ON1050152727.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16830g
         (862 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1618   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...  1009   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271    985   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...   971   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...   964   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...   964   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...   964   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271    962   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...   961   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...   961   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...   960   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...   959   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...   959   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...   952   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   950   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   946   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...   915   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...   910   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   908   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...   905   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...   899   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....   888   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   870   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   863   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   472   e-152
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   113   4e-25
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   113   5e-25
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   110   4e-24
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...   107   2e-23
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   106   7e-23
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   102   2e-21
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   101   2e-21
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   100   4e-21
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    99   2e-20
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    97   6e-20
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    97   8e-20
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    80   8e-15
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    74   1e-12
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    73   2e-12
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    72   5e-12
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    70   1e-11
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    69   3e-11
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    68   7e-11
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    64   1e-09
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    64   2e-09
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...    39   0.093
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    38   0.11 
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....    37   0.20 
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...    36   0.56 
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...    35   0.92 
KAFR0B00360 Chr2 (81284..83215) [1932 bp, 643 aa] {ON} Anc_7.535...    34   1.6  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...    32   7.4  

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1618 bits (4191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 792/862 (91%), Positives = 792/862 (91%)

Query: 1   MSDYHTHNRGSSKDLEHNSSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQ 60
           MSDYHTHNRGSSKDLEHNSSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQ
Sbjct: 1   MSDYHTHNRGSSKDLEHNSSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQ 60

Query: 61  NDAKGLKNDGQTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISL 120
           NDAKGLKNDGQTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQ          FREYLISL
Sbjct: 61  NDAKGLKNDGQTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISL 120

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSF 180
           FPVIRWIPHYNFAWMY              PQSMSYAQIASLPAQYGLYSSFIGAFIYSF
Sbjct: 121 FPVIRWIPHYNFAWMYGDVVAGVTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSF 180

Query: 181 FATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLR 240
           FATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLR
Sbjct: 181 FATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLR 240

Query: 241 LGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTK 300
           LGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTK
Sbjct: 241 LGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTK 300

Query: 301 LDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVL 360
           LDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVL
Sbjct: 301 LDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVL 360

Query: 361 FTLIAWGITRHKKKHPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXX 420
           FTLIAWGITRHKKKHPISLLNTVPSGLKNVGVMKFPDHLATN                  
Sbjct: 361 FTLIAWGITRHKKKHPISLLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIA 420

Query: 421 XXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVF 480
             KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVF
Sbjct: 421 IAKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVF 480

Query: 481 TGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTV 540
           TGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTV
Sbjct: 481 TGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTV 540

Query: 541 FITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDS 600
           FITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDS
Sbjct: 541 FITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDS 600

Query: 601 ENINVASSTKPKLGLSADNSSISTGPSRVRFHTKWIPLENNYGREYNSXXXXXXXXXXXX 660
           ENINVASSTKPKLGLSADNSSISTGPSRVRFHTKWIPLENNYGREYNS            
Sbjct: 601 ENINVASSTKPKLGLSADNSSISTGPSRVRFHTKWIPLENNYGREYNSGIVVQPPPPGVI 660

Query: 661 XYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXXX 720
            YRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPP       
Sbjct: 661 VYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLKKLF 720

Query: 721 XXXXXXEQELSPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEF 780
                 EQELSPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEF
Sbjct: 721 KRGKRLEQELSPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEF 780

Query: 781 HFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQDEENHIGQGRYNIS 840
           HFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQDEENHIGQGRYNIS
Sbjct: 781 HFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQDEENHIGQGRYNIS 840

Query: 841 AASGTNMPFFHVEMPDFSKWSL 862
           AASGTNMPFFHVEMPDFSKWSL
Sbjct: 841 AASGTNMPFFHVEMPDFSKWSL 862

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/884 (59%), Positives = 621/884 (70%), Gaps = 41/884 (4%)

Query: 12  SKDLEHNSSDFAEPNLDDLEAEYDNYKNAE-------------QNPR-----EKSDVVET 53
           S D E ++     P+ D LE EYD+ K +E              +PR     E   +   
Sbjct: 16  SLDGESSNQYSVGPDFDQLEQEYDDLKTSEIIAPHISNGHSISSSPRHHHLYEDRHLDSI 75

Query: 54  LPPTTH---QNDAKGLKNDGQTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXX 110
           +   TH   ++D    K       ++Y   S    +P Y E  V+ K  YD+        
Sbjct: 76  IDTNTHGFKKHDNGNGKFADVNIEQIYNYDSLR--VPNYEETVVDAKQLYDEKLRPYLTF 133

Query: 111 XXFREYLISLFPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYS 170
               EYL SLFP+++W+ HYNF W+Y              PQSMSYAQIA+LPAQYGLYS
Sbjct: 134 SAIVEYLTSLFPLLKWVHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYS 193

Query: 171 SFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDT-EITGPIIATALSLLC 229
           SF+GAFIYSFFATSKDVCIGPVAVMSLETAKVIARV E + +D  EIT PIIAT LSL+C
Sbjct: 194 SFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLIC 253

Query: 230 GAITLGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVV 289
           G + LG+G+LRLGFLVE ISLNAVAGFMTGSA +I++GQ+P LMGY++ VNTRD+TYKV+
Sbjct: 254 GGVALGVGLLRLGFLVEFISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVI 313

Query: 290 INTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRM-NPHSPRAKFWKSFFFY 348
           INTLKHLPDTKLDAVFGLIPL ILY WKY C T+GP  VDR +      RA  +K   FY
Sbjct: 314 INTLKHLPDTKLDAVFGLIPLFILYSWKYFCGTLGPKLVDRYVARSDVKRAAAYKYILFY 373

Query: 349 AQALRNAFVIVLFTLIAWGITRHKKKH--PISLLNTVPSGLKNVGVMKFPDHLATNXXXX 406
            QALRNAFVI++FTLI+WGITRHK K   PISLL TVPSGLKNVGVMK PD L +N    
Sbjct: 374 LQALRNAFVIIIFTLISWGITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASE 433

Query: 407 XXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSAL 466
                           KAFGR+N YKVVPDQELIAIGVTNL+ TFFNAYPATGSFSRSAL
Sbjct: 434 LPSAIIILVLEHIAISKAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSAL 493

Query: 467 KAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFW 526
           KAKCNV+TPLSG+FTGACVLL+LYCLT+AFY+IPKA LSA+IIHAVSDL+ASY+TTWNFW
Sbjct: 494 KAKCNVKTPLSGIFTGACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFW 553

Query: 527 KMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINP 586
            MNPLD +CF+VTV ITIFSSIENGIYFA+CWSCA+LL K+ FP+G+FLG VE+ +V N 
Sbjct: 554 LMNPLDFVCFIVTVIITIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQVSNA 613

Query: 587 TVREDLGVV---EDFDSENIN---VASSTKPKLGLSADNSSISTGPSRVRFHTKWIPLEN 640
            V E++  +   ED   + I      ++T  K+G+ A+    S G S++++HTKW+PL N
Sbjct: 614 EVDENIDRIVLSEDSQPKTIEDNVTKNNTAVKVGVVANE---SFGHSQLQYHTKWLPLNN 670

Query: 641 NYGREYNSXXXXXXXXXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKS 700
           +Y RE N              YRPSESWTY+NCSRQYD IFD VK LTR G +L H  K 
Sbjct: 671 HYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSKH 730

Query: 701 DRPWNDPGQWEPPXXXXXXXXXXXXXEQELSPELGRDERPVLKILAMDWSQVTQIDATGV 760
           D+ WNDPG+WEPP             + E    +  DERPVLKILAMDWSQVTQID+TGV
Sbjct: 731 DKMWNDPGEWEPPFLVKKLFKLGNKHDLEGGEVI--DERPVLKILAMDWSQVTQIDSTGV 788

Query: 761 QNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHI 820
           QNLVDLRKAINKYA+RQVEFHFSGIISPWIKR+L+  GFGTVN+EF+DES+I+GH+SY +
Sbjct: 789 QNLVDLRKAINKYANRQVEFHFSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSL 848

Query: 821 VKTRP--QDEENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           VK RP  QD E  + +    +  A G N+PFFH+EMP+F KW L
Sbjct: 849 VKNRPDLQDPEAALPE-PIALHTALGVNLPFFHLEMPEFHKWHL 891

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/890 (56%), Positives = 607/890 (68%), Gaps = 46/890 (5%)

Query: 19  SSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVETLPPT---------THQNDAKGLKND 69
           SS  +  NLDDLE EYD YK +E N  +                    T QN      N 
Sbjct: 34  SSGNSTQNLDDLELEYDQYKVSETNNNDDVINNNNNNNNNNNNIPELETQQNLDVQFSNT 93

Query: 70  GQTTVELYGTTSSGG--VIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWI 127
                  Y   S+    +IP Y E TV+ KDYYD            R+Y +S+FP+ RW+
Sbjct: 94  TNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWL 153

Query: 128 PHYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDV 187
           PHYN  W                PQSMSYAQIA+LPAQYGLYSSFIGAF YS FATSKDV
Sbjct: 154 PHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDV 213

Query: 188 CIGPVAVMSLETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVE 246
           CIGPVAVMSLETAKV+ +V    PD D  IT PI+ATALSLLCG +T G+GVLRLGFLVE
Sbjct: 214 CIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVE 273

Query: 247 LISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFG 306
           LISLNAV GFMTGSA +I+ GQ+P LMGYN KVNTR   YKV+I TLKHLPDTKLDAVFG
Sbjct: 274 LISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFG 333

Query: 307 LIPLLILYLWKYGCNTIGPNWVDRRMNPH-SPRAKFW-KSFFFYAQALRNAFVIVLFTLI 364
           LIPL +LYLWK+ C+ +GP  VD+    + + RA F+ K F+FYAQA +NA +I++FT I
Sbjct: 334 LIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAI 393

Query: 365 AWGITRHKKK--HPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXX 422
           +W ITR K K   PIS+L TVP GLK VGVMK PD L +                     
Sbjct: 394 SWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIA 453

Query: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482
           K+FGRINDYKVVPDQELIAIGVTNL+GTFFNAYPATGSFSRSALKAKC VRTPLSG+FTG
Sbjct: 454 KSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTG 513

Query: 483 ACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFI 542
           ACVLLALYCLT AF+YIPKATLSAVII AVSDLIASY+ TWNFWKMNPLDCLCFLVTVFI
Sbjct: 514 ACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFI 573

Query: 543 TIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDL---------- 592
           T+FSSIENGIYFA+CWSCAILL K+ FP+GKFLGR+EV+EVI+  V   +          
Sbjct: 574 TVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNSIESATTAEYSS 633

Query: 593 --GVVEDFDSENINVASSTKPKLGLSADNSSISTGP----SRVRFHTKWIPLENNYGREY 646
                 D +++   +  ++    G  A   ++ST P     +VR++TKW+P ++ Y RE 
Sbjct: 634 ASSPSSDNETDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTREL 693

Query: 647 NSXXXXXXXXXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWND 706
           N              YR ++S+TYINCSR YD+IFDEVKR TRRG +L H KK+DRPWND
Sbjct: 694 NPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWND 753

Query: 707 PGQWEPPXXXXXX--XXXXXXXEQELSPELG-----RDERPVLKILAMDWSQVTQIDATG 759
           PG+WE P               ++E + ++      RD RP+LKI+ +D+SQV QIDA+ 
Sbjct: 754 PGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASA 813

Query: 760 VQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYH 819
           +Q+LVDLRK+IN+YADRQVEFHF+GI+SPW+KR L+  GFGT+NDEF+D S+I GHSSYH
Sbjct: 814 IQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYH 873

Query: 820 IVKTRPQDE-------ENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           + +T P  +        +   + +Y++ AA+GTN+PFFH+++PDFSKW L
Sbjct: 874 LTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/860 (57%), Positives = 612/860 (71%), Gaps = 31/860 (3%)

Query: 26  NLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQNDAKGLKNDGQTTVELYGT---TSS 82
            LDDLEAEYD YK  EQ   E ++V        + N  KG+    +T V  YG+    + 
Sbjct: 16  KLDDLEAEYDLYKANEQ--LEDNEVTVNGSEDDYGNK-KGIDLVKETEVRYYGSPGPEAI 72

Query: 83  GGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXXXXX 142
           GG IPG+ E TV+ KDYY+Q             Y+ SLFP+++W PHYN  W Y      
Sbjct: 73  GGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAG 132

Query: 143 XXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKV 202
                   PQSMSYAQIASLP QYGLYSSFIGAFIYS FATSKDVCIGPVAVMSL+TAKV
Sbjct: 133 ITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKV 192

Query: 203 IARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSA 261
           IA+V+   P+ D  +T P+IATALSLLCG + +G+G+LRLGFLVELISLNAVAGFMTGSA
Sbjct: 193 IAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSA 252

Query: 262 FSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCN 321
           F+I+ GQ+PALMGY+ KVNTR +TYKVVI++LKHLPDTKLDAVFGL+PL +LYLWK+ C 
Sbjct: 253 FNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCG 312

Query: 322 TIGPNWVDRRMNPHSPRA-KFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKKKH--PIS 378
           T GP   DR++  HSP+  +  K F+FY+ A+RNA +I++FT I+W IT++K K   PI 
Sbjct: 313 TYGPKLADRQL-AHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIK 371

Query: 379 LLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQE 438
           +L TVPSGL++VGV K P+ L                       K+FGRINDYKVVPDQE
Sbjct: 372 VLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQE 431

Query: 439 LIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYY 498
           LIAIG TNL+GTFFNAYPATGSFSRSALKAKC VRTP SGVFTG CVL+A+YCLT+AF++
Sbjct: 432 LIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFF 491

Query: 499 IPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICW 558
           IP ATLSAVIIHAVSDL+ASY+TTWNFWKMNPLDC  F+VTV IT+FSSIENGIYFA+CW
Sbjct: 492 IPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCW 551

Query: 559 SCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLSAD 618
           SCA+LL K AFP+G+FLGRVEV+EVINPTV ED+  +    S N  +  S      L AD
Sbjct: 552 SCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAI----SINDQIEGSVGKSKSLKAD 607

Query: 619 NSSIS-TGPSRVRFHTKWIPLENNYGREYNSXXXXXXXXXXXXXYRPSESWTYINCSRQY 677
             +IS +  S  +FH+KW+  +  Y RE N              YR S+S+TYINCSR Y
Sbjct: 608 KGAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHY 667

Query: 678 DIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPP-------XXXXXXXXXXXXXEQEL 730
           D IFD +K+ TRRG +L   KKSDRPWNDPG+WE                      ++++
Sbjct: 668 DTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDV 727

Query: 731 SPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWI 790
           + +  RDERP+LKI+ +D+SQV Q+D+T +Q+LVDLRKA++KYADRQVEFHF+GIIS W+
Sbjct: 728 AIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWV 787

Query: 791 KRALVAVGFGTVNDEFADESLILGHSSYHIVK-TRPQDEE-------NHIGQGRYNISAA 842
           KR+L+++GFGTVN  ++DES+I GHSSYHI K T+P  ++       +   Q    I AA
Sbjct: 788 KRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDSSGSSQLQQSQEIYAA 847

Query: 843 SGTNMPFFHVEMPDFSKWSL 862
           +GTNMPFFH+++PDFSKW L
Sbjct: 848 TGTNMPFFHLDIPDFSKWDL 867

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/874 (55%), Positives = 599/874 (68%), Gaps = 41/874 (4%)

Query: 23  AEPNLDDLEAEYDNYKNAEQNPR----------EKSDVVETLPPTTHQNDAKGLKNDGQT 72
           + P+LD+LE EYD YK  E +P+          ++  +           D+  + +    
Sbjct: 33  STPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSN-IPSASIE 91

Query: 73  TVELYGTTSSGG-VIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYN 131
            ++ +   S G  VIP Y E  V   ++++            + Y++S+FP+I W+PHYN
Sbjct: 92  ELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYN 151

Query: 132 FAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGP 191
             W                PQSMSYAQIA+LP QYGLYSSFIGAFIYS FATSKDVCIGP
Sbjct: 152 VYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGP 211

Query: 192 VAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLN 251
           VAVMSLETAK+IARV +  P+D ++ GPIIAT  +LLCG I  G+G LRLGFLVELISLN
Sbjct: 212 VAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLN 271

Query: 252 AVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLL 311
           AVAGFMTGSA +II+GQ+PALMGY + VNTR  TYKV++NTLKHLPDTKLDAVFGLIPL 
Sbjct: 272 AVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLF 331

Query: 312 ILYLWKYGCNTIGPNWVDRRMNPHSPRAKF-WKSFFFYAQALRNAFVIVLFTLIAWGITR 370
           ILY W++ CN  GP   DR   P   R  F WK F+FYAQA R+  +I++FT I+W ITR
Sbjct: 332 ILYFWRWWCNGYGPKLTDRYY-PKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITR 390

Query: 371 H--KKKHPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRI 428
           H   K+  IS+L TVP GLK+VG +K P  L                       K+FGRI
Sbjct: 391 HVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRI 450

Query: 429 NDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLA 488
           NDYKVVPDQELIAIGVTNL+GTFF+AYP TGSFSRSALKAKCNV+TPLSG+FTG+CVLLA
Sbjct: 451 NDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLA 510

Query: 489 LYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSI 548
           LYCLT AF+YIPKATLSAVIIH+VSDL+ASY TTWNF+KMNPLD +CFL T+ IT+FSSI
Sbjct: 511 LYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSI 570

Query: 549 ENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVV------------- 595
           ENGIYFAICWSCA+LLFK+AFP+GKFLGRVE++EV++  +  D  VV             
Sbjct: 571 ENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGN 630

Query: 596 EDFDSENINVASSTKPKLGLSADNSSISTGPSRVRFHTKWIPLENNYGREYNSXXXXXXX 655
           ++F  + +N  S    K  L +  SS S   ++++++TKW+P ++ Y RE N        
Sbjct: 631 KEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPP 690

Query: 656 XXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXX 715
                 YR S+S+TYIN S  YDII DE+KR+TRRG +L H KKSDRPWNDPG+W+PP  
Sbjct: 691 PPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKF 750

Query: 716 XXXXXXXXXXXE-------QELSPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRK 768
                      +       + L   + RDERPVLK+L +D+SQV Q+D+T +Q+LVDLRK
Sbjct: 751 LSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRK 810

Query: 769 AINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQDE 828
           A+N YADRQVEFHF+GIISPWIKR LV +GFGTVN+EF+DES+I GHSSYH+VK    D 
Sbjct: 811 AVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDI 870

Query: 829 ENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           EN      Y +  A+GTN+PFFH+++PDF KW +
Sbjct: 871 ENG-----YQVKTATGTNLPFFHIDIPDFKKWDI 899

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/888 (55%), Positives = 612/888 (68%), Gaps = 49/888 (5%)

Query: 14  DLEHNSSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVET--LPPTTHQNDAKGLKNDGQ 71
           D + N+     PNLDDLE EYD YKN E N     + +E+  +      NDAKG+K    
Sbjct: 16  DFQDNTDSV--PNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGVKGSKI 73

Query: 72  TTVELYGTTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYN 131
              +    +     +  + E  V+ K+YY+             +YL S+FP+I W+PHYN
Sbjct: 74  EYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYN 133

Query: 132 FAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGP 191
           F W                PQSMSYAQ+A+LPAQYGLYSSFIGA+ YSFFATSKDVCIGP
Sbjct: 134 FNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGP 193

Query: 192 VAVMSLETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISL 250
           VAVMSL+TAKVIA V    PD DT ITGP+IAT L+LLCG I+  +G LRLGFLVELISL
Sbjct: 194 VAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISL 253

Query: 251 NAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPL 310
           NAVAGFMTGSAF+I+ GQ+PALMGYN+ VNTR  TYKVVI TLKHLPDTKLDAVFGLIPL
Sbjct: 254 NAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPL 313

Query: 311 LILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITR 370
            +LY+WK+ C T GP   DR  + ++   K  K  +FYAQA RN  +I++FT I W ITR
Sbjct: 314 FLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITR 373

Query: 371 HKK--KHPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRI 428
            K   + PIS+L +VPSGLK VGV   P  L +                     K+FGRI
Sbjct: 374 GKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRI 433

Query: 429 NDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLA 488
           NDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKCNVRTPLSG+F+G+CVLLA
Sbjct: 434 NDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLA 493

Query: 489 LYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSI 548
           LYCLT AF+YIPKATLSAVIIHAVSDL+ASY+TTWNFWKMNPLD +CF+VTV IT+F+SI
Sbjct: 494 LYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASI 553

Query: 549 ENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENIN---- 604
           E+GIYFA+CWSCA+LL K+AFP+GKFLGRVE++EV +  V+ D   V  + SEN N    
Sbjct: 554 EDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVS-YVSENNNRIST 612

Query: 605 ---------------VASSTKP------KLGLSADNSSISTGPSRVRFHTKWIPLENNYG 643
                          + +S+K         G ++ +SSI  G  R+++HTKW+P ++ Y 
Sbjct: 613 LEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSI--GQPRIKYHTKWLPFDHKYT 670

Query: 644 REYNSXXXXXXXXXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRP 703
           RE N              YR SES+TY+NCSR Y+II DEVKR TRRG ++ H KKSDRP
Sbjct: 671 RELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRP 730

Query: 704 WNDPGQWEPPXXXXXXXXXXXXXEQEL---------SPELGRDERPVLKILAMDWSQVTQ 754
           WNDPG WE P             E +L         S +  RDERP+LKIL +D+SQV Q
Sbjct: 731 WNDPGPWEAP-AFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQ 789

Query: 755 IDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILG 814
            DAT +Q+LVDLRKAIN+YADRQVEFHF GIISPW+KR L++ GFGT+N+E++DES++ G
Sbjct: 790 TDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAG 849

Query: 815 HSSYHIVKTRPQDEENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           H+SYH+ +  P+++EN     +Y++  ASGTN+PFFH+++PDF+KW +
Sbjct: 850 HTSYHVARV-PRNKEN---PDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/893 (56%), Positives = 614/893 (68%), Gaps = 66/893 (7%)

Query: 21  DFAE-----PNLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQ--NDAKGLKND---- 69
           DF E     P+LDDLE EYD YKN E N       +E+     H   N +KG+K      
Sbjct: 16  DFQETNNTVPDLDDLELEYDQYKNNENNDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDY 75

Query: 70  -GQTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIP 128
              + V LY  + S      + E TV+ K+YYD              YL S+FP+I W+P
Sbjct: 76  FNPSDVSLYDNSVSQ-----FEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLP 130

Query: 129 HYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVC 188
           HYNF+W                PQSMSYAQ+A+LPAQYGLYSSFIGA+ YSFFATSKDVC
Sbjct: 131 HYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVC 190

Query: 189 IGPVAVMSLETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVEL 247
           IGPVAVMSL+TAKVIA VT   PD D+ ITGP+IAT L+LLCG I+  +G LRLGFLVEL
Sbjct: 191 IGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVEL 250

Query: 248 ISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGL 307
           ISLNAVAGFMTGSAF+I+ GQ+PALMGYN  VNTR  TYKVVI TLKHLPDTKLDAVFGL
Sbjct: 251 ISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGL 310

Query: 308 IPLLILYLWKYGCNTIGPNWVDRRMNPHSPRA-KFWKSFFFYAQALRNAFVIVLFTLIAW 366
           IPL +LY+WK+ C T GP   DR  N  +PR  K  K  +FYAQA RN  +I++FT I W
Sbjct: 311 IPLFLLYVWKWWCGTYGPRLNDR-YNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGW 369

Query: 367 GITRHKKK--HPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKA 424
            ITR K K   PIS+L +VPSGLK VGV   P  L +                     K+
Sbjct: 370 AITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKS 429

Query: 425 FGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGAC 484
           FGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKCNVRTPLSG+F+G+C
Sbjct: 430 FGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSC 489

Query: 485 VLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITI 544
           VLLALYCLT AF+YIPKATLSAVIIHAVSDL+ASY+TTWNFWKMNPLD +CF+VTV IT+
Sbjct: 490 VLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITV 549

Query: 545 FSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVV--------- 595
           F+SIE+GIYFA+CWSCA+L+ K+AFP+GKFLGRVEV+EV +  VR D  VV         
Sbjct: 550 FASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNG 609

Query: 596 ---------EDFDSENINVASSTKP------KLGLSADNSSISTGPSRVRFHTKWIPLEN 640
                    +D +S    V +S+K         G  + +SSIS    R+++HTKWIP ++
Sbjct: 610 ISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQ--PRIKYHTKWIPFDH 667

Query: 641 NYGREYNSXXXXXXXXXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKS 700
            Y RE N              YR SES+TY+NCSR Y+II +EVK++TRRG ++ H KKS
Sbjct: 668 KYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKS 727

Query: 701 DRPWNDPGQWEPPXXXXXXXXXXXXXEQELSPE-----------LGRDERPVLKILAMDW 749
           DRPWNDPG WE P             ++E  PE           + RD+RP+LKIL +D+
Sbjct: 728 DRPWNDPGPWEAP---AFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDF 784

Query: 750 SQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADE 809
           SQV Q DAT +Q+LVDLRKAIN+YADRQVEFHF GIISPW+KR L++ GFGT+N+E++DE
Sbjct: 785 SQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDE 844

Query: 810 SLILGHSSYHIVKTRPQDEENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           S++ GH+SYH+ +  PQ EEN     +Y++  ASGTN+PFFH+++PDF+KW +
Sbjct: 845 SIVAGHTSYHVARV-PQGEEN---PEKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/899 (54%), Positives = 611/899 (67%), Gaps = 47/899 (5%)

Query: 8   NRGSSKDLEHN-------SSDFAEPNLDDLEAEYDNYKNAEQNPR-------EKSDVVET 53
           N  ++ D+E+        +SD +  NL DLE EYD YK +E N +       E +++   
Sbjct: 10  NENNTNDIENQYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQ 69

Query: 54  LPPTTHQNDAKGLKNDGQTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXF 113
              T +  D K    + Q  +  +   S   +IP + E  ++FKDYY             
Sbjct: 70  FSNTYNTGDKKNSIKNHQIQINTFNADSV--IIPSFEEHAISFKDYYRHSLKENFSLKSV 127

Query: 114 REYLISLFPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFI 173
           +EY +S+FP+IRW+PHYN AW                PQSMSYAQIA+LP QYGLYSSFI
Sbjct: 128 KEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFI 187

Query: 174 GAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAI 232
           GAF YS FATSKDVCIGPVAVMSLET KVI +V    P+ D  IT P+IAT L+ LCG I
Sbjct: 188 GAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVI 247

Query: 233 TLGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINT 292
           T GIG LRLGFLVELISLNAV GFMTGSA +I+ GQ+PALMGY  KVNTR +TYKV+I +
Sbjct: 248 TAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIES 307

Query: 293 LKHLPDTKLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQAL 352
           LKHLPDTKLDAVFGLIPL ILYLWK+ C  +GP   D+    +     + K F+FYAQA 
Sbjct: 308 LKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAA 367

Query: 353 RNAFVIVLFTLIAWGITRHKKK--HPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXX 410
           +NA +I++FT IAW IT+ K K   PIS+L +VP GLK VGVMK PD LA+         
Sbjct: 368 KNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPAS 427

Query: 411 XXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKC 470
                       K+FGRINDYKVVPDQELIAIGVTNL+GTFFNAYPATGSFSRSALKAKC
Sbjct: 428 VIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKC 487

Query: 471 NVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNP 530
            VRTPLSG+FTG+CVLLALYCLT  F YIPKATLSAVIIHAVSDLIASY TTWNFWKMNP
Sbjct: 488 EVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNP 547

Query: 531 LDCLCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVRE 590
           LDC  F+VTVFIT+FSSIENGIYFA+CWSCAIL+ K+AFP+GKFLGRVE++EV+N  V +
Sbjct: 548 LDCFSFIVTVFITVFSSIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDD 607

Query: 591 DLGVVE-------DFDSENINVASSTK----PKLG-----LSADNSSISTGPSRVRFHTK 634
              V +          ++ IN     K    P L      L +D SSI  G S++R++TK
Sbjct: 608 SFEVTDYSSNSNLSLSADTINHNKKLKILHIPLLKTLKDQLFSDISSIQ-GKSKIRYYTK 666

Query: 635 WIPLENNYGREYNSXXXXXXXXXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVL 694
           W+P ++ Y +E N              YR ++S+TY+NCS+ YD+IF+E+K+ T+RG ++
Sbjct: 667 WLPFDHAYTKELNPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLI 726

Query: 695 AHTKKSDRPWNDPGQWEPP-------XXXXXXXXXXXXXEQELSPEL---GRDERPVLKI 744
            H KKSDRPWNDPG+WE P                    E+   P++    RD+RP+LK+
Sbjct: 727 RHRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKV 786

Query: 745 LAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVND 804
           L +D+SQV Q+DAT +Q+LVDLRKAINKYADRQVEFHF+GI+SPWIK+ L+ +GFGT+N+
Sbjct: 787 LCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINE 846

Query: 805 EFADESLILGHSSYHIVKTRPQD-EENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           E++DES+I GH+SYH+ +    D E   +  G Y +  A+GTN+PFFH+++PDF +W +
Sbjct: 847 EYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/878 (56%), Positives = 605/878 (68%), Gaps = 49/878 (5%)

Query: 25  PNLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQ--NDAKGLKNDGQTTVELYGTTSS 82
           P+LDDLE EYD YKN E N     + +E+   T H   ++AKG+K    + VE + T+  
Sbjct: 25  PDLDDLELEYDQYKNNENNGAFNDNDLESNSLTNHNTASEAKGVKG---SKVEYFNTSDI 81

Query: 83  G---GVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXX 139
                 +  + E TV+FK+YYD              YL S+FP+I W+PHYN  W     
Sbjct: 82  SLYDNSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFIADL 141

Query: 140 XXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLET 199
                      PQSMSYAQ+A+LPAQYGLYSSFIGA+ YSFFATSKDVCIGPVAVMSL+T
Sbjct: 142 IAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQT 201

Query: 200 AKVIARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMT 258
           AKVIA VT   PD DT ITGPIIAT L+LLCG I+  +G LRLGFLVELISLNAVAGFMT
Sbjct: 202 AKVIADVTARYPDGDTTITGPIIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMT 261

Query: 259 GSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKY 318
           GSAF+I+ GQ+PALMGYN+ VNTR  TYK+VI++LKHLPDT LDA FGLIPL ILY WK+
Sbjct: 262 GSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPLFILYTWKW 321

Query: 319 GCNTIGPNWVDRRMNPHSPRA-KFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKKK--H 375
            C T GP   DR  N   PR  K  K   FYAQA RN  +I++FT IAW ITR K     
Sbjct: 322 WCGTYGPRLNDR-FNSKKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAWAITRGKSSADR 380

Query: 376 PISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVP 435
           PIS+L +VPSGLK VGV   P  L +                     K+FGR+NDYKVVP
Sbjct: 381 PISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKVVP 440

Query: 436 DQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEA 495
           DQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKCNVRTPLSG+F+G+CVLLALYCLT A
Sbjct: 441 DQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGA 500

Query: 496 FYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFA 555
           F+YIPKATLSAVIIHAVSDL+ASY+TTWNFWKMNPLD +CF+VTV IT+FSSIENGIYFA
Sbjct: 501 FFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFSSIENGIYFA 560

Query: 556 ICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTK----- 610
           +CWSCAI + K+AFP+GKFLGRVE++EV +  VR D   V  F SEN N  S+ +     
Sbjct: 561 MCWSCAIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDSVS-FTSENNNRISTLEEDGVG 619

Query: 611 -------------PKLGLSA-----DNSSISTGPSRVRFHTKWIPLENNYGREYNSXXXX 652
                         KL         ++ S S G  R+++HTKW+P ++ Y +E N     
Sbjct: 620 EKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIKYHTKWLPFDHKYTKELNPDVNI 679

Query: 653 XXXXXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEP 712
                    YR SES+TYINCSR Y++I DE+K++TRRG ++ H KKSDRPWNDPG WEP
Sbjct: 680 LPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQLIRHRKKSDRPWNDPGPWEP 739

Query: 713 PXXXXXXXXXXXXXEQELSPELG--------RDERPVLKILAMDWSQVTQIDATGVQNLV 764
           P                 S E          RD+RP+LKIL +D+SQV Q DAT +Q+LV
Sbjct: 740 PTFFKNLKFWKKKETDIESSENAVNNPTDAVRDDRPLLKILCLDFSQVAQTDATALQSLV 799

Query: 765 DLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTR 824
           DLRKAIN+YADRQVEFHF GIISPW+KR L++ GFGT+N+E++DES++ GH+SYH+ +  
Sbjct: 800 DLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARV- 858

Query: 825 PQDEENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           PQ+EE      +Y++  ASGTN+PFFH+++PDF+KW +
Sbjct: 859 PQNEET---PDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/860 (56%), Positives = 592/860 (68%), Gaps = 46/860 (5%)

Query: 26  NLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQNDAKGLKNDGQTTVELYGTTSSG-- 83
           N++  +++Y +Y+ +E                   ++ +  K +G    E   T SS   
Sbjct: 14  NIEIFDSKYSSYRESEAAANRDD-----------SHNEQSWKVNGNRKFEHTKTESSDVS 62

Query: 84  -GVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXXXXX 142
              IP Y E TV  K+YY               Y+ SLFP+++W+PHYNF W Y      
Sbjct: 63  YDSIPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAG 122

Query: 143 XXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKV 202
                   PQSMSYAQIASL  +YGLYSSF+GAFIYS FATSKDVCIGPVAVMSL+TAKV
Sbjct: 123 ITVGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKV 182

Query: 203 IARVTEHLPDD-TEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSA 261
           IA V +  P D TE+TGPIIATAL LLCG +T  +GVLRLGFLVELISLNAVAGFMTGSA
Sbjct: 183 IAEVLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSA 242

Query: 262 FSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCN 321
           FSII GQ+PALMGYN+ VNTR++TYKVVINTLKHLP+TKLDAVFGLIPL+ILY+WK+ C 
Sbjct: 243 FSIIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCG 302

Query: 322 TIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHK--KKHPISL 379
           T G    +R    H   A   KSF+FYAQA+RNA VIV+FT I+W ITR+K  +  PIS+
Sbjct: 303 TYGITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPISI 362

Query: 380 LNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQEL 439
           L TVPSGL  VGVMK P+ L +N                    K+FGRINDYKVVPDQEL
Sbjct: 363 LGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQEL 422

Query: 440 IAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYI 499
           IAIGVTNLVGTFF++YPATGSFSRSALKAKCNVRTP SG+FTG CVLLALYCLT+AF++I
Sbjct: 423 IAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFFI 482

Query: 500 PKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWS 559
           PKATLSAVIIHAVSDL+ SYETTW FWK NPLDC+ F+VTVFIT+FSSIENGIYFA+CWS
Sbjct: 483 PKATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCWS 542

Query: 560 CAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLSADN 619
           CAILL K AFP+G+FLGRVEV+E++NPT++ ++  V   +  N  V ++           
Sbjct: 543 CAILLLKQAFPAGRFLGRVEVAEILNPTLQNNVSAVVSLNESNKQVKTTVD--------- 593

Query: 620 SSISTGPSRVRFHTKWIPLENNYGREYNSXXXXXXXXXXXXXYRPSESWTYINCSRQYDI 679
                  S  RF TKW+P ++ Y RE N              YR S+S+TY+NCSR YDI
Sbjct: 594 ---VLRSSEYRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRLSDSFTYVNCSRHYDI 650

Query: 680 IFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXXXXXXXXXEQEL--------S 731
           IFD VK  TRRG ++   KKSDRPWNDPG+W+ P               E         S
Sbjct: 651 IFDHVKEETRRGQLVNLRKKSDRPWNDPGEWKMPTSLKTLFRFKRKSVTENEEPSVSNGS 710

Query: 732 PELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIK 791
              G  E+P+LK++ +D+SQV Q+D+T +Q+LVDLRKA+NKYADRQVEFHF+GIISPWIK
Sbjct: 711 TNRGSYEKPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYADRQVEFHFAGIISPWIK 770

Query: 792 RALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQ------DEENHIGQGRYN---ISAA 842
           R+L +V FGTVN+E++DES+I GHSS H+ K          DEE+HI     N   + AA
Sbjct: 771 RSLSSVDFGTVNEEYSDESVIAGHSSVHVTKFSSDDDADYTDEESHISAPYSNYGTLCAA 830

Query: 843 SGTNMPFFHVEMPDFSKWSL 862
           +GTN+PFFH+++PDFSKW +
Sbjct: 831 TGTNLPFFHIDIPDFSKWDI 850

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/797 (60%), Positives = 579/797 (72%), Gaps = 29/797 (3%)

Query: 86  IPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXXXXXXXX 145
           IP Y E+TV  KDYYD              YL SLFP+I+W+PHYNF W Y         
Sbjct: 76  IPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGITV 135

Query: 146 XXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIAR 205
                PQSMSYAQIASL  +YGLYSSFIGAFIYS FATSKDVCIGPVAVMSL+TAKVIA 
Sbjct: 136 GCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 195

Query: 206 VTEHLPDD-TEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFSI 264
           V +  P+D  E+TGPIIAT L LLCG +  G+GVLRLGFLVELISLNAVAGFMTGSAFSI
Sbjct: 196 VLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAFSI 255

Query: 265 ITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTIG 324
           I GQ+PALMGYN+ VNTR+ TYKVVINTLKHLP+TKLDAVFGLIPL+ILYLWK+ C + G
Sbjct: 256 IWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGSFG 315

Query: 325 PNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHK--KKHPISLLNT 382
              VDR  +     A   KSF+FYAQA+RNA VI++FT I++ ITR+K  +K PIS+L T
Sbjct: 316 IKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPISILGT 375

Query: 383 VPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAI 442
           VPSGL  VGVMK PD L +N                    K+FGRINDYKV+PDQELIAI
Sbjct: 376 VPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIAI 435

Query: 443 GVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKA 502
           GVTNL+GTFF++YPATGSFSRSALKAKCNVRTP SGVFTGACVLLALYCLT AF+YIPKA
Sbjct: 436 GVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFFYIPKA 495

Query: 503 TLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAI 562
           TLSAVIIHAVSDL+ASYETTWNFWKMNPLDC+ F+VTV IT+FSSIENGIYFA+CWSCA+
Sbjct: 496 TLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMCWSCAM 555

Query: 563 LLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLSADNSSI 622
           LL K AFP+GKFLGRVEV+EV+NPT++  +  +         V+ +  P        SS+
Sbjct: 556 LLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSI---------VSPNESPNEFSKQVKSSV 606

Query: 623 STGP-SRVRFHTKWIPLENNYGREYNSXXXXXXXXXXXXXYRPSESWTYINCSRQYDIIF 681
              P S  +F  KW+P ++ Y RE NS             YR S+S+TY+NCSR YD+IF
Sbjct: 607 DALPSSEYKFSVKWVPFDHAYTRELNSYTRVRPPPPGVIVYRFSDSFTYVNCSRHYDVIF 666

Query: 682 DEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXXXXXXXXXEQELS--PELGRD-- 737
           D +K  TRRG +++  KKSDRPWNDPG+W+ P               + S  P +  +  
Sbjct: 667 DRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNSFKNIFRVKRGLATKNSELPAVNDNTN 726

Query: 738 ----ERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRA 793
               E+P+LK++ +D+SQV Q+D+T VQ+LVDLRKA+NKYADRQVEFHF+GIISPWIKR+
Sbjct: 727 SESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRS 786

Query: 794 LVAVGFGTVNDEFADESLILGHSSYHIVKTRPQ-----DEENHIGQGRYN---ISAASGT 845
           L++V FGT+N+EF+D S+I GHSS+HI K         DE++ I     N   + AA+GT
Sbjct: 787 LLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDEVDYTDEDSPISVTCSNYDTLCAATGT 846

Query: 846 NMPFFHVEMPDFSKWSL 862
           N+PFFH+++PDFSKW +
Sbjct: 847 NLPFFHIDIPDFSKWDV 863

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/881 (55%), Positives = 604/881 (68%), Gaps = 49/881 (5%)

Query: 8   NRGSSKDLEHNSSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQNDAKGLK 67
           +R SS +  HN  D    +++  E+EY  Y+ +E    E  D +       H  D +  K
Sbjct: 2   SRKSSTEYVHNQED---ADIEVFESEYRTYRESEA--AENRDGL-------HNGDEENWK 49

Query: 68  NDGQTTVELYGTTSSG------GVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLF 121
            +  ++ + +G T +         IP Y E TV  K+YYD              YL+SLF
Sbjct: 50  VN--SSKQKFGVTKNELSDVLYDSIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLF 107

Query: 122 PVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFF 181
           P+I+W PHYNF W Y              PQSMSYAQIASL  +YGLYSSFIGAFIYS F
Sbjct: 108 PIIKWFPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLF 167

Query: 182 ATSKDVCIGPVAVMSLETAKVIARVTEHLPDD-TEITGPIIATALSLLCGAITLGIGVLR 240
           ATSKDVCIGPVAVMSL+TAKVIA V +  P+D TE+T PIIAT L LLCG +  G+G+LR
Sbjct: 168 ATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILR 227

Query: 241 LGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTK 300
           LGFLVELISLNAVAGFMTGSAF+II GQ+PALMGYN  VNTR+ TYKVVINTLKHLP+TK
Sbjct: 228 LGFLVELISLNAVAGFMTGSAFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTK 287

Query: 301 LDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVL 360
           LDAVFGLIPL+ILY+WK+ C T G    DR        A   KSF+FYAQA+RNA VIV+
Sbjct: 288 LDAVFGLIPLVILYVWKWWCGTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVV 347

Query: 361 FTLIAWGITRHK--KKHPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXX 418
           FT I+W ITR+K  K  PIS+L TVPSGL  VGVMK PD L +N                
Sbjct: 348 FTAISWSITRNKSSKDRPISILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEH 407

Query: 419 XXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSG 478
               K+FGRINDYKVVPDQELIAIGVTNL+GTFF++YPATGSFSRSALKAKCNVRTP SG
Sbjct: 408 IAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSG 467

Query: 479 VFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLV 538
           VFTG CVLLALYCLT+AF++IPKATLSAVIIHAVSDL+ SY+TTW FWK NPLDC+ F+V
Sbjct: 468 VFTGGCVLLALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIV 527

Query: 539 TVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDF 598
           TVFIT+FSSIENGIYFA+CWSCA+LL K AFP+GKFLGRVEV+EV+NPTV+ED+  V   
Sbjct: 528 TVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAV--- 584

Query: 599 DSENINVASSTKPKLGLSADNSSISTGPS-RVRFHTKWIPLENNYGREYNSXXXXXXXXX 657
                 ++S+  P        S++   P+   +F  KW+P ++ Y RE N          
Sbjct: 585 ------ISSNELPNELNKQVKSTVEVLPAPEYKFSVKWVPFDHGYSRELNINTTVRPPPP 638

Query: 658 XXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXX 717
               YR  +S+TY+NCSR YDIIFD +K  TRRG ++   KKSDRPWNDPG+W+ P    
Sbjct: 639 GVIVYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLK 698

Query: 718 XX---XXXXXXXEQELSPELGRD-----ERPVLKILAMDWSQVTQIDATGVQNLVDLRKA 769
                         +L    G       E+P+LK++ +D+SQV Q+D+T VQ+LVDLRKA
Sbjct: 699 SLFKFKRHSATTNSDLPISNGSSNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKA 758

Query: 770 INKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQ--- 826
           +N+YADRQVEFHF+GIISPWIKR+L++V FGT N+E++D+S+I GHSS+H+ K       
Sbjct: 759 VNRYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVD 818

Query: 827 --DEENHIGQGRYN---ISAASGTNMPFFHVEMPDFSKWSL 862
             DE++ I     N   + AA+GTN+PFFH+++PDFSKW +
Sbjct: 819 YTDEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 859

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/879 (55%), Positives = 606/879 (68%), Gaps = 44/879 (5%)

Query: 7   HNRGSSKDLEHNSSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQNDAKGL 66
           ++  SS ++  N  D    +++  E+EY  Y+ +E    E  D            D +  
Sbjct: 6   NSHKSSTEVLDNQED---TDIEVFESEYRTYRESEA--AENRD-------NFQNGDDQSW 53

Query: 67  KNDGQTTVELYGTTSSG---GVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPV 123
           K +G+   E+  +  S      IP Y E TV  K+YYD             +YL SLFP+
Sbjct: 54  KINGKQKYEVTKSEVSDVAYDSIPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPI 113

Query: 124 IRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFAT 183
           I+W+PHYNF W Y              PQSMSYAQIASL  +YGLYSSFIGAFIYS FAT
Sbjct: 114 IKWLPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFAT 173

Query: 184 SKDVCIGPVAVMSLETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLG 242
           SKDVCIGPVAVMSL+TAKVIA V +  P+  TE+TGPIIATAL  LCG ++  +GVLRLG
Sbjct: 174 SKDVCIGPVAVMSLQTAKVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALGVLRLG 233

Query: 243 FLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLD 302
           FLVELISLNAVAGFMTGSAFSII GQ+PALMGYN  VNTR+ TYKVVINTLKHLP+TKLD
Sbjct: 234 FLVELISLNAVAGFMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLD 293

Query: 303 AVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFT 362
           AVFGLIPL+ILY+WK+ C T G    DR        A   KSF+FYAQA+RNA VI++FT
Sbjct: 294 AVFGLIPLVILYVWKWWCGTFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVIIVFT 353

Query: 363 LIAWGITRHK--KKHPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXX 420
            I+W ITR+K  K+ PIS+L TVPSGL  VGVMK P+ L +N                  
Sbjct: 354 AISWRITRNKSSKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIA 413

Query: 421 XXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVF 480
             K+FGRINDYKV+PDQELIAIGVTNL+GTFF++YPATGSFSRSALKAKCNVRTP SG+F
Sbjct: 414 ISKSFGRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIF 473

Query: 481 TGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTV 540
           TGACVLLALYCLT AF++IPKATLSAVIIHAVSDL+ SY+TTW FWK NPLDC+ F+ TV
Sbjct: 474 TGACVLLALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATV 533

Query: 541 FITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDS 600
           FIT+FSSIENGIYFA+CWSCA+LL K AFP+GKFLGRVEV+EV+NPTV+E +  V     
Sbjct: 534 FITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAV----- 588

Query: 601 ENINVASSTKPKLGLSADNSSISTGPS-RVRFHTKWIPLENNYGREYNSXXXXXXXXXXX 659
                +S+  P        S++   P+   +F  KWIP +++Y RE N            
Sbjct: 589 ----TSSNELPNELSKQVKSTVDVLPAPEYKFSVKWIPFDHDYSRELNRYTKVRPPPPGV 644

Query: 660 XXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXX 719
             YR ++S+TY+NCSR YDIIFD +K  TRRG +++  KKSDRPWNDPG+W+ P      
Sbjct: 645 IVYRLADSFTYVNCSRHYDIIFDRIKEETRRGQLISLRKKSDRPWNDPGEWKMPNSFKAL 704

Query: 720 ---XXXXXXXEQELSPELGRD-----ERPVLKILAMDWSQVTQIDATGVQNLVDLRKAIN 771
                     + EL    GR+     E+P+LK++ +D+SQV Q+D+T VQ+LVDLRKA+N
Sbjct: 705 FKFKRKSATTDNELPVSSGRNNQESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVN 764

Query: 772 KYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQD---- 827
           KYADRQVEFHF+GIISPWIKR+L++V FGT N+E++D+S+I GHSS+H+ K    D    
Sbjct: 765 KYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYT 824

Query: 828 -EENHIGQGRYN---ISAASGTNMPFFHVEMPDFSKWSL 862
            E++ I     N   + AA+GTN+PFFH+++PDFSKW +
Sbjct: 825 EEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 863

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/881 (56%), Positives = 611/881 (69%), Gaps = 55/881 (6%)

Query: 25  PNLDDLEAEYDNYKNAEQNPREKSDVVET---LPPTTHQND--AKGLKND--GQTTVELY 77
           P+LDDLE EYD YKN E N   K + +E+     P    N   AKG K +    + V LY
Sbjct: 25  PDLDDLELEYDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLY 84

Query: 78  GTTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYX 137
             + S      + E TV+ K+YYD            R+YL S+FP+I W+PHYNF W   
Sbjct: 85  DNSVSQ-----FEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTA 139

Query: 138 XXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSL 197
                        PQSMSYAQ+A+LPAQYGLYSSFIGA+ YSFFATSKDVCIGPVAVMSL
Sbjct: 140 DLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSL 199

Query: 198 ETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGF 256
           +TAKVIA VT   PD D  ITGP+IAT L+LLCG I+  IG LRLGFLVELISLNAVAGF
Sbjct: 200 QTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGF 259

Query: 257 MTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLW 316
           MTGSAF+I+ GQ+PALMGYN  VNTR  TYKVVI TLKHLPDTKLDAVFGLIPL +LY+W
Sbjct: 260 MTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVW 319

Query: 317 KYGCNTIGPNWVDRRMNPHSPRA-KFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKKK- 374
           K+ C T GP  ++ R N  +PR  K  K  +FYAQA RN  +IV+FT I W ITR K K 
Sbjct: 320 KWWCGTYGP-ILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKS 378

Query: 375 -HPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKV 433
             PIS+L +VPSGLK VGV   P  L +                     K+FGRINDYKV
Sbjct: 379 ERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKV 438

Query: 434 VPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLT 493
           VPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKCNVRTPLSG+F+G+CVLLALYCLT
Sbjct: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498

Query: 494 EAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIY 553
            AF+YIPKATLSAVIIHAVSDL+ASY+TTWNFWKMNPLD +CF+VTV IT+F+SIE+GIY
Sbjct: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIY 558

Query: 554 FAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENIN--------- 604
           FA+CWSCA+LL K+AFP+GKFLGRVE++EV +  ++ +   V  + SEN N         
Sbjct: 559 FAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVS-YTSENNNGIRTSEEGD 617

Query: 605 -----------VASSTKPKLGLSADN----SSISTGPSRVRFHTKWIPLENNYGREYNSX 649
                        SS K +  +   +    SS+ T P R+++HTKW+P ++ Y RE N  
Sbjct: 618 EYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQP-RMKYHTKWVPFDHKYTRELNPD 676

Query: 650 XXXXXXXXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQ 709
                       YR SES+TY+NCSR Y+II ++VK +TRRG ++ H KKSDRPWNDPG 
Sbjct: 677 IQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGP 736

Query: 710 WEPPXXXXXXXXXXXXXEQ----ELSPE--LG--RDERPVLKILAMDWSQVTQIDATGVQ 761
           WE P                   E +P+  +G  RD+RP+LKIL +D+SQV Q DAT +Q
Sbjct: 737 WEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQ 796

Query: 762 NLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIV 821
           +LVDLRK IN+YADRQVEFHF GIISPW+KR LV+ GFGT+N+E++DES++ GH+SYH+ 
Sbjct: 797 SLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVA 856

Query: 822 KTRPQDEENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           +  PQ +EN     +Y++  ASGTN+PFFH+++PDF+KW +
Sbjct: 857 RV-PQSKEN---SDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/863 (56%), Positives = 585/863 (67%), Gaps = 44/863 (5%)

Query: 26  NLDDLEAEYDNYKNAEQ---------NPREKSDVVETLPPTTHQNDAKGLKNDGQTT--- 73
           +LDDL+AEY ++KN E          NP     V  +      QN  K     G      
Sbjct: 11  DLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGNGANE 70

Query: 74  -VELYGTTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNF 132
            + LY +  +      Y+ED V F++YYD            R+YL  L PVI W+PHYN 
Sbjct: 71  PLALYDSPEA------YYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNG 124

Query: 133 AWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPV 192
            W Y              PQSMSYA IA+LP Q+GLYSSF+GA IYSFFATSKDVCIGPV
Sbjct: 125 RWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPV 184

Query: 193 AVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNA 252
           AVMSL+TAK +++V   LP DT+IT P++ATAL+ LCG I+LG+GVLRLGFLVELIS  A
Sbjct: 185 AVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTA 244

Query: 253 VAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLI 312
           VAGFMTGSA +II+GQLPALMGYN+ VNTR +TYKV+I TLKHLPDTKLDAVFGLIPL++
Sbjct: 245 VAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVM 304

Query: 313 LYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHK 372
           LY WK+ CN+ GP  V+R     S + + W +  FY QALRNA +I++FT IAW I+ HK
Sbjct: 305 LYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHK 364

Query: 373 KKHPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYK 432
           KK PISLL  VPSGLK+VGVMK PD LA                      KAFGR+NDY+
Sbjct: 365 KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYR 424

Query: 433 VVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCL 492
           VVPDQELIAIG TNL+GTFFNAYPATGSFSRSALKAKCNV TPLSGVF+GACVLLA+YCL
Sbjct: 425 VVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484

Query: 493 TEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGI 552
           T AF YIPKATLSAVIIHAVSDLIASY+TTW+ W++NPLD +CFL TVFI +FSSIENGI
Sbjct: 485 TSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGI 544

Query: 553 YFAICWSCAILLFKIAFPSGKFLGRVEVSEV-INPTV---REDLGVVEDFD-SENINVAS 607
           YFA+CWS A+LLFK+AFP  +FLGRVE++E+  N  V    E   + +DF+  + ++ AS
Sbjct: 545 YFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEKGKGVSYAS 604

Query: 608 STKPKLGLSADNSSISTGPSRV---------RFHTKWIPLENNYGREYNSXXXXXXXXXX 658
            +      +A    I  G   V          FHTKW+P E  Y RE N           
Sbjct: 605 GSVSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNPQVPVAQPPPG 663

Query: 659 XXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXX 718
              +RPSESWTY+NC+RQY+ IFDEV R TRRG V   T KS RPWNDPG+W PP     
Sbjct: 664 VIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKVQV-TSKSGRPWNDPGEWHPP--KFL 720

Query: 719 XXXXXXXXEQELSPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQV 778
                    + L   +  D+RPVL+++AMDWSQV Q+D+TG+Q L DLRKA++KYADRQV
Sbjct: 721 RKWFGKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQV 780

Query: 779 EFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQ-DEENHIGQGRY 837
           EFHFSGIISPWIKR L+  GFGTVN+E ADESL++GH +Y + +     DEE  + Q   
Sbjct: 781 EFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGATGDEEALLPQ--- 837

Query: 838 NISAASGTNMPFFHVEMPDFSKW 860
               A+G NMPFFH EMPDFSKW
Sbjct: 838 ---PATGVNMPFFHAEMPDFSKW 857

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/915 (54%), Positives = 600/915 (65%), Gaps = 72/915 (7%)

Query: 1   MSDYHTH---NRGSSKDLEHNSSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVETLPPT 57
           MS++ +     R SS ++    S+ A  +LDDL+AEY  +KNAE      SD       T
Sbjct: 1   MSNFQSSPGSKRESSFEVSRELSNDAPIDLDDLDAEYGQFKNAEH-----SDATAGRDLT 55

Query: 58  TH---QNDAKGLKNDGQTTVELYGTTSSGGVIPG-----------YHEDTVNFKDYYDQX 103
           +    Q  A+     G  +    G   +  V P            +HE  V   ++Y Q 
Sbjct: 56  SEYGAQFAAEFGGEPGSGSGSGSGFPEAKPVAPAAPGNVPSALYEFHERPVTVGEFYSQN 115

Query: 104 XXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLP 163
                    F  YL SL P++RW+PHYN  W+Y              PQSMSYAQIA+L 
Sbjct: 116 LRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCVLVPQSMSYAQIATLS 175

Query: 164 AQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIAT 223
            QYGLYSSF+GAFIYSFFATSKDVCIGPVAVMSL+TAK I+ V   LP+DTEIT P+IAT
Sbjct: 176 PQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVSSLPEDTEITSPMIAT 235

Query: 224 ALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRD 283
           AL+LLCG I+LG+GVLRLGFLVELIS  AVAGFMTGSA +II GQ+PALMGYN+ VNTR 
Sbjct: 236 ALALLCGIISLGLGVLRLGFLVELISSTAVAGFMTGSALNIIAGQVPALMGYNKLVNTRT 295

Query: 284 TTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWK 343
           +TYKV+IN+L+HLPDTKLDAVFGL+PL+ILY+WK+GC+T GP  V R     S R++ W 
Sbjct: 296 STYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPRLVQRY---GSRRSRMWD 352

Query: 344 SFFFYAQALRNAFVIVLFTLIAWGITRHKKKHP----ISLLNTVPSGLKNVGVMKFPDHL 399
           + F Y QALRNA VIV+FT IAWG++    K      ISLL TVPSGLK+VGVMK P  L
Sbjct: 353 NVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARISLLGTVPSGLKDVGVMKVPSGL 412

Query: 400 ATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATG 459
            +                     KAFGR+NDY+VVPDQELIAIG TNL+GTFFNAYPATG
Sbjct: 413 LSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQELIAIGATNLIGTFFNAYPATG 472

Query: 460 SFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASY 519
           SFSRSALKAKCNV TPLSG+F+GACVLLA+YCLT AF +IPKATLSAVIIHAVSDLIASY
Sbjct: 473 SFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASY 532

Query: 520 ETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVE 579
           +TTW+FW+++P D +CFLVTV IT+FSSIENGIYFA+CWS A+LLF+ AFP+GKFLGRV+
Sbjct: 533 KTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQ 592

Query: 580 VSE-----------------------VINPTVREDLGVVEDFDSENINVASSTKPKLGLS 616
           ++E                       V     RE         SE+++  +  K K   S
Sbjct: 593 IAEARVTNSGAGAGVGMSSGNSAGTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANS 652

Query: 617 ADNSSIST---------GPSRVRFHTKWIPLENNYGREYNSXXXXXXXXXXXXXYRPSES 667
           A    +            P   RFHTKW+P +  Y RE N              +RPSES
Sbjct: 653 AGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFD-RYTRELNPEVFVAPPPPGVIVFRPSES 711

Query: 668 WTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXXXXXXXXXE 727
           WTY+NCSRQYD IFDEV RLTRRG      K S RPWNDPG+W PP             E
Sbjct: 712 WTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPWNDPGEWHPP--KFLRKLFKSSSE 769

Query: 728 QELSPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIIS 787
              +  + RDERPVL+++AMDWSQV Q+D+TG+Q L DLRKA+NKYADRQVEFHF+GII 
Sbjct: 770 DLENRAVARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIE 829

Query: 788 PWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRP--QDEENHIGQGRYNISAASGT 845
           PW+KR L+  GFGTVNDEFADESL++GH S HI ++    +DEE+ +         A+GT
Sbjct: 830 PWVKRGLINSGFGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAH------PATGT 883

Query: 846 NMPFFHVEMPDFSKW 860
           N+PFFH+E+PDFS+W
Sbjct: 884 NLPFFHLELPDFSEW 898

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/898 (53%), Positives = 597/898 (66%), Gaps = 72/898 (8%)

Query: 27  LDDLEAEYDNYKNAEQ--NPREKSDVVETLPPTTHQNDAKGLKNDGQTTVELYGTTSSGG 84
           LD+LE EY+ +KN E+  N    +D+ + L       D K       T    YG  S   
Sbjct: 4   LDNLELEYNQFKNNERPSNTNAGADIEKGL-------DTKKYFERSITDNSTYGKKSYS- 55

Query: 85  VIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXXXXXXX 144
            IP Y EDT+  KDYYD             +Y+ SLFPV+ W+P YN  W          
Sbjct: 56  -IPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGIT 114

Query: 145 XXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIA 204
                 PQSMSYAQIA+LP +YGLYSSFIGA +YSFFATSKDVCIGPVAVMSL+TAKVIA
Sbjct: 115 VGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIA 174

Query: 205 RVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFS 263
           RV E  PD D  ITGPIIAT L+ +CG I  G+G+LRLGFLVELISLNAVAGFMTGSAF+
Sbjct: 175 RVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFN 234

Query: 264 IITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTI 323
           II GQ+P LMGY++KVNTR +TY VVI++LKHLPDTKLDA FGLIPL  L+ WK+ CN++
Sbjct: 235 IIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSM 294

Query: 324 GPNWVDRRMNPHS-PRA-KFWKSFFFYAQALRNAFVIVLFTLIAWGITR--HKKKHPISL 379
           GP   DR    +S PRA K+WK+F+FY QA RN  +I+LFT +++GIT+   K K  IS+
Sbjct: 295 GPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISV 354

Query: 380 LNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQEL 439
           L TVP GL++ GVMK P  +  N                    K+FGR+NDYK+ P+QE+
Sbjct: 355 LGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEI 414

Query: 440 IAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYI 499
           IAIGV+NL+GTFFNAYPATGSFSRSALKAKCNV TPLSG+F+ ACVLLA+YCLT AF+YI
Sbjct: 415 IAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYI 474

Query: 500 PKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWS 559
           PKATLSAVIIHAV DLIASY TTW+ WKMN  D + F+ TVFIT+FSSIENGIYFA+CWS
Sbjct: 475 PKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWS 534

Query: 560 CAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVV-----EDFDSENINVASST-KPKL 613
           CAILL+  AFP+GKFLGR+E++EV+NP + +D         E FD E I   +S  + KL
Sbjct: 535 CAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKL 594

Query: 614 GLSAD-----NSSIST-----------GPSRVRFHTKWIPLENNYGREYNSXXXXXXXXX 657
           G S++     N+ + T             S +R++TKW+P ++ Y +E N          
Sbjct: 595 GTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPP 654

Query: 658 XXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPX--- 714
               YR S+S+TYINCSR YD+IFDE+KR+TRRG ++ H  K DRPWNDPG+WE P    
Sbjct: 655 GVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLKK 714

Query: 715 -----------XXXXXXXXXXXXEQELS--------PELGRDERPVLKILAMDWSQVTQI 755
                                  E E+          +  +DERP+L+++ +D+SQV   
Sbjct: 715 FFNVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANT 774

Query: 756 DATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGH 815
           DAT +Q+L DLRKA+NKYADRQVEFHF GI SPWIKR L  +GFGT N+E++DES+I GH
Sbjct: 775 DATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGH 834

Query: 816 SSYHIVKTRPQDE-----------ENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           SSYH+ + R  ++           + +IG  +  + AASGTN+PFFHV++PDFSKW +
Sbjct: 835 SSYHLSRFRESEQDGFNELDSLESQRNIGS-KTKVLAASGTNLPFFHVDIPDFSKWDI 891

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/858 (53%), Positives = 595/858 (69%), Gaps = 35/858 (4%)

Query: 34  YDNYKNAEQNPREKSDVVETLPPTTHQNDAKGLKNDGQTTVEL-YGTT------------ 80
           Y+ YK  E+  +  SDV ++       N   GL  D +   E   G T            
Sbjct: 15  YNQYKTVEE--QGNSDVGDSSGNDDLGNAGDGLTKDSKFVFEKDLGYTDDSNELTRESFL 72

Query: 81  SSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXXX 140
           +S   +P Y E+TV  K+YY+           F  YLIS+FP+I+W+P YN+ W+     
Sbjct: 73  NSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLI 132

Query: 141 XXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETA 200
                     PQSMSYAQIA+LP QYGLYSSF+GA+ YS FATSKDVCIGPVAVMSL+TA
Sbjct: 133 AGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTA 192

Query: 201 KVIARVTEHLPDD--TEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMT 258
           KVI  V   L ++  T IT P+IAT L+LLCG I+ G+G+LRLGFLVELISLNAV GFMT
Sbjct: 193 KVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMT 252

Query: 259 GSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKY 318
           GSA +II+GQ+PALMGY  +VNTR+ TYKV+INTLKHLPDTK+DA+FGLIPL+ILY WK+
Sbjct: 253 GSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKW 312

Query: 319 GCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKKK--HP 376
             +++GP  VDR   P+S   K+ K+F+FY  A+R+  +I++ T I+W +TR K K   P
Sbjct: 313 WFSSMGPKLVDRYY-PNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSERP 371

Query: 377 ISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPD 436
           IS+L TVPSGL+ VGV   P+ L                       K+FGR+NDYKVVPD
Sbjct: 372 ISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPD 431

Query: 437 QELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAF 496
           QELIAIG++NL+GTFFN+YP TGSFSRSALKAKCNV+TPLSG+FTG+CVLLALYCLT AF
Sbjct: 432 QELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAF 491

Query: 497 YYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAI 556
           +YIPKATLSAVIIHAVSDL+ASY+TTW+FWKMNPLD +CF+ TVFIT+F+SIE+GIYF +
Sbjct: 492 FYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTM 551

Query: 557 CWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLS 616
           CWS AILLFK+AFP+GKFLG V+++E++NP + +   +VE  ++          P+ G  
Sbjct: 552 CWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVEKAETSVQYSTVLMNPEKGEL 611

Query: 617 ADNSSISTGPSRVRFHTKWIPLENNYGREYNSXXXXXXXXXXXXXYRPSESWTYINCSRQ 676
           +  SS S+  S++++H KWIP ++ Y +E N              YR +ES+TYINCSR 
Sbjct: 612 SYLSSKSSE-SQLKYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRN 670

Query: 677 YDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXXXXXXXXXEQELSPELGR 736
           Y+ ++D+VK LTR G ++ H KKSDRPWNDPG W+PP              ++  P    
Sbjct: 671 YETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLKNIINWRKNKNKDDEPTTFD 730

Query: 737 ----DERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKR 792
               D RP+LKI+ +D+SQV Q D+T +Q+L+DLR+AINKYADRQVEFHFSGI+SPW+K+
Sbjct: 731 NKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKK 790

Query: 793 ALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQDEENHI--------GQGRYNISAASG 844
            LV +GFGTVN E++DES+I+GH+SYH+VKT  +D EN+             Y I A +G
Sbjct: 791 GLVNLGFGTVNKEYSDESIIIGHTSYHVVKT--EDLENNPMTTVEEPNQNSSYYIHAGTG 848

Query: 845 TNMPFFHVEMPDFSKWSL 862
           TN PFFH+E+PDFSKW++
Sbjct: 849 TNFPFFHIEIPDFSKWNI 866

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/838 (55%), Positives = 568/838 (67%), Gaps = 26/838 (3%)

Query: 26  NLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQN-DAKGLKNDGQTTVELYG-TTSSG 83
           +++ L+AEYD  K  E         V +    TH +  ++     G+   +  G   +S 
Sbjct: 30  DIEALQAEYDQLKAGE---------VHSAQGATHGDIGSRQYSGSGKPAAQYLGLNVNSR 80

Query: 84  GVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXXXXXX 143
             +P Y E  V+ KDYY+            R+Y +S+FP+ RWI HYN AWMY       
Sbjct: 81  EAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGI 140

Query: 144 XXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVI 203
                  PQSMSYAQ+ASL  QYGLYSSF+GAFIYSFFATSKDVCIGPVAVMSLETAKVI
Sbjct: 141 TVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI 200

Query: 204 ARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFS 263
           ARVTE+LP+DT ITGPIIATAL+LLCGAI + IG+LRLGFLVE IS+ AV GFMTGSA S
Sbjct: 201 ARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALS 260

Query: 264 IITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTI 323
           II+GQ+P+LMGY++KVNTR TTYKV+I +LKHL DT ++A FGL+PL++L+LWK+ C ++
Sbjct: 261 IISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSL 320

Query: 324 GPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHK-KKHPISLLNT 382
           GP  VDR +     RA  W + FFY QALRNA +IV+FT I+WGI+RHK +K PISLL  
Sbjct: 321 GPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKPPISLLGK 380

Query: 383 VPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAI 442
           VPSGLKNVG ++ P+ L                       K+FGRIN+YKVVPDQELIAI
Sbjct: 381 VPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAI 440

Query: 443 GVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKA 502
           GVTNL  TFFNAYPATGSFSRSALKAKCNV+TPLSG+FTGACVLLALYCLTEAFY+IPKA
Sbjct: 441 GVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKA 500

Query: 503 TLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAI 562
           TLSAVIIHAV+DLIASY+ TW FW+ NPLD   F+VTV IT+FSSIE+GIYF+I WSCA+
Sbjct: 501 TLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFSISWSCAV 560

Query: 563 LLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLSADNSSI 622
           LL K+AFP GKFLG ++V+EVI P     +    D  S + +       K G   +    
Sbjct: 561 LLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGGKLNTVES 620

Query: 623 STGPSRVRFHTKWIPLENNYGREYNSXXXXXXXXXXXXXYRPSESWTYINCSRQYDIIFD 682
                  RFH +WIPL++ Y RE N              YRP++SWTY+NCSR +DII D
Sbjct: 621 VLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILD 680

Query: 683 EVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXXXXXXXXXEQELSPELGRDERPVL 742
            VK  TR G ++ H    +R W DPG W PP               + +     D RPVL
Sbjct: 681 HVKEHTRPGQLVNHLSNKERLWCDPGPWRPP------RIFRRFIADKRTGSAVADARPVL 734

Query: 743 KILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTV 802
           ++LAMDWSQV+Q+D+TG+QNLVDLR A+NKYADR VEFHF+GI+SPWIKRALV  GFG  
Sbjct: 735 RVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFG-- 792

Query: 803 NDEFADESLILGHSSYHIVKTRPQDEENHIGQGRYNISAASGTNMPFFHVEMPDFSKW 860
               AD  LI    SYH+V+  P D   HI  G +++  A GTN PFFH++MPDF  W
Sbjct: 793 ---IADPPLISSRVSYHLVRL-PADPP-HIVHG-HSVVFALGTNTPFFHLDMPDFETW 844

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/857 (53%), Positives = 586/857 (68%), Gaps = 36/857 (4%)

Query: 16  EHNS--SDFAEPNLDDLEAEYDNYKNAE---QNPREKSDVVETLPPTTHQNDAKGLKNDG 70
           +H++  +DF+  NLDDLE E++ YK  E    + R+  +V         +   K  KN  
Sbjct: 4   QHDTELTDFS--NLDDLEQEFNQYKKIELTISSTRQNEEV-------DSKRQGKSDKNVK 54

Query: 71  QTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHY 130
            ++ +   + +    +P Y E+++   DYY              +Y+ SLFP+  W+PHY
Sbjct: 55  SSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHY 114

Query: 131 NFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIG 190
           N  W                PQSMSYAQIA+L  Q+GLYSSFIGAF YS FATSKDVCIG
Sbjct: 115 NLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIG 174

Query: 191 PVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISL 250
           PVAVMSL+TAKVIARV + LP DT+IT   IAT L+LLCG I  G+G+LRLGFLVELISL
Sbjct: 175 PVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISL 234

Query: 251 NAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPL 310
           NAVAGFMTGSA +II+GQ+P LMGYN +VNTR +TYKV+I+TLKHLPDTKLDAVFGLIPL
Sbjct: 235 NAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPL 294

Query: 311 LILYLWKYGCNTIGPNWVDRRM-NPHSPRA-KFWKSFFFYAQALRNAFVIVLFTLIAWGI 368
            +L+ WK+ C+ +GP   +R   N  +PRA +  K+F+FYAQ  +NA +I++FT I+W I
Sbjct: 295 FLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAI 354

Query: 369 TRHK--KKHPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFG 426
           TR K  +  PIS+L +VP GLK+V     P  L                       K+FG
Sbjct: 355 TRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFG 414

Query: 427 RINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVL 486
           RINDYK+VPDQE++AIG+TNL+GTFF+AYPATGSFSRSALKAKCNVRTPLSG+F+GACVL
Sbjct: 415 RINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVL 474

Query: 487 LALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFS 546
           LALYCLT AF+YIPKATL AVIIHAVS+LIASY+ T NFWKMNPLDC CFLVTV IT+F+
Sbjct: 475 LALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFA 534

Query: 547 SIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVA 606
           SIE+GIYFA+CWS A+LLFK+AFP GKFLG++E++EV++  +  D  V+   D EN  + 
Sbjct: 535 SIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSD-ENSEIL 593

Query: 607 SSTKPKLGLSADNSSISTGPSRVRFHTKWIPLENNYGREYNSXXXXXXXXXXXXXYRPSE 666
            +TK    +      +S       ++TKW+P + +Y +E N              YR ++
Sbjct: 594 PTTKAGYSVEV----VSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMAD 649

Query: 667 SWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXXXXXXXXX 726
           S+TY+NCSR +DI+FDE+KR T+RG +    +KSDRPWNDPG+WEP              
Sbjct: 650 SFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRRENYD 709

Query: 727 EQELSPE-LGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGI 785
           E  +  E    D+RP LKI+ +D+SQV+QIDAT +Q L DLRK++NKYADRQVEFHF GI
Sbjct: 710 EDNVDIEDRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGI 769

Query: 786 ISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQDEENHIGQGRYNISAASGT 845
           ISPWIK++L   GFGT+N+E++DES+I+GHSSYH+ K                I AA+GT
Sbjct: 770 ISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTKDVD------------GIKAATGT 817

Query: 846 NMPFFHVEMPDFSKWSL 862
           N+PFFH+++P+F+KW +
Sbjct: 818 NLPFFHIDIPNFNKWDI 834

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/877 (52%), Positives = 587/877 (66%), Gaps = 45/877 (5%)

Query: 26  NLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQNDAKGLKNDGQTTVELYGTTSS--- 82
           NLDDLE EYD YK AE   R    VV         +  KG  +  +T +E + +T+    
Sbjct: 35  NLDDLEQEYDQYKAAEDRER----VVGRGDDEYDDDLRKGKVDYKETELEYWNSTNGTTN 90

Query: 83  ----GGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXX 138
                  +P Y E  V   D +             + Y  S FP+I+W+P YN+ W Y  
Sbjct: 91  LLAPKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNWKWGYAD 150

Query: 139 XXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLE 198
                       PQSMSYAQIA+LP QYGLYSSF+GAFIYSFFATSKDVCIGPVAVMSLE
Sbjct: 151 LVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLE 210

Query: 199 TAKVIARVTEHLP-DDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFM 257
           TAKVI    E  P +D E+TGP+IATAL+LLCG + +G GVLRLGFLVELISLNAVAGFM
Sbjct: 211 TAKVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLVELISLNAVAGFM 270

Query: 258 TGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWK 317
           TGS+ +II+GQ+PALMG+ + V+TRD+TYK++IN+LK+L  T+LDAVFGLIPL++LY WK
Sbjct: 271 TGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLVLLYTWK 330

Query: 318 YGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKKKHPI 377
           + C++ GP   DR    +  +    K+F+FYAQA+R+A +I++FT I++GIT+ +K   I
Sbjct: 331 WWCSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVIIIVFTAISYGITKGRKTPRI 390

Query: 378 SLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQ 437
           S+L  VP GLK+V VM+ P+ L +                     K+FGR+N+YKVVPDQ
Sbjct: 391 SVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGRVNNYKVVPDQ 450

Query: 438 ELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFY 497
           ELIAIG TNL+GTFFNAYPATGSFSRSALKAKCNVRTPLSGVF+GACVLLALYCLT+ FY
Sbjct: 451 ELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVLLALYCLTQTFY 510

Query: 498 YIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAIC 557
           YIP ATLSAVIIHAVSDL ASY+T+WNF+KMNP D + F+VTVFIT+FSSI+ GIYFA+C
Sbjct: 511 YIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFSSIDYGIYFAMC 570

Query: 558 WSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENIN-------VASSTK 610
           WS A+ L K  F  G+FLGRVEV+EV+N  V  ++  V +    +++       + SS+K
Sbjct: 571 WSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESVSESAGSHLDGFQAQSSIESSSK 630

Query: 611 P--KLGLSADNSSISTG-------------PSRVRFHTKWIPLENNYGREYNSXXXXXXX 655
               L  SA +S+   G               ++ +HTKWI  + +Y RE+N        
Sbjct: 631 KLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYHTKWISYDRSYSREFNPEVPIQPP 690

Query: 656 XXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXX 715
                 YR  +S+TY+NCSR YDII+DEV+R TRRG +++  KK DRPWNDPG+WE P  
Sbjct: 691 PPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRPWNDPGEWEAPRW 750

Query: 716 XXXXXXXXXXXEQELSPELG---------RDERPVLKILAMDWSQVTQIDATGVQNLVDL 766
                      E+    E           +D RP+LKI+ +D+SQ +Q DAT +QNL DL
Sbjct: 751 FKKLTSKKKTAEEWAETEAQESKAAEQKLQDNRPLLKIICLDFSQCSQTDATAIQNLTDL 810

Query: 767 RKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQ 826
           RK +N+YADRQVEFH  G+ +PW+KRALV  GFGTVN+E++DESL+ GH SYH+ +  P 
Sbjct: 811 RKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESLLAGHRSYHVARA-PT 869

Query: 827 DEENHIGQ-GRYNISAASGTNMPFFHVEMPDFSKWSL 862
             E+ +G   +Y++  ASGTN+PFFHVE+PDFSKW L
Sbjct: 870 SLEDGLGSPAQYSVYPASGTNLPFFHVEIPDFSKWDL 906

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/891 (51%), Positives = 587/891 (65%), Gaps = 58/891 (6%)

Query: 26  NLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQN--------DAKGLKNDGQT----T 73
           +L+ LE EYD YK  E+      + + +  PT + N        + K LK+  Q+    +
Sbjct: 31  DLEALEEEYDQYKKEEEIEYISGNYLNS-SPTQNINVTSNPKYEEYKKLKHLDQSYNYVS 89

Query: 74  VELYGTTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFA 133
            E   T     +IP ++E+ + FK+YY+            + Y +S+FP+I W+P YNF 
Sbjct: 90  TEYLDTDY---LIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALSIFPIIHWLPFYNFN 146

Query: 134 WMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVA 193
           W                PQSMSYAQIA+L  QYGLYSSFIGAF+Y+ FATSKDVCIGPVA
Sbjct: 147 WFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYALFATSKDVCIGPVA 206

Query: 194 VMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAV 253
           VMSLETAKVIA V+ H  +D ++TGPIIAT L+LLCG I   +G LRLGFLVELISLNAV
Sbjct: 207 VMSLETAKVIADVSSHFQNDPDVTGPIIATTLALLCGGIAAAVGFLRLGFLVELISLNAV 266

Query: 254 AGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLIL 313
            GFMTGSAF+I+ GQ+P LMGY++ VNTR  TYKVVI+TLKHLPDTKLDAVFGLIPL IL
Sbjct: 267 TGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDTKLDAVFGLIPLFIL 326

Query: 314 YLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHK- 372
           Y+ K+ C   G    +++ + +     + K F+FY  A+RNA VI++FT I+W ITR+K 
Sbjct: 327 YVVKWWCTNYGLQLAEKQFSSNERYRFYLKKFYFYTNAMRNAVVIIIFTAISWSITRNKS 386

Query: 373 -KKHPISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDY 431
             + PI++L TVPSGLK++GV K    +                       K+FGRINDY
Sbjct: 387 SSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLLEHIAIAKSFGRINDY 446

Query: 432 KVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYC 491
           K+VPDQELIAIG++NLVGTFF+AYPATGSFSRSAL AKCNV+TPLSG+FTG CVLLALYC
Sbjct: 447 KIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPLSGIFTGGCVLLALYC 506

Query: 492 LTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENG 551
           LT AF+YIPKATLSAVIIHAVSDLIASY+TT +FW MNPLD LCFLVTV IT+FSSIENG
Sbjct: 507 LTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCFLVTVLITVFSSIENG 566

Query: 552 IYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGV--VEDFDSENIN--VAS 607
           IYFA+C+SCA+ +F+ AFP+GKFLGR+E++EVIN T ++D  +     F++   N   A 
Sbjct: 567 IYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINATPKDDFQMDNFNGFETSEYNNFPAD 626

Query: 608 STKPKLGLSADNSSISTGPSRVR-FHTKWIPLENNYGREYNSXXXXXXXXXXXXXYRPSE 666
            +  K  ++  N+     P   + F+TKW+P ++ Y +E N              YR S+
Sbjct: 627 QSYGKFDIANKNTHKYNSPHCSKNFYTKWVPFDHTYTKELNKDVEILEPPPGVIVYRLSD 686

Query: 667 SWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXXXXXXXXX 726
           S+ Y+NCSR +D IFDEVKR T+RG  + + KKS RPWNDPG+WE P             
Sbjct: 687 SFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQRPWNDPGEWEAPTWMTKKFSIRNLF 746

Query: 727 EQELSPE-------------------LGRDERPVLKILAMDWSQVTQIDATGVQNLVDLR 767
           +++   E                   +  D RPVL+++ +D+SQV+Q D T +Q+L DLR
Sbjct: 747 KRKQEAESNVPNEDASTDLDISNNKDIDMDHRPVLQVICLDFSQVSQTDNTALQSLFDLR 806

Query: 768 KAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKT---R 824
           K++N YADRQVEFHF GIISPW+KR L+ +GFGTVN+ ++D S I+GH SYHIVK    R
Sbjct: 807 KSVNSYADRQVEFHFCGIISPWVKRGLIKLGFGTVNEAYSDASTIVGHVSYHIVKNPTFR 866

Query: 825 PQDEENHIGQ-------------GRYNISAASGTNMPFFHVEMPDFSKWSL 862
            +   +H  +               Y+I AASGTN PFFH+++P+FSKW +
Sbjct: 867 NKSFSSHTSEDTISDMNIEAKDYNNYSIEAASGTNYPFFHIDIPNFSKWDV 917

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/855 (52%), Positives = 574/855 (67%), Gaps = 39/855 (4%)

Query: 27  LDDLEAEYDNYKNAE--------QNPREKSDVVETLPPTTHQNDAKGLKNDGQTTVELYG 78
           LD+LE +Y  +K  E        +N R + D  +++      +  +  K DG    +   
Sbjct: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSV-----GSSLQFAKYDGNALPDFKA 94

Query: 79  TTSSGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXX 138
                   P Y+E TV F +YYD+          FR Y +SLFP+I+WI HYNFAWMY  
Sbjct: 95  --------PPYYETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSD 146

Query: 139 XXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLE 198
                       PQSMSYAQ+A L  +YGLYSSFIGAFIYSFFATSKDVCIGPVAVMS++
Sbjct: 147 FIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQ 206

Query: 199 TAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMT 258
            +KVI+ V + LP+ T IT P++A+AL+L    + + IG+LRLGF++ELIS+ AVAGFMT
Sbjct: 207 VSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMT 266

Query: 259 GSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKY 318
           GSA SI+  QLP+L+G  +K+NTR  TY+V+I+TLKHL  + ++A FGLI L +L+ WK+
Sbjct: 267 GSALSILASQLPSLLGI-QKINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKW 325

Query: 319 GCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAW-GITRHKKKHPI 377
            C  +GP  + + + P+S +A+ W+SFFFYAQALRNAFV+ L T ++W  I RHKKK  I
Sbjct: 326 TCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKKTSI 385

Query: 378 SLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQ 437
           S+L TVPSGLK+VGV   P  L                       K+FGRIN+YK+VPDQ
Sbjct: 386 SVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQ 445

Query: 438 ELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFY 497
           ELIAIGVTNL+G+FFNAYPATGSFSRSALKAKCNV+TPLSG+F+GACVLLALY LT AFY
Sbjct: 446 ELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFY 505

Query: 498 YIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAIC 557
           YIPKA LSAVIIHAV DLIASY+ ++  W  NP D + FL T+ +TIFSSIENGIYFA+ 
Sbjct: 506 YIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVA 565

Query: 558 WSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLSA 617
           +S A LL K AFPSGKFLG V+++EV N  V EDL  + + D E +    S   KL    
Sbjct: 566 FSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPE-LPQEISKDSKLAKDP 624

Query: 618 D---NSSISTGPSRVRFHTKWIPLENNYGREYNSXXXXXXXXXXXXXYRPSESWTYINCS 674
           D   ++++      VRFHTKW+PL+N Y RE N              YRP+ESW Y+NCS
Sbjct: 625 DVHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCS 684

Query: 675 RQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPXXXXXXXXXXXXXEQELSPEL 734
           RQ+DII D VK LTR G ++ H +KS++ W +PG W PP              +   PE+
Sbjct: 685 RQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPP--LFLRKFFKKYRHKAAKPEV 742

Query: 735 GR--DERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKR 792
               D RPVLKILAMDW+QVT +D+T +Q+L+DLRK IN+YADRQV FHFSGI+SPWIKR
Sbjct: 743 VEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKR 802

Query: 793 ALVAVGFGTVNDEFADESLILGHSSYHIVK-TRPQDEENHIGQGRYNISA----ASGTNM 847
           ALV  GFGT+N+ ++++ L+L +S+YH+V+     DEEN   Q    ISA    ASGTN 
Sbjct: 803 ALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEEN---QQNSEISASLDVASGTNF 859

Query: 848 PFFHVEMPDFSKWSL 862
           PFFH++MPDF+KW +
Sbjct: 860 PFFHIDMPDFTKWDI 874

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/894 (51%), Positives = 582/894 (65%), Gaps = 67/894 (7%)

Query: 26  NLDDLEAEYDNYKNAE--QNPREKSDVVET--LPPTTHQNDAKGLKNDGQTTVELYGTTS 81
           +L+  E EYD+ K  +   +  E  D+     +   T Q D    + D  +++       
Sbjct: 10  DLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNSSLS------ 63

Query: 82  SGGVIPGYHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXXXX 141
               IP Y+E  V  KD+Y +            +YL SLFP+++W+PHYN  W+      
Sbjct: 64  ----IPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIA 119

Query: 142 XXXXXXXXXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAK 201
                    PQSMSYAQIA+L  QYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSL+TAK
Sbjct: 120 GITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAK 179

Query: 202 VIARVTEHLPDDTEI--TGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTG 259
           VI RVT  L  D +   T PIIATAL+LLCG I+ GIG LRLGFL+E ISLNAVAGFMTG
Sbjct: 180 VIERVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTG 239

Query: 260 SAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYG 319
           SAF+II GQ+PALMGYN+KVNTR +TY+VVINTLKHLPDTKLDAVFGLIPL ILYL K+ 
Sbjct: 240 SAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWF 299

Query: 320 CNTIGPNWVDRRMNPHSPRA------KFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKK 373
            +++GP ++++  N  +         K+  ++FFY+ A+RN  VI++FT I+W ITR K 
Sbjct: 300 FSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKS 359

Query: 374 KH--PISLLNTVPSGLKNVGVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDY 431
               PIS+L TVP GLK V V K P  L                       K+FGR+NDY
Sbjct: 360 STSVPISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDY 419

Query: 432 KVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYC 491
           K+VPDQELIAIGVTNL+GTFF AYPATGSFSRSALKAKC+V+TPLSG+F+GACVLLALYC
Sbjct: 420 KIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYC 479

Query: 492 LTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENG 551
           LT AFYYIPKATLSAVIIHAVSDL+ASY+TT NF+KMNPLD +CF+ TVFIT+FSSIE G
Sbjct: 480 LTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYG 539

Query: 552 IYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVR-EDLGVVEDFDS---------- 600
           IYFAIC+SCA L+FK  FP G FLG ++++EV+NPT+   D  ++ D  S          
Sbjct: 540 IYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKD 599

Query: 601 --------ENINVASSTKPKLGLSADNSSISTGPSRVRFHTKWIPLENNYGREYNSXXXX 652
                   +N N  SS K      +   S ++  + + ++ +W+P++N+Y RE N     
Sbjct: 600 DSVKNRLDQNENPKSSEKEYSEFKSYEMSSNSKTTNLSYYVRWVPMKNDYHREVNPLIKI 659

Query: 653 XXXXXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEP 712
                    YR  +S+TY+NCSR YDII+DEVK+ TR+GI   + +K DRPWND G+WE 
Sbjct: 660 TPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWEC 719

Query: 713 PXXXXXXXXXXXXXE--------------QELSPELGRDERPVLKILAMDWSQVTQIDAT 758
           P                            +  S     D +P LKI+  D+SQV Q DAT
Sbjct: 720 PKSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDAT 779

Query: 759 GVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSY 818
            +Q+L DLRKA+N+Y+++Q+E+HFSGIIS W+K++L+ +GFGTVND ++D+S+I+GH SY
Sbjct: 780 AIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSY 839

Query: 819 HIVKTRPQDE--ENHI--------GQGRYNISAASGTNMPFFHVEMPDFSKWSL 862
           H+ K   Q++  EN I        G   Y+I   +GTN PFFH+++PDFS W L
Sbjct: 840 HVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  472 bits (1215), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 249/527 (47%), Positives = 329/527 (62%), Gaps = 26/527 (4%)

Query: 89  YHEDTVNFKDYYDQXXXXXXXXXXFREYLISLFPVIRWIPHYNFAWMYXXXXXXXXXXXX 148
           Y E  V   + ++            + YL+SL P+ +WI HYN  W              
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 149 XXPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTE 208
             PQSMSYAQIA+L  QYGLYSS +G FIY+ FATSKD+CIGPVA+MSL+TAK IA V +
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 209 HLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQ 268
             PD   I   IIA+ ++++CGAIT+GIGVLRLGF ++LI + AV GF +GSAF+I+ GQ
Sbjct: 123 KHPD---IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWGQ 179

Query: 269 LPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTIGPNWV 328
           +P LMGY++ VNTR  TYKVV++TLK LP T ++AV GLIPL  L++WKYGC+     + 
Sbjct: 180 IPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCD-----YA 234

Query: 329 DRRMNPHSPRAKFW-KSFFFYAQALRNAFVIVLFTLIAWGITRHKKKHPISLLNTVPSGL 387
            RR N      K W K   FY  +LR   VI++ +  A+G     K   + +L  +P G 
Sbjct: 235 LRRGN-----LKPWPKRIVFYLLSLRVTIVIIICSAAAYG----AKNPSLKVLGKIPKGF 285

Query: 388 KNVG---VMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGV 444
                  +   P  L ++                    K+F R+N+Y+V  DQEL AIGV
Sbjct: 286 AAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTAIGV 345

Query: 445 TNLVGTF-FNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKAT 503
           +N++G     AYP TGSFSR+ALKA+C VRTPL  +F+G CV++A+  LT A  +IPKAT
Sbjct: 346 SNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIPKAT 405

Query: 504 LSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAIL 563
           LSAVIIHAVS LI+SY+ T   +KM PLDCL FLVT+FIT+FS IE G+YFA+CW+C +L
Sbjct: 406 LSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWACFLL 465

Query: 564 LFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTK 610
           + +IAFP G FLG V V E+     R  + ++E  D E+ N   + K
Sbjct: 466 MIRIAFPYGAFLGYVRVREI----SRSSITMIEPMDYESGNDKENIK 508

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 110/222 (49%), Gaps = 28/222 (12%)

Query: 635 WIPLENNYGREYNSXXXXXXXXXXXXXYRPSESWTYINCSRQYDIIFDEVKRLTRRG-IV 693
           WIP  + + RE N              YR S+S TYINCSR YD I D +K  T+ G I 
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEID 747

Query: 694 LAHTKKSDRPWNDPGQWEPPXXXXXXXXXXXXXEQELSPELGR-----DERPVLKILAMD 748
           +       +PWN+PG WE P              +   PE+ R     D+RP L+IL +D
Sbjct: 748 VLSDALYVKPWNNPGPWEKPKLKFW---------EHADPEIARKKRMADKRPTLRILCLD 798

Query: 749 WSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFAD 808
           +SQV QID+T +Q L+DLR  +N Y    VE+HF GIISPW++R L+ +GFG +N EF  
Sbjct: 799 FSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKINKEF-- 856

Query: 809 ESLILGHSSYHIVKTRPQDEENHIGQGRYNISAASGTNMPFF 850
                        K         I    YN   A G N+PFF
Sbjct: 857 -----------FPKVNDSSTVEVISDLEYNGELALGENVPFF 887

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  113 bits (283), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 113/478 (23%), Positives = 193/478 (40%), Gaps = 52/478 (10%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   W+P Y F  ++              P ++SY   IA +P   GLYS  I  F+Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
              +   + +GP + +SL   + +  +T H  + + I    I+T ++ + G I L  G+ 
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITLHKENVSLID---ISTVITFVSGTILLFSGIS 221

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDT 299
           R GFL  ++S   + GF++     +I   L + +  ++ + +    Y      +  L D 
Sbjct: 222 RFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDY 281

Query: 300 KL------DAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALR 353
                    A+F    L++L+L +          + R++       K+ KS  F+   L 
Sbjct: 282 APAQYHIPTAIFSGCCLIVLFLTR---------LLKRKL------MKYHKSAIFFPDIL- 325

Query: 354 NAFVIVLFTLIAWGITRHKKKHPISLLNTVPSGLKNVGVMKFP-----DHLATNXXXXXX 408
              ++V+ T++       K ++ IS++      + N   +K P       L  +      
Sbjct: 326 ---LVVIVTILISMKFNLKHRYGISIIGDF--SMDNFDELKNPLTRPRRKLIPDLFSASL 380

Query: 409 XXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKA 468
                         K+ G   +  V  ++EL+A+G  N+V + F A PA G + RS + A
Sbjct: 381 IVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRSKINA 440

Query: 469 KCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKM 528
               ++ +SGVF G   L+ +  L +  +YIP   LS +       L+        F   
Sbjct: 441 LSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKFH-- 498

Query: 529 NPLDC------LCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEV 580
             L C        F VT   TIF SIE G    IC  C   +  I   S K   R+++
Sbjct: 499 --LRCGGFSELFVFAVTFCTTIFYSIEAG----ICIGCVYSIINIIKHSAK--SRIQI 548

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  113 bits (282), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 122/506 (24%), Positives = 206/506 (40%), Gaps = 61/506 (12%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P + WIP+YN+                  P  +S+A  +A +    GLYS  +  FIY+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
            F +   + +GP + +SL   + +  +T H   D  +    IAT +S + G   L  G+ 
Sbjct: 132 LFGSVPHMIVGPESAISLVVGQAVETLTSH---DLSLETVDIATMISFMSGLTLLFGGIF 188

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDT 299
           RLGFL  ++S   + GF++   F +I   L   +  N+ + T    Y        H P  
Sbjct: 189 RLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHY--------HTPFE 240

Query: 300 KLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFF--------FYAQA 351
           K           IL+L +YG +           N H P +    + F        F  + 
Sbjct: 241 K-----------ILFLVRYGPS-----------NYHLPTSFLSLAVFTTLMTIRIFKKKM 278

Query: 352 LRN----AFV-----IVLFTLIAWGITRHKKKHPISLLNTVPS-GLKNVG--VMKFPDHL 399
           +R      F+     +V+F+++   +   KKK+ IS++    + G  +    + K    L
Sbjct: 279 MRRIKWIVFIPEILSVVIFSIVLSYMCDLKKKYDISVIGDFNTDGFDDFRNPLSKCNRGL 338

Query: 400 ATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATG 459
                                  K+ G   +     ++EL+A+G+ N +G+ F   PA G
Sbjct: 339 IPALRDVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFG 398

Query: 460 SFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLI--A 517
            + RS + A    +T ++GVF G+  L  +  L    +YIP   LS +       L+  A
Sbjct: 399 GYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEA 458

Query: 518 SYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGR 577
            ++  ++       + + F++T   T F SIE GI     +S   ++   A    + L R
Sbjct: 459 PHDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQSRIQILAR 518

Query: 578 VEVSE-VINPTVREDLGVVEDFDSEN 602
           VE ++  IN      L    D DS+N
Sbjct: 519 VEGTDHFINANEYLQL----DLDSDN 540

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 116/481 (24%), Positives = 199/481 (41%), Gaps = 58/481 (12%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   W+P Y F  ++              P ++SY   IA +P   GLYS  I  F+Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
              +   + +GP + +SL   + +  +T H  + + I   I+ T +S   GAI L  G+ 
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITLHKDNVSLIDISIVITFVS---GAILLFSGIS 211

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTR----DTTYKVVINTLKH 295
           R GFL  ++S   + GF++     +I   L + +  ++ + +      T ++ V+  + +
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLIDY 271

Query: 296 LPDT--KLDAVFG---LIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQ 350
            P    K  A+F     I L+++ L K            + M  H       KS  F+  
Sbjct: 272 APAQYHKPTAIFSGCCFIILIVMRLLK-----------KKLMKRH-------KSAVFFPD 313

Query: 351 ALRNAFVIVLFTLIAWGITRHKKKHPISLLNTVPSGLKNVGVMKFP-----DHLATNXXX 405
            L    V+++  LI+  ++  K+++ IS++      + N   +K P       L  +   
Sbjct: 314 IL---LVVIVTILISMKLSL-KQRYGISIVGDF--SMDNFDKLKNPLTHSRRKLMPDLFS 367

Query: 406 XXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSA 465
                            K+ G   +  V  ++EL+A+G  N+  + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSK 427

Query: 466 LKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNF 525
           + A    ++ +SGVF G   L+ +  L +  +YIP   LS +       L+        F
Sbjct: 428 INALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKF 487

Query: 526 WKMNPLDC------LCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVE 579
                L C        F VT  +TIF SIE+G    IC  C   +  I   S K   R++
Sbjct: 488 H----LQCGGYSELFVFAVTFGVTIFYSIESG----ICIGCVYSILNIIKHSAK--SRIQ 537

Query: 580 V 580
           +
Sbjct: 538 I 538

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 113/478 (23%), Positives = 186/478 (38%), Gaps = 52/478 (10%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   W+P Y F+ ++              P ++SY   IA +P   GLYS  I  F+Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
            F +   + +GP + +SL   + +  +T H  + + I   I+ T +S   GAI L  G+ 
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESITLHKDNVSLIDISIVITFVS---GAILLFSGIS 211

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDT 299
           R GFL  ++S   + GF++     +I   L + +  ++ + +    Y      +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDY 271

Query: 300 K------LDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALR 353
                    A+F    L+IL+L                        K+ K   F+   L 
Sbjct: 272 APAQYHMPTAIFSGCCLIILFLM---------------RLLKRKLLKYHKGAIFFPDILL 316

Query: 354 NAFVIVLFTLIAWGITRHKKKHPISLLNTVPSGLKNVGVMKFP-----DHLATNXXXXXX 408
              V +L ++      +   KH   +       + N   +K P       L  +      
Sbjct: 317 VVIVTILISM------KFDLKHRYGITIVGDFSMDNFDKLKNPLTRSRRKLIPDLFSASL 370

Query: 409 XXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKA 468
                         K+ G   +  V  ++EL+A+G  N+V + F A P+ G + RS + A
Sbjct: 371 IVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINA 430

Query: 469 KCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKM 528
               ++ +SGVF G   L+ +  L +  +YIP   LS +       L+    +   F   
Sbjct: 431 LSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIKFH-- 488

Query: 529 NPLDC------LCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEV 580
             L C        F VT  +TIF SIE G    IC  C   +  I   S K   R+++
Sbjct: 489 --LRCGGYSELFVFAVTFGVTIFYSIEAG----ICIGCVYSILNIIKHSAK--SRIQI 538

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 117/479 (24%), Positives = 193/479 (40%), Gaps = 36/479 (7%)

Query: 113 FREYLISLFPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSS 171
           F + L    P   W+P Y                    P ++SYA  +A +    GLYS 
Sbjct: 73  FYDRLKYYLPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSL 132

Query: 172 FIGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPI-IATALSLLCG 230
            I  F+Y  F +   + +GP + +SL    V+ +  E L    E  G I I+  ++ L G
Sbjct: 133 AITPFVYCVFGSVPQMIVGPESAISL----VVGQAVEKLVTHNEKVGTINISVVVTFLSG 188

Query: 231 AITLGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNT----RDTTY 286
           AI L  G+ RLGFL  ++S   + GF++     ++   L   +   + + T      T +
Sbjct: 189 AILLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPF 248

Query: 287 KVVINTLKHLPDT--KLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKS 344
           + V    K+ P+   K  A+  L   +IL   ++         + +++       K +KS
Sbjct: 249 EKVQFLFKYGPENLHKPTAILSLCSFIILMTLRF---------LKKKL------MKRYKS 293

Query: 345 FFFYAQALRNAFVIVLFTLIAWGITRHKKKHPISLLNTVP-SGLKNVG--VMKFPDHLAT 401
             F+ + L    +IV+ +LI       KK   IS+L     SG   +   + K    L  
Sbjct: 294 VIFFPEIL----LIVISSLIISVNFNLKKDFDISMLGDFSTSGFDKLNNPLGKDNRSLCH 349

Query: 402 NXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSF 461
                                K+ G I D  +  ++EL+A+G  NLVG+ F A P+ G +
Sbjct: 350 ELLSVGLMCAILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSFGGY 409

Query: 462 SRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYET 521
            RS + A    +T +SG   G   L  +  L    +Y P   LS +       L+    +
Sbjct: 410 GRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPS 469

Query: 522 TWNF-WKMNPLDCLCFLVTVFI-TIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRV 578
              F  + +  + L     +F+ TI  S+E GI     +S   ++   A    + L RV
Sbjct: 470 DIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILTRV 528

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 109/478 (22%), Positives = 191/478 (39%), Gaps = 39/478 (8%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P +RW+P YN +  +              P ++SYA  IA +    GLYS  I   IY 
Sbjct: 114 LPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYG 173

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHL----PDDTEITGPIIATALSLLCGAITLG 235
              +   + +GP   +SL   + + ++         +D  I+   I+  ++ L G +   
Sbjct: 174 ILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLVLFI 233

Query: 236 IGVLRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRD----TTYKVVIN 291
            G+LRLGFL  ++S   +  F++     ++   L   M  N  +   D    T ++ ++ 
Sbjct: 234 CGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDALITEMKLNCILIDNDRHYHTAFEKIMF 293

Query: 292 TLKHLPDT--KLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYA 349
            +K+ P+   K   V  ++   ILY  +Y C         + +  H       KS  F  
Sbjct: 294 IIKYAPNNFHKPTTVLSVVCFSILYFVRY-CK-------KKYIIKH-------KSLIFLP 338

Query: 350 QALRNAFVIVLFTLIAWGITRHKKKHPISLLNTVPSGLKNVGVMKFPDHLATN------- 402
           + L    ++V+ T I       K  + IS++  V S   N+      + L+++       
Sbjct: 339 EIL----IVVISTGILSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSSSNKELFPI 394

Query: 403 XXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFS 462
                               K+ G   +  +  ++EL+A+GV NL  +     P+ G + 
Sbjct: 395 LMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLPSFGGYG 454

Query: 463 RSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETT 522
           RS + A    +T +SGV  G   +L +  L    ++IP   LS +       LI      
Sbjct: 455 RSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLIEEAPGE 514

Query: 523 WNF-WKMNPL-DCLCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRV 578
             F W+     + + F +T   TIF S+E GI     +S   ++   A    + LGR+
Sbjct: 515 VKFHWRCKGYNELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRIQILGRI 572

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 107/478 (22%), Positives = 191/478 (39%), Gaps = 52/478 (10%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   W+P Y F  ++              P ++SY   IA +P   GLYS  I  F+Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
              +   + +GP + +SL   + +  +T H  + + I    I+  ++ + GAI L  G+ 
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITLHKDNVSLID---ISVVITFVSGAILLFSGIS 211

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTR----DTTYKVVINTLKH 295
           R GFL  ++S   + GF++     +I   L + +  ++ + +      T ++ V+  + +
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYHTPFEKVLFLIDY 271

Query: 296 LPDT--KLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALR 353
            P    K  A+F    L++L+                R+           + FF    L 
Sbjct: 272 APAQYHKPTAIFSGCCLIVLF--------------SMRLLKKKLVKHHKSAIFFPDILL- 316

Query: 354 NAFVIVLFTLIAWGITRHKKKHPISLLNTVPSGLKNVGVMKFP-----DHLATNXXXXXX 408
              ++ +F  + + +   K ++ I+++      + N   +K P       L  +      
Sbjct: 317 -VVIVAIFISMKFSL---KHRYGITIIGDF--SMDNFDKLKNPFTHSRRKLIPDLFSASL 370

Query: 409 XXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKA 468
                         K+ G   +  V  ++EL+A+G  N+V + F A P+ G + RS + A
Sbjct: 371 IVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINA 430

Query: 469 KCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKM 528
               ++ +SGVF G   L+ +  L +  +YIP   LS +       L+        F   
Sbjct: 431 LSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFH-- 488

Query: 529 NPLDC------LCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEV 580
             L C        F VT  +TI  SIE G    IC  C   +  I   S K   R+++
Sbjct: 489 --LRCGGYSELFVFAVTFGVTILCSIEAG----ICIGCVYSILNIIKHSAK--SRIQI 538

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 113/501 (22%), Positives = 189/501 (37%), Gaps = 80/501 (15%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   W+P+YN +                 P ++S+A  +A +    GLYS     FIY+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
              +   + +GP + +SL   + + ++  H PD   +    ++  ++ + G      G+ 
Sbjct: 150 ILGSVPQMIVGPESAISLVVGQAVEKMISHNPDLHTLQ---LSAVITFISGGFLFFFGLC 206

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDT 299
           RLGFL  ++S   + GF++     +I   + +    ++ +      Y        H P  
Sbjct: 207 RLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHY--------HTPFE 258

Query: 300 KLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALR------ 353
           K           IL+L  Y  N           N H P      S FF     +      
Sbjct: 259 K-----------ILFLVTYAPN-----------NYHGPTTALSLSCFFILIMTKIIKKKL 296

Query: 354 -----------NAFVIVLFTLIAWGITRHKKKHPIS------------LLNTVPSGLKNV 390
                      +  ++++ T+      R K  + IS            LLN  P   +N 
Sbjct: 297 MPRCRWIVFVPDILLLIIGTIFLSIKYRFKHNYSISTVGDFNTKGLDKLLN--PLSAENR 354

Query: 391 GVMKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGT 450
           G++  P  L+                      K+ G   D  +  ++EL+A+G  NL  +
Sbjct: 355 GLI--PQLLSAGFITAMLGFFESTTAS-----KSLGSSYDLAISSNRELVALGSMNLFSS 407

Query: 451 FFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIH 510
              + PA G + RS + A    +T +SG F G  VLL +  L    +YIP   LS V   
Sbjct: 408 ILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTM 467

Query: 511 AVSDLI--ASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAILLFKIA 568
               L+  A  +  ++F      + L F +TV  T+F S+E G    IC  C   +  I 
Sbjct: 468 VGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVG----ICIGCGYSVISII 523

Query: 569 FPSGKFLGRVEVSEVINPTVR 589
             S K   R+++   +  T R
Sbjct: 524 KHSAK--SRIQILARVQGTSR 542

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 129/516 (25%), Positives = 207/516 (40%), Gaps = 83/516 (16%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   WIP Y +  +               P ++SYA  IA +    GLYS  I  FIY+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
            F +   + +GP + +SL   + +  +  H   D+ +    I+  L+ + GA  L +G+L
Sbjct: 149 VFGSVPQMIVGPESAISLVVGQSVELLKSH---DSALEIINISVVLTFISGAALLILGIL 205

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNE-----KVNTRDTTYKVVINTLK 294
           RLGFL  ++S + + GF++     +I   L   +  N+     KV+   T+++ V   +K
Sbjct: 206 RLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCH-TSFEKVQFLIK 264

Query: 295 HLPD-----TKLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYA 349
           + P      T L +    + L  + L K            R M  H      W +F    
Sbjct: 265 YAPTNYHKPTALLSAIAFVTLFSIRLLK-----------KRWMAKHR-----WLAFI--- 305

Query: 350 QALRNAFVIVLFTLIAWGITRH---------------KKKHPISLLN-TVPSGLKNVGVM 393
             +    +I ++    W   +                K K+PIS  N  +   L N GV+
Sbjct: 306 PEILMVVIISIYLSATWEFKKQYGILIVGDFNTHAIDKLKNPISKENRKIMPQLLNTGVL 365

Query: 394 KFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFN 453
                                        K+ G   D  +  ++EL+A+G  N++ + F 
Sbjct: 366 ----------------ISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFG 409

Query: 454 AYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVI-IHAV 512
           A P+ G + RS + A    +T +SGVF G+  L+ +  L    +YIP   LS +  I  +
Sbjct: 410 ALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGI 469

Query: 513 SDL-IASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPS 571
           S L  A  E  ++F      +   F +TV  T+  S+E G    IC  C   +  I   S
Sbjct: 470 SLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMG----ICIGCGYSIISIVKHS 525

Query: 572 GK----FLGRVEVSEVINPTVREDLGVVEDFDSENI 603
            K     LGRV+         RE   + E  DS+ I
Sbjct: 526 AKSRIQILGRVQ-------GTREFANIDEYLDSDPI 554

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 119/480 (24%), Positives = 194/480 (40%), Gaps = 46/480 (9%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   WIP Y+                   P +MSYA  +A +P   GLYS      +Y+
Sbjct: 74  LPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYSLVFSPAVYT 133

Query: 180 FFATSKDVCIGPVAVMSLETAKVI-ARVTEHLPDDTEITGPIIATALSLLCGAITLGIGV 238
              +   + +GP + +SL   + I AR++E    D ++    I   ++ + G + L  G+
Sbjct: 134 VLGSVPQMIVGPESAISLILGQAIEARLSE----DPKLKAINICLVITFISGLVLLTGGL 189

Query: 239 LRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTY----KVVINTLK 294
           LRLGFL  ++S   + GF++G    ++   L   +  N    TR   Y    + V+  +K
Sbjct: 190 LRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMK 249

Query: 295 HLPDT--KLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQAL 352
           + P+   K  A+  L+  +IL                  M+    + ++ K F +    L
Sbjct: 250 YGPENYHKPTAILSLVAFVIL------------------MSLRIFKKRYGKKFKWLV-LL 290

Query: 353 RNAFVIVLFTLIAWGITRHKKKHPISLLNTVPSG--------LKNVGVMKFPDHLATNXX 404
            +  V+V  ++        K ++ I ++N +P            NV V  F D  +T   
Sbjct: 291 PDILVVVALSIFVSYKMHLKSRYGIEIINDIPKDSMKHLKNPFSNVNVATFKDLFSTGFM 350

Query: 405 XXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRS 464
                             K+ G   +  +  ++ELIA+G  N+VG+ F   PA G + RS
Sbjct: 351 VAMLGFFESATAS-----KSLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGGYGRS 405

Query: 465 ALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWN 524
            + A    +T +SG F G   L  +  L     YIP   LS +       L+        
Sbjct: 406 KINAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVITTVVGLTLLEEAPHDLK 465

Query: 525 F-WKMNPLDCL-CFLVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSE 582
           F W+      L  F VT+  T+F S+E GIY     S   ++   A    + LGRV  +E
Sbjct: 466 FHWRCKGYSELTVFTVTLLATLFYSLEAGIYIGCACSIINVIKHSAKSRIQILGRVPGTE 525

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 103/460 (22%), Positives = 180/460 (39%), Gaps = 52/460 (11%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   W+P Y+ + +               P +MSY+  +A +P   GL +     F+Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
            F +   + +GP + +SL   + I +  +H   D  +    +   L+ + GAI    G++
Sbjct: 130 VFGSVPHMIVGPESAISLVVGQAIEKQMKH---DKSLDVVNLCLILTFISGAILFCFGIM 186

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDT 299
           R G+L  ++S   + GF++     ++   L   +   +  N     Y        H P  
Sbjct: 187 RFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPFQ 238

Query: 300 KLDAVFGLIPLLILYLWKYGCNT-----------IGPNWVDRRMNPHSPRAKFWKSFFFY 348
           KL  +F   P        Y   T           +    V +R+      ++ +K   F 
Sbjct: 239 KLIFLFHYAP------GNYHVPTALLSLSSFSILMSLRLVKKRL------SRVYKKVIFV 286

Query: 349 AQALRNAFVIVLFTLIAWGITRHKKKHPISLLNTVPSGLKNVGVMKFPDHLA-------T 401
            + L    V+ L TL ++  +  K ++ I ++  +  G       KF + L+       +
Sbjct: 287 PEIL---IVVALVTLGSYHFS-FKLRYNIDIVGDIEVG----DTSKFRNPLSKKNLSLFS 338

Query: 402 NXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSF 461
                                K+ G   +  V  ++EL+A+G  NLVG+ F A P+ G +
Sbjct: 339 ELFHAGFMVALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGY 398

Query: 462 SRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLI--ASY 519
            RS + A     T +SGVF G    +    L  A ++IP   LS +       L   A  
Sbjct: 399 GRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPA 458

Query: 520 ETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWS 559
           +  ++F      + L F +TV  T F S+E GI     +S
Sbjct: 459 DLRYHFRCRGYNELLIFALTVLTTFFYSVEAGITLGCGYS 498

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 96/443 (21%), Positives = 173/443 (39%), Gaps = 45/443 (10%)

Query: 152 QSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTE--- 208
            S+S + +A LP   GLYS  I   IY    T     +GP  V+SL    V+ +  E   
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSL----VVGQSCEWWS 56

Query: 209 HLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQ 268
           H   +   T  +I      + G I   +GV R+GF+   +S   + GF++  A  ++  +
Sbjct: 57  HRSLEPLSTVAVIGC----VSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITE 112

Query: 269 LPALMG-------YNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCN 321
           L   +        Y  +     TT++     L+  P+   D           + W     
Sbjct: 113 LLPELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENS-DT----------FTWNLSLF 161

Query: 322 TIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKKKHPISLLN 381
           T       R +  H      WK   F+ + L    ++V+ ++      +  +   I ++ 
Sbjct: 162 TFILLMTIRYLKRHLAEKCGWKKCIFFPEIL----IVVVGSITLSNTQKWSELKGIKIIG 217

Query: 382 TVPSGLKNVGV-----MKFPDHLATNXXXXXXXXXXXXXXXXXXXXKAFGRINDYKVVPD 436
            +P    ++ V      +F +   T+                    K+    ++     +
Sbjct: 218 DIPPNSDHIKVPVQTFSEFKELFGTSALIAMLGLFESTIVF-----KSVCSNSNVDASSN 272

Query: 437 QELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAF 496
           +EL+++GV NLV + F+A PA G + RS +   C  +T  SGVF     ++ +  L  AF
Sbjct: 273 RELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNAF 332

Query: 497 YYIPKATLSAVIIHAVSDLIASYETTWNF-WKMNPL-DCLCFLVTVFITIFSSIENGIYF 554
           +++P   L+ +I      L+        F W +    +   F++ V  T+  S + G+  
Sbjct: 333 HHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVTM 392

Query: 555 AICWSCAILLFKIAFPSGKFLGR 577
            +C +   LL        + LGR
Sbjct: 393 GMCLTMIRLLKHSTRSRVQILGR 415

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 95/226 (42%), Gaps = 34/226 (15%)

Query: 115 EYLISLFPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFI 173
           +YL   FP   W+P+Y                    P ++SYA  +A +    GLYS  I
Sbjct: 54  DYLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAI 113

Query: 174 GAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAIT 233
             FIY+ F +   + +GP + +SL   + +  +  H   D  I+   I+  ++ + G+  
Sbjct: 114 TPFIYAIFGSVPQMIVGPESAISLVVGQAVEPMVNH---DERISTISISIVVTFISGSFL 170

Query: 234 LGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTL 293
           L +G+ RLGFL  ++S   + GF+    F +I   L + +  ++ + T    Y       
Sbjct: 171 LFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHY------- 223

Query: 294 KHLPDTKLDAVFGLIPLLILYLWKYGCNTIGPNWVDRRMNPHSPRA 339
            H P  K           IL+L KYG           + N H+P A
Sbjct: 224 -HTPFEK-----------ILFLIKYG-----------QHNYHAPTA 246

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482
           KA G   D  V  ++EL+A+G  N+VG+ F A PA G + RS + A    +T +SGV  G
Sbjct: 350 KALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLG 409

Query: 483 ACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFW-KMNPLDCLCFLVTVF 541
           +  L  +       +  P   LS V       L+    T   F+ + +  + L  L   F
Sbjct: 410 SVTLFTIKFFLPVVHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTF 469

Query: 542 I-TIFSSIENGIYFAICWS 559
           I TIF S+E GI    C+S
Sbjct: 470 ITTIFYSVEVGICVGCCYS 488

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 79/168 (47%), Gaps = 4/168 (2%)

Query: 113 FREYLISLFPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSS 171
           ++E L    P + WIPHY++   +              P ++SYA  IA +    GLYS 
Sbjct: 66  YQELLPYYLPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSL 125

Query: 172 FIGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGA 231
            I   IY+ F +   + +GP + +SL   +   + + H   D+EI+   I   ++ + G 
Sbjct: 126 AITPLIYAIFGSVPQMIVGPESAISLVVGQATEKFSAH---DSEISTVTITMMITFISGV 182

Query: 232 ITLGIGVLRLGFLVELISLNAVAGFMTGSAFSIITGQLPALMGYNEKV 279
           +   +G +RLGFL  ++S   + GF++     +I   L   +  N K+
Sbjct: 183 VLFFLGSVRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKL 230

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 70/166 (42%), Gaps = 10/166 (6%)

Query: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482
           K+ G   +     ++ELIA+G  N+VG+ F A P+ G + RS +      +T +SG   G
Sbjct: 364 KSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVG 423

Query: 483 ACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDC------LCF 536
              LL    L    +Y P   LS +       L+    +   F     + C        F
Sbjct: 424 LITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFH----IHCSGYSELTVF 479

Query: 537 LVTVFITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSE 582
            +T   T+  S+E G+     +S  +++   A    + L ++E S+
Sbjct: 480 TLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKLEGSD 525

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 75/159 (47%), Gaps = 4/159 (2%)

Query: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482
           K+ G   D  +  ++EL+A+G  NLVG+ F A P+ G + RS + A     T +SGVF G
Sbjct: 375 KSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMG 434

Query: 483 ACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLI--ASYETTWNFWKMNPLDCLCFLVTV 540
              L+    L  A  +IP   LS +       L   A  +  ++F      + L F +TV
Sbjct: 435 LITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNELLTFAITV 494

Query: 541 FITIFSSIENGIYFAICWSCAILLFKIAFPSG-KFLGRV 578
             T F S+E GI    C    I   K +  SG + LGR+
Sbjct: 495 LTTFFYSVEAGITLG-CGYSIIRAIKNSTQSGIQILGRI 532

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 66/150 (44%), Gaps = 4/150 (2%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   W+P Y+                   P +MSY+  +A +P   GL +      +Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
            F +   + +GP + +SL   + I ++T+H   D  +    +   L+ + G+I    G++
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTKH---DASLNVTNLCVVLTFISGSILFSFGLM 201

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQL 269
           R GFL  ++S   + GF++     ++   L
Sbjct: 202 RFGFLDSVLSRALLRGFISAVGLIMVINSL 231

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 71/139 (51%), Gaps = 2/139 (1%)

Query: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482
           KA G  ++  V  ++EL+A+G++N+V +   A P+ G + RS + A    +T LSGVF G
Sbjct: 400 KALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKTLLSGVFMG 459

Query: 483 ACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNF-WKMNPLDCLCFLVTVF 541
              +LA+  L    +YIP   LS +       L+       +F W+    + L  +V  F
Sbjct: 460 LTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEIPKEVSFHWRCRGYNELFLIVLTF 519

Query: 542 IT-IFSSIENGIYFAICWS 559
           +T IF S+E  +Y    +S
Sbjct: 520 MTSIFYSVETSMYIGCVYS 538

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 70/150 (46%), Gaps = 4/150 (2%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P + W+P+Y    +               P ++SYA  IA +    GLY+  +  F Y+
Sbjct: 110 LPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAVSPFFYA 169

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
            F ++  + +GP   +SL   + +    +H PD   I   +I  A++L+ G I L  G+ 
Sbjct: 170 IFGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPI---LIVIAVTLISGTILLISGIF 226

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQL 269
           RLG+L  +++   + GF+    F +I   L
Sbjct: 227 RLGYLGNILNKALLHGFIGSVGFVMIIDSL 256

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 80/162 (49%), Gaps = 2/162 (1%)

Query: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482
           KA G   D  +  ++EL+++G+ N+V + F+A PA G + RS L   C+ +TP++G+   
Sbjct: 337 KAIGEKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVS 396

Query: 483 ACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNF-WKMNPL-DCLCFLVTV 540
              +  +  +  AF+Y+P   L+ +I +   +L+    +   F W +    + L F+  V
Sbjct: 397 VAAIFCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVV 456

Query: 541 FITIFSSIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSE 582
             T+  S + G+   +  +   LL        + LGR  V++
Sbjct: 457 VTTLVWSPQFGVSIGVGLTMIRLLKHTTQSRVQILGRDPVTK 498

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 74/163 (45%), Gaps = 12/163 (7%)

Query: 114 REYLISLFPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFI 173
           + Y+    P+++W P Y+   +               P ++S + +A +    GL+S  I
Sbjct: 41  KSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAISLSTMAHVSPYAGLFSLVI 100

Query: 174 GAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTE---HLPDDTEITGPIIATALSLLCG 230
              IY+ F +   + +GP  V+SL    V+ +  E   H   D+ +T  +IA       G
Sbjct: 101 PPLIYAVFGSVPTMVVGPQTVVSL----VVGQSCEAWSHKSVDSLVTVAVIACT----SG 152

Query: 231 AITLGIGVLRLGFLVELISLNAVAGFMTGSA-FSIITGQLPAL 272
            I L +G+ R+GF+   IS   + GF+   A   +IT  LP L
Sbjct: 153 FILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPEL 195

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 73/163 (44%), Gaps = 10/163 (6%)

Query: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482
           K+ G   ++ +  ++EL+A+G  NL  +   A PA G + RS + +    +T +SGV  G
Sbjct: 372 KSLGSAYEFAISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMG 431

Query: 483 ACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLI--ASYETTWNFWKMNPLDCLCFLVTV 540
             VLL +        YIP   LS +       L+  A  +  ++F      + L F VTV
Sbjct: 432 VIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTV 491

Query: 541 FITIFSSIENGIYFAICWSCAILLFKIAFPSGK----FLGRVE 579
             T F S+E G    +C  C   +  I   S K     L RVE
Sbjct: 492 LTTFFYSLEMG----VCIGCGYSVISIIKHSAKSRIQILARVE 530

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (56%)

Query: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482
           K+     D  V  ++EL+++G+ N+VG+ F++ PA G + RS L   C  +TP++G+F  
Sbjct: 337 KSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVS 396

Query: 483 ACVLLALYCLTEAFYYIPKATLSAVI 508
              +  +  L   F+Y+P   L+ +I
Sbjct: 397 LSAIFCMRFLMGVFHYLPLCILAVII 422

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 72/161 (44%), Gaps = 8/161 (4%)

Query: 114 REYLISLFPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYAQIASLPAQYGLYSSFI 173
           + Y+    P++RW+P Y++  M               P ++S   +A +    GLY+  I
Sbjct: 41  KSYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYALVI 100

Query: 174 GAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATA-LSLLCGAI 232
              IY+ F +   + +GP  V SL    V+ +  +     +    P++  A +  + G +
Sbjct: 101 PPLIYAVFGSVPTMVVGPQTVASL----VVGQSCDAWAHKS--LEPLMTVAVIGCISGVL 154

Query: 233 TLGIGVLRLGFLVELISLNAVAGFMTGSA-FSIITGQLPAL 272
              +G+ RLGF+   IS   + GF +  A   +IT  LP L
Sbjct: 155 VFAMGIFRLGFIDNAISKAFLKGFTSALAVVMLITELLPQL 195

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 423 KAFGRINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTG 482
           K+ G   D  V  ++EL+A+G  NL+G+ F A P+ G + RS + A    +T +SG   G
Sbjct: 387 KSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMG 446

Query: 483 ACVLLALYCLTEAFYYIPKATLSAVIIHAVSDLI--ASYETTWNFWKMNPLDCLCFLVTV 540
              +  +  L +   YIP   LS +       L+  A  +  ++       + + F++TV
Sbjct: 447 TITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITV 506

Query: 541 FITIFSSIENGIYFAICWS 559
             T F S+E GI     +S
Sbjct: 507 LTTFFYSVEAGITVGCGYS 525

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 64/150 (42%), Gaps = 4/150 (2%)

Query: 121 FPVIRWIPHYNFAWMYXXXXXXXXXXXXXXPQSMSYA-QIASLPAQYGLYSSFIGAFIYS 179
            P   W+P Y+    +              P +MSYA  IA +    GLY+     F Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 180 FFATSKDVCIGPVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVL 239
            F +   + +GP + +SL   + I  +  H P  + +   +I T +S   G +    GV 
Sbjct: 157 IFGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLSSLDLCVIITFIS---GVVLFTFGVF 213

Query: 240 RLGFLVELISLNAVAGFMTGSAFSIITGQL 269
           R GFL  ++S   + GF++     ++   L
Sbjct: 214 RFGFLDNVLSRAFLRGFISAVGVIMVINSL 243

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score = 38.5 bits (88), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 11/86 (12%)

Query: 213 DTEITGPIIATALS-LLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSA-FSIITGQLP 270
           D  IT  I+  ALS ++ GA+ L +G LRLG LV    L+ + G + G A F IITG   
Sbjct: 315 DDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGI-- 372

Query: 271 ALMGYNEKVNTRDTTYKVVINTLKHL 296
                  +V+TR T ++  +  L++L
Sbjct: 373 -------EVSTRVTKFEYSLAFLRNL 391

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 67/160 (41%), Gaps = 8/160 (5%)

Query: 428 INDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLL 487
           ++ Y V  D+ELIA G +NL+  F  +      ++ S L  +    +P++G+       +
Sbjct: 555 VDKYDV--DKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFI 612

Query: 488 ALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFW-KMNPLDCLCFLVTVFITIFS 546
            +        +IP   + ++I     +LI   E   + W K+ P + L   + V      
Sbjct: 613 VMVIGPVIISFIPICIVGSLIFLLGYELIQ--EAVIDTWGKLQPFEYLTIWIIVITMGVV 670

Query: 547 SIENGIYFAICWSCAILLF---KIAFPSGKFLGRVEVSEV 583
               GI   I  +C   L    ++   +G++ G+V  S V
Sbjct: 671 DFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTV 710

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
           YGR125W
          Length = 1020

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 69/161 (42%), Gaps = 8/161 (4%)

Query: 427 RINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVL 486
           +++ Y V  D+ELIA G++NLV   F +      ++ S L  +    +P +G       +
Sbjct: 500 QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557

Query: 487 LALYCLTEAFYYIPKATLSAVI-IHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIF 545
           + +        +IP   + ++I +     L+ +   TW+  K+   + +  +V V     
Sbjct: 558 VVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWD--KLTTFEYVTVVVIVLTMGI 615

Query: 546 SSIENGIYFAICWSCAILLF---KIAFPSGKFLGRVEVSEV 583
                GI   I  +C   L    K+   +G+F G+V  S V
Sbjct: 616 VDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTV 656

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
           protein of unknown function; deletion mutant has
           decreased rapamycin resistance but normal wormannin
           resistance; green fluorescent protein (GFP)-fusion
           protein localizes to the vacuole
          Length = 1036

 Score = 35.8 bits (81), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 66/161 (40%), Gaps = 8/161 (4%)

Query: 427 RINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVL 486
           +++ Y V  D+ELIA G +N       +      ++ S L  +    +P +G    A  +
Sbjct: 497 QMDKYDV--DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTI 554

Query: 487 LALYCLTEAFYYIPKATLSAVI-IHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIF 545
             +        +IP   + ++I +     L+ +   TWN  K+N  + L  ++ VF    
Sbjct: 555 CIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWN--KLNRFEYLTVVIIVFTMGI 612

Query: 546 SSIENGIYFAICWSCAILLF---KIAFPSGKFLGRVEVSEV 583
                GI   I  +C   L    K+   +G++ G V  S V
Sbjct: 613 FDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTV 653

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON}
           Anc_3.485 YGR125W
          Length = 1150

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 72/176 (40%), Gaps = 10/176 (5%)

Query: 427 RINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVL 486
           +++ Y V  D+ELIA G +NL+   F +      ++ S L  +    T  +G+       
Sbjct: 622 QMDKYDV--DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTA 679

Query: 487 LALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFW-KMNPLDCLCFLVTVFITIF 545
           + L+       +IP   + ++I     +LI   E   + W K+   + +  ++ VF    
Sbjct: 680 IILFIGPVIISFIPVCIVGSLIFLLGWELIV--EALLDTWGKVTKFEYITIMIIVFTMGI 737

Query: 546 SSIENGIYFAICWSCAILLF---KIAFPSGKFLGRVEVSEVINPTVREDL--GVVE 596
                GI   I  +C   L    K+   +G+F G V  S V    V+     G+ E
Sbjct: 738 YDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAE 793

>KAFR0B00360 Chr2 (81284..83215) [1932 bp, 643 aa] {ON} Anc_7.535
           YPR179C
          Length = 643

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 6/100 (6%)

Query: 1   MSDYHTHNRGSSKDLEH---NSSDFAEPNLDDLEAEY-DNYKNAEQNPREKSDVVETLPP 56
           + D +   R +S D+E    N  +F E   DDLE  + +N K   ++P E +DV +   P
Sbjct: 312 LPDIYPLKRYNSMDVERSLLNEVNFNEA--DDLETAFANNSKKRHRHPDETTDVNKKDGP 369

Query: 57  TTHQNDAKGLKNDGQTTVELYGTTSSGGVIPGYHEDTVNF 96
           T    + K LKND        G  +  G++ G  +D++N+
Sbjct: 370 TKSFYELKRLKNDYLANPINQGMANLAGIVTGNVKDSINY 409

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1050

 Score = 32.3 bits (72), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 63/152 (41%), Gaps = 6/152 (3%)

Query: 436 DQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEA 495
           D+ELIA G +NL+  F  +      ++ S L  +    +  +G        + +      
Sbjct: 548 DKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMIIGPVI 607

Query: 496 FYYIPKATLSAVIIHAVSDLIASYETTWNFW-KMNPLDCLCFLVTVFITIFSSIENGIYF 554
             +IP   + ++I     +LI   E  ++ W K+N  + +  ++ VF         GI  
Sbjct: 608 ISFIPICIVGSLIFLLGYELIK--EALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIV 665

Query: 555 AICWSCAILLF---KIAFPSGKFLGRVEVSEV 583
            I  +C   L    K+   +G+F G+V  S V
Sbjct: 666 GILIACFSFLVDSTKLQTINGEFNGQVARSTV 697

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 86,325,900
Number of extensions: 3537079
Number of successful extensions: 10048
Number of sequences better than 10.0: 60
Number of HSP's gapped: 10073
Number of HSP's successfully gapped: 82
Length of query: 862
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 744
Effective length of database: 39,950,811
Effective search space: 29723403384
Effective search space used: 29723403384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)