Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16808g8.272ON65764329920.0
ZYRO0C01430g8.272ON59059716860.0
Kpol_543.448.272ON64363416860.0
KLLA0A04631g8.272ON57960116400.0
TDEL0F039908.272ON63163016350.0
Kwal_56.237548.272ON58960416300.0
KLTH0G13464g8.272ON59359916030.0
AGR076C8.272ON68663415130.0
TPHA0A017508.272ON63660714960.0
Kwal_26.6669singletonON59053713451e-179
TBLA0F030408.272ON90659412601e-162
Ecym_42988.272ON67865211761e-152
KLLA0F17776gna 1ON5535418551e-106
SAKL0E04246gna 1ON5655497763e-94
SAKL0C02178gsingletonON5655627755e-94
Kwal_26.6697singletonON5775264607e-49
KLTH0E16720gsingletonON5745024388e-46
YDR119W (VBA4)8.272ON7685064314e-44
SAKL0A07480gsingletonON5735214132e-42
Skud_4.3798.272ON7595434041e-40
TDEL0C00120singletonON5695683963e-40
Skud_2.423na 2ON5605033945e-40
Suva_4.553na 2ON5625643938e-40
Smik_4.3638.272ON7655213981e-39
Suva_2.2798.272ON7755423802e-37
ZYRO0A00330gsingletonON5765253654e-36
TDEL0A024902.473ON5545093601e-35
NCAS0A078102.473ON5685623566e-35
CAGL0J01375g2.473ON5645493494e-34
KLTH0H05456gna 3ON5685163486e-34
KNAG0E025602.473ON5784673443e-33
Smik_2.434na 2ON4744613359e-33
YBR293W (VBA2)na 2ON4744763341e-32
YMR088C (VBA1)2.473ON5624933372e-32
Suva_13.2652.473ON5614643327e-32
Skud_13.2442.473ON5625203301e-31
Smik_13.2722.473ON5615143256e-31
SAKL0E02992g2.473ON5704613212e-30
Kwal_14.1585na 3ON5704623202e-30
KLLA0F13684g2.473ON5715853202e-30
ZYRO0G03234g2.473ON5625183193e-30
NDAI0H022002.473ON5714653169e-30
Kpol_467.242.473ON3703493017e-29
TPHA0G031502.473ON6005192883e-26
ZYRO0G21868gna 3ON6205402803e-25
Kwal_26.77552.473ON5594712704e-24
ABL040W2.473ON5674592642e-23
ZYRO0G21890gsingletonON5764612625e-23
KLTH0D05434g2.473ON5764932544e-22
Ecym_73992.473ON5634732403e-20
KLTH0B00132gsingletonON5685272206e-18
NDAI0J012808.272ON6942652031e-15
KNAG0K01020singletonON5995531903e-14
KLTH0C10120gsingletonON6511521797e-13
Skud_16.503singletonON5435171662e-11
YPR198W (SGE1)singletonON5435071653e-11
CAGL0B02079gna 4ON6241891636e-11
SAKL0A00726gsingletonON5981661636e-11
Skud_6.14singletonON6365491637e-11
KLTH0C10142gsingletonON5731571601e-10
Kwal_26.9616singletonON5623341555e-10
Smik_6.22singletonON6364801547e-10
Smik_17.11singletonON5445141539e-10
Smik_16.81na 4ON6251171512e-09
TDEL0G03260singletonON6121991493e-09
KLTH0B10142gsingletonON5682811483e-09
SAKL0C05588gsingletonON6771861484e-09
NCAS0C03460na 4ON6304671484e-09
SAKL0F00198gsingletonON5371981457e-09
SAKL0B12716gsingletonON6321981467e-09
SAKL0A08228gsingletonON569801441e-08
Suva_10.9singletonON6374781422e-08
Kwal_14.728singletonON5681871394e-08
KLTH0D16962gsingletonON5711701385e-08
Skud_7.560na 4ON6421601351e-07
TPHA0K02330singletonON6312671323e-07
YKR105C (VBA5)singletonON5821901314e-07
TDEL0G05000singletonON1861681236e-07
YGR224W (AZR1)na 4ON613801297e-07
TPHA0A006203.84ON6341201298e-07
KLLA0E09879gsingletonON6302081281e-06
CAGL0E04092gna 5ON6452571281e-06
Kpol_1053.243.84ON6201411252e-06
CAGL0I07447g3.84ON5701481243e-06
KLLA0D19941gsingletonON6112001243e-06
Skud_18.3singletonON5902011233e-06
NDAI0H00140na 5ON6322601234e-06
KNAG0K006303.84ON6182031191e-05
NDAI0A071103.84ON6021671153e-05
Smik_11.368singletonON5801971144e-05
KNAG0H031808.272ON677701136e-05
TBLA0B083103.84ON6381341136e-05
Suva_8.12na 5ON6332601127e-05
Skud_18.6singletonON6102671127e-05
NCAS0C047603.84ON6071341127e-05
YCL073C (GEX1)singletonON6152571111e-04
ZYRO0G07414gsingletonON7072721111e-04
YKR106W (GEX2)singletonON6152571101e-04
TBLA0C01040singletonON6692491101e-04
YHL047C (ARN2)singletonON6201211101e-04
KAFR0C02660singletonON5911361092e-04
Smik_6.24na 6ON5441151092e-04
KAFR0C014803.84ON5771201073e-04
YHL040C (ARN1)na 5ON6272571073e-04
SAKL0F00792gsingletonON6172661055e-04
NCAS0I025203.84ON5871391046e-04
SAKL0G06600gsingletonON629811046e-04
SAKL0C11066gsingletonON580901047e-04
KLTH0G00198gna 5ON4582241038e-04
KLLA0C12309g3.84ON5691201030.001
KAFR0B039408.843ON5471271020.001
KLTH0B00594gsingletonON6185191020.001
Smik_8.1na 5ON6272651020.001
YOL103W (ITR2)3.84ON609401000.002
KNAG0J02980singletonON6362661000.002
TBLA0F00470singletonON7321151000.002
Suva_15.623.84ON609401000.002
Skud_15.513.84ON587401000.002
Smik_15.543.84ON61140990.002
KLTH0D18150gsingletonON607126990.003
Skud_8.3na 5ON631265990.003
TDEL0D054003.84ON585120980.004
KAFR0I01560singletonON632134980.004
Suva_4.2singletonON570268970.005
Kpol_358.4na 7ON617102960.006
NCAS0B037808.272ON589218960.006
Kpol_513.33singletonON62687960.006
Smik_15.560na 8ON51650960.007
YOR378Wna 8ON51550950.007
Skud_15.545na 8ON51650950.007
Suva_13.278.843ON55348950.009
TDEL0H01600singletonON604124940.009
Kwal_56.22298singletonON610257940.010
Suva_4.547.309ON890134940.010
TBLA0D03280singletonON580134940.011
SAKL0C09350g3.84ON578123940.011
KLTH0C09372g3.84ON608121930.013
KLLA0C18931gna 9ON55388930.015
Skud_6.16na 6ON549111930.015
AFR343C3.84ON57190930.016
Kpol_416.5singletonON607122920.017
Kwal_14.722singletonON611291920.020
Suva_8.435na 8ON51550910.022
KLLA0C19272gsingletonON62381910.022
Smik_4.467.309ON881120920.023
ZYRO0C00374gna 10ON564182900.029
Kwal_23.6547na 8ON511125900.030
Smik_4.7743.84ON584121900.031
KLTH0C10560gna 8ON51550900.033
ZYRO0D01672g7.511ON432103890.034
Smik_11.369singletonON16881860.034
YDR497C (ITR1)3.84ON584121890.042
TDEL0B005508.843ON53748890.046
Skud_4.647.309ON884118890.048
YEL065W (SIT1)na 7ON62877880.063
KLLA0A10439gsingletonON634190870.065
TDEL0H04480na 10ON570212870.069
Suva_13.4678.843ON54365870.071
KNAG0B007303.503ON62243870.075
NCAS0D02350na 7ON634126870.076
TDEL0H00130singletonON62177870.077
ZYRO0B06688g3.84ON59340870.078
Smik_11.370singletonON440259860.079
Smik_5.22na 7ON62877870.080
Suva_26.1singletonON534128860.081
SAKL0C12122gna 11ON611108870.082
Skud_4.7713.84ON584121860.083
YOL158C (ENB1)singletonON606167860.087
Suva_5.2na 7ON62777860.088
KLTH0H16214gsingletonON55191860.089
KLTH0A01562gna 11ON61577860.089
Skud_5.24na 7ON62777860.091
YML116W (ATR1)8.843ON54268850.11
Smik_13.188.843ON54568850.12
Kwal_27.102458.843ON51569850.12
KLLA0B00352gna 8ON49850840.14
TPHA0M00120singletonON619103840.15
KLLA0C00220gsingletonON624100840.15
NCAS0E007503.503ON62043840.15
YCL069W (VBA3)singletonON458131840.17
Kwal_56.227243.84ON578120830.19
SAKL0F00440gsingletonON54452830.19
Suva_2.6743.84ON579121830.21
Suva_10.11singletonON54099830.22
Skud_13.258.843ON53748830.22
NCAS0F036203.503ON63443830.23
NDAI0D010202.242ON59285830.23
NDAI0I02650na 7ON638102830.24
TDEL0D06610singletonON497111820.26
SAKL0D01386g8.843ON52148820.26
Kwal_23.2794singletonON619111820.28
TPHA0C047908.843ON55679820.31
Kpol_541.168.843ON528127820.31
NDAI0I027703.503ON62643810.35
KLTH0A07964gsingletonON619129810.37
Smik_21.4singletonON605137810.38
TPHA0B00180singletonON633143810.40
CAGL0B02343g8.843ON53748810.41
KLLA0D19945gsingletonON644215810.42
KLTH0C03806g8.843ON52548800.48
KLTH0B00110gsingletonON62767790.65
TDEL0C045902.242ON529131790.67
KAFR0D00930singletonON61476790.68
NCAS0I00100singletonON163112760.69
Kpol_1039.192.242ON573141790.70
YDL138W (RGT2)7.309ON763125790.70
YMR279C8.843ON54060780.73
KAFR0G00160singletonON63626790.74
TPHA0G03780singletonON61286780.81
Smik_4.977.309ON76739780.95
KLLA0E14609gsingletonON639114780.96
Kpol_416.6singletonON597121780.97
YDL194W (SNF3)7.309ON884120780.99
Skud_4.588.446ON68743781.0
NDAI0A02050singletonON617102771.1
SAKL0F00110gsingletonON620264771.2
KAFR0B03930singletonON55560771.2
KNAG0G034308.843ON54248771.2
KLLA0E09021gna 10ON56698761.3
KLTH0D00506gsingletonON616114761.3
Smik_4.418.446ON68743761.4
TDEL0G04740singletonON601281761.5
KAFR0A028408.843ON52048761.5
KLTH0G02266g3.503ON64474761.7
KLTH0G18854g8.22ON50271751.7
YDL199C8.446ON68743751.8
SAKL0E00132gsingletonON62081751.8
ABL210CsingletonON478123751.8
Skud_4.1167.309ON76939751.8
Suva_7.4253.503ON61343751.9
YGR138C (TPO2)3.503ON61443751.9
Smik_6.2333.503ON61443752.0
KLTH0D00110gsingletonON62077752.1
KLTH0B10450gsingletonON62077752.1
NDAI0K004008.843ON55348752.1
Smik_16.4083.503ON62243752.1
Suva_16.4843.503ON62243752.2
CAGL0L02519gna 8ON52949742.2
KNAG0J002608.843ON55048742.2
CAGL0M03003g8.843ON55847742.6
Kwal_47.189193.503ON64074742.6
CAGL0I03872g7.309ON76239742.7
NDAI0E002808.843ON54948742.7
TBLA0D032708.843ON55048742.8
Kwal_56.24841singletonON511111732.8
NCAS0I00110na 5ON45281732.9
CAGL0A04323g7.376ON21623722.9
Kpol_505.52.177ON687143733.1
TBLA0C01160singletonON60079733.2
Kwal_34.15746na 9ON51847733.3
NOTE: 1 genes in the same pillar as SAKL0H16808g were not hit in these BLAST results
LIST: KAFR0B05450

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16808g
         (657 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...  1157   0.0  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...   654   0.0  
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...   654   0.0  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...   636   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   634   0.0  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   632   0.0  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...   622   0.0  
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...   587   0.0  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   580   0.0  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   522   e-179
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   489   e-162
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...   457   e-152
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...   333   e-106
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...   303   3e-94
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...   303   5e-94
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...   181   7e-49
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...   173   8e-46
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...   170   4e-44
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...   163   2e-42
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...   160   1e-40
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}        157   3e-40
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...   156   5e-40
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...   155   8e-40
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...   157   1e-39
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...   150   2e-37
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...   145   4e-36
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...   143   1e-35
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...   141   6e-35
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...   139   4e-34
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...   138   6e-34
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...   137   3e-33
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...   133   9e-33
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...   133   1e-32
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...   134   2e-32
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...   132   7e-32
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...   131   1e-31
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...   129   6e-31
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...   128   2e-30
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...   127   2e-30
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...   127   2e-30
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...   127   3e-30
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...   126   9e-30
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...   120   7e-29
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...   115   3e-26
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...   112   3e-25
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...   108   4e-24
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...   106   2e-23
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...   105   5e-23
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...   102   4e-22
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    97   3e-20
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    89   6e-18
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....    83   1e-15
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    78   3e-14
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    74   7e-13
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    69   2e-11
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    68   3e-11
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    67   6e-11
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    67   6e-11
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    67   7e-11
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    66   1e-10
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    64   5e-10
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    64   7e-10
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    64   9e-10
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    63   2e-09
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               62   3e-09
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    62   3e-09
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    62   4e-09
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    62   4e-09
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    60   7e-09
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    61   7e-09
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    60   1e-08
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    59   2e-08
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    58   4e-08
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    58   5e-08
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    57   1e-07
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              55   3e-07
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    55   4e-07
TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON}                52   6e-07
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    54   7e-07
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    54   8e-07
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    54   1e-06
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    54   1e-06
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    53   2e-06
CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly...    52   3e-06
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    52   3e-06
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    52   3e-06
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       52   4e-06
KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3....    50   1e-05
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    49   3e-05
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    49   4e-05
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    48   6e-05
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...    48   6e-05
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    48   7e-05
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    48   7e-05
NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84      48   7e-05
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    47   1e-04
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    47   1e-04
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    47   1e-04
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               47   1e-04
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    47   1e-04
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}               47   2e-04
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    47   2e-04
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    46   3e-04
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    46   3e-04
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    45   5e-04
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    45   6e-04
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    45   6e-04
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    45   7e-04
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...    44   8e-04
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    44   0.001
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    44   0.001
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    44   0.001
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    44   0.001
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...    43   0.002
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              43   0.002
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               43   0.002
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...    43   0.002
Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {...    43   0.002
Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W (...    43   0.002
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    43   0.003
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    43   0.003
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...    42   0.004
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      42   0.004
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       42   0.005
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    42   0.006
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    42   0.006
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    42   0.006
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...    42   0.007
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...    41   0.007
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...    41   0.007
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    41   0.009
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    41   0.009
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    41   0.010
Suva_4.54 Chr4 (99974..102646) [2673 bp, 890 aa] {ON} YDL194W (R...    41   0.010
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    41   0.011
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    41   0.011
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    40   0.013
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    40   0.015
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    40   0.015
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    40   0.016
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    40   0.017
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    40   0.020
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...    40   0.022
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    40   0.022
Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)    40   0.023
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    39   0.029
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...    39   0.030
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    39   0.031
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...    39   0.033
ZYRO0D01672g Chr4 (134493..135791) [1299 bp, 432 aa] {ON} simila...    39   0.034
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...    38   0.034
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    39   0.042
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...    39   0.046
Skud_4.64 Chr4 (108965..111619) [2655 bp, 884 aa] {ON} YDL194W (...    39   0.048
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    39   0.063
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    38   0.065
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    38   0.069
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    38   0.071
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    38   0.075
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               38   0.076
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       38   0.077
ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {...    38   0.078
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    38   0.079
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    38   0.080
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        38   0.081
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    38   0.082
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...    38   0.083
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    38   0.087
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       38   0.088
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    38   0.089
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...    38   0.089
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    38   0.091
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    37   0.11 
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...    37   0.12 
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    37   0.12 
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...    37   0.14 
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                37   0.15 
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    37   0.15 
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               37   0.15 
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    37   0.17 
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    37   0.19 
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    37   0.19 
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...    37   0.21 
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    37   0.22 
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    37   0.22 
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    37   0.23 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    37   0.23 
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               37   0.24 
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    36   0.26 
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    36   0.26 
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    36   0.28 
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    36   0.31 
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    36   0.31 
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     36   0.35 
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    36   0.37 
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     36   0.38 
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       36   0.40 
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...    36   0.41 
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...    36   0.42 
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...    35   0.48 
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    35   0.65 
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    35   0.67 
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...    35   0.68 
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}          34   0.69 
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    35   0.70 
YDL138W Chr4 (213351..215642) [2292 bp, 763 aa] {ON}  RGT2Plasma...    35   0.70 
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...    35   0.73 
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 35   0.74 
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...    35   0.81 
Smik_4.97 Chr4 (189933..192236) [2304 bp, 767 aa] {ON} YDL138W (...    35   0.95 
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    35   0.96 
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    35   0.97 
YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma...    35   0.99 
Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON} ...    35   1.0  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    34   1.1  
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    34   1.2  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...    34   1.2  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...    34   1.2  
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    34   1.3  
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    34   1.3  
Smik_4.41 Chr4 complement(79517..81580) [2064 bp, 687 aa] {ON} Y...    34   1.4  
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    34   1.5  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...    34   1.5  
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    34   1.7  
KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]...    33   1.7  
YDL199C Chr4 complement(101290..103353) [2064 bp, 687 aa] {ON} P...    33   1.8  
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    33   1.8  
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    33   1.8  
Skud_4.116 Chr4 (208941..211250) [2310 bp, 769 aa] {ON} YDL138W ...    33   1.8  
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    33   1.9  
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    33   1.9  
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    33   2.0  
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    33   2.1  
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    33   2.1  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                33   2.1  
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    33   2.1  
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    33   2.2  
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...    33   2.2  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    33   2.2  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...    33   2.6  
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    33   2.6  
CAGL0I03872g Chr9 (337985..340273) [2289 bp, 762 aa] {ON} some s...    33   2.7  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843       33   2.7  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    33   2.8  
Kwal_56.24841 s56 complement(1167890..1169425) [1536 bp, 511 aa]...    33   2.8  
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         33   2.9  
CAGL0A04323g Chr1 (429121..429771) [651 bp, 216 aa] {ON} similar...    32   2.9  
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    33   3.1  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    33   3.2  
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    33   3.3  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843       33   3.5  
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    33   3.5  
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    33   3.5  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...    32   4.0  
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    32   4.1  
TPHA0J02740 Chr10 complement(608490..610214) [1725 bp, 574 aa] {...    32   4.5  
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    32   4.7  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    32   4.8  
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             32   4.9  
KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weak...    32   5.1  
KAFR0B01080 Chr2 (204541..206721) [2181 bp, 726 aa] {ON} Anc_7.3...    32   5.3  
TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {O...    32   5.3  
SAKL0F15422g Chr6 complement(1242050..1243387) [1338 bp, 445 aa]...    32   5.4  
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    32   5.6  
Kwal_27.9678 s27 complement(14940..16481) [1542 bp, 513 aa] {ON}...    32   5.9  
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    32   6.0  
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    32   6.1  
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    32   6.1  
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    32   6.4  
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    32   6.6  
KLTH0D00484g Chr4 complement(44278..45819) [1542 bp, 513 aa] {ON...    32   8.0  
AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-synte...    31   9.4  
Ecym_2317 Chr2 (621407..623080) [1674 bp, 557 aa] {ON} similar t...    31   9.6  

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 1157 bits (2992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/643 (88%), Positives = 572/643 (88%)

Query: 15  LQAFVKLKERQRQLLNDEPKVVIQQNPAHSIEPTETTPFLQPIRRELVLDPTSDLPGFVA 74
           LQAFVKLKERQRQLLNDEPKVVIQQNPAHSIEPTETTPFLQPIRRELVLDPTSDLPGFVA
Sbjct: 15  LQAFVKLKERQRQLLNDEPKVVIQQNPAHSIEPTETTPFLQPIRRELVLDPTSDLPGFVA 74

Query: 75  GXXXXXXXXXXXXQTNASGYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGS 134
           G            QTNASGYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGS
Sbjct: 75  GELEEQEERCAEEQTNASGYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGS 134

Query: 135 MYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRK 194
           MYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRK
Sbjct: 135 MYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRK 194

Query: 195 PLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALY 254
           PLLIFSNVMFALGCLICGLSPGLWCLVAGRF                  DIVPLRNRALY
Sbjct: 195 PLLIFSNVMFALGCLICGLSPGLWCLVAGRFIAGIGGGGLTSMSSITTSDIVPLRNRALY 254

Query: 255 QGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGS 314
           QGICNFFF            WFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGS
Sbjct: 255 QGICNFFFGLGTACGGLVGGWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGS 314

Query: 315 GIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVG 374
           GIQSDEDNQISEKLRRIDW                     KELPFQSNGFYALCVAIVVG
Sbjct: 315 GIQSDEDNQISEKLRRIDWFGALSLVVFLLLFMLASSLGGKELPFQSNGFYALCVAIVVG 374

Query: 375 GATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKP 434
           GATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKP
Sbjct: 375 GATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKP 434

Query: 435 TDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWR 494
           TDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWR
Sbjct: 435 TDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWR 494

Query: 495 QYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRK 554
           QYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRK
Sbjct: 495 QYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRK 554

Query: 555 SLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNT 614
           SLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNT
Sbjct: 555 SLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNT 614

Query: 615 YKFCLASIFCALLSCIAVKEYKLHTSMDRQAXXXXXXXXANST 657
           YKFCLASIFCALLSCIAVKEYKLHTSMDRQA        ANST
Sbjct: 615 YKFCLASIFCALLSCIAVKEYKLHTSMDRQAEEEEEEEEANST 657

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/597 (54%), Positives = 408/597 (68%), Gaps = 18/597 (3%)

Query: 48  TETTPFLQPIRRELVLDPTSDLPGFVAGXXXXXXXXXXXXQTNASGYDSIKKNTVATAKT 107
           T  T FL P+R +++ D ++D+PGFVA             Q    G             +
Sbjct: 11  TSRTNFLNPVRDDILQDASTDIPGFVAEELEEREELYRECQGTDYG-------------S 57

Query: 108 IDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHIS 167
           ID E  S +   ++ + P ++ +I  SMYLGIFLA+ D T+VST++AHIASEFNE+P IS
Sbjct: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRIS 117

Query: 168 WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXX 227
           WIATAYLLSSATFQPLYGK+SDIFGRKPLL+ +N++F +GCL+CGL+P  W LV  RF  
Sbjct: 118 WIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFIS 177

Query: 228 XXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAF 287
                           DIVPLR+RALYQG+CNFFF            WFS+HGGGWR+AF
Sbjct: 178 GIGGGGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWRMAF 237

Query: 288 LIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXX 347
           LIQ+PL A+S  LI  +++LP   K    + +    I  KL  +DW              
Sbjct: 238 LIQVPLSALSSLLIAVFMKLPPRSK----RVNSPASIKNKLLSVDWIGASALVVFLSLFL 293

Query: 348 XXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLA 407
                  KE+ F S  F ALC+   +  A F+ VE Y +KDPILP++FL+NR++LGSS +
Sbjct: 294 VTASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFS 353

Query: 408 NWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKW 467
           NWF MM MMTTSY+LP+Y++GVLNM PT +GKR +P+FFSTALGSLGAGYYMK+TGKY W
Sbjct: 354 NWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYW 413

Query: 468 LLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQA 527
           L + FC L+++G LQI+L++P+IA WRQ+ILLVIPGFG SVLITV LLAMIAAVPH H A
Sbjct: 414 LTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHA 473

Query: 528 ATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHS 587
           ATTSISYAFRSTG TLGVSIGGAIFR+SL  LL R V+K A DKHPR+EL +II+ A+ S
Sbjct: 474 ATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFA-DKHPRKELLEIIEKASKS 532

Query: 588 SDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSMDRQ 644
           S+++HDSAPEF+R  LI  YHFAC++T+ FC       L S   +KEYKLH S+DR+
Sbjct: 533 SEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRK 589

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/634 (51%), Positives = 421/634 (66%), Gaps = 25/634 (3%)

Query: 20  KLKERQRQLLNDEPKVVIQQNPAHSIEPT-------ETTPFLQPIRRELVLDPTSDLPGF 72
           +++E Q  ++ D P+    ++   ++  T       +    L PIR EL+ DP+++LPGF
Sbjct: 21  QVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDENSVLLPIRDELLQDPSTELPGF 80

Query: 73  VAGXXXXXXXXXXXXQTNASGYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIM 132
           +A             ++   G                +E+  I +K  T LS AR+KIIM
Sbjct: 81  IAAEIEEGEQEYEETRSGHYG---------------AIESRRISSKG-TELSTARLKIIM 124

Query: 133 GSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFG 192
            SMYLGIFLA+LDNTIVSTLLAHIASEFNE+P ISW+ATAYLLSSATFQP+YGKISDIFG
Sbjct: 125 LSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFG 184

Query: 193 RKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRA 252
           RK +LIF N+ F +G LICGLSP    LVAGRF                  DIVPLRNRA
Sbjct: 185 RKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLRNRA 244

Query: 253 LYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCK 312
           LYQGICNF+F            WFS+   GWR++FLIQ+P+   S  LI+ +L LPK  K
Sbjct: 245 LYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMSFLIQLPIAFFSTILIILFLRLPKESK 304

Query: 313 GSGIQSDED--NQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVA 370
           G G+Q D +  + I  +L  +DW                     KE+P+ S+ F  LCV 
Sbjct: 305 GRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVV 364

Query: 371 IVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVL 430
            V+G   F Y E  ++KDPILP+ FLK+R++LGSSL+NWF MM +MT SY+LP+Y+AGVL
Sbjct: 365 TVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVL 424

Query: 431 NMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNI 490
           NMKPTD+GKR IP+FFSTA GSLGAGYYMKKTGKY W +++FC LA +G LQI  I+P+I
Sbjct: 425 NMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDI 484

Query: 491 AVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGA 550
           +V++QY L+ IPG G SVLITV LLAMIAAVPH HQA TTSISYAFRSTGCTLGVSIGGA
Sbjct: 485 SVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGA 544

Query: 551 IFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFA 610
           IFR+SL +LL+  V+K  S +H  +EL +IID A+ S++++ +S+P F++Q LI+ YHFA
Sbjct: 545 IFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFA 604

Query: 611 CRNTYKFCLASIFCALLSCIAVKEYKLHTSMDRQ 644
           C+N + FCL     A  S   +KE++LH ++DR 
Sbjct: 605 CKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRD 638

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/601 (53%), Positives = 403/601 (67%), Gaps = 29/601 (4%)

Query: 48  TETTPFLQPIRRELVLDPTSDLPGFVAGXXXXXXXXXXXXQTNASGYDSIKKNTVATAKT 107
           ++ T  LQP+R  L  + +  LP +V                              T   
Sbjct: 4   SDRTSLLQPVRNALNPELSEGLPAYVGA------------------------EVAETEHL 39

Query: 108 IDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHIS 167
           ++ E  + E    + +S AR+ II+ SM LG FLA+LDNTIV+TLL+HIASEFNE+ HIS
Sbjct: 40  LESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHIS 99

Query: 168 WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXX 227
           WIATAYLLSSATFQPLYGKISDIFGR+PL+I SN+ F LGCLICGLS  LW LVAGRF  
Sbjct: 100 WIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIA 159

Query: 228 XXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAF 287
                           DIVPLR+RALYQGI NFFF            WFSE   GWR+AF
Sbjct: 160 GIGGGGVTSLGSITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWFSESKNGWRMAF 219

Query: 288 LIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDN---QISEKLRRIDWXXXXXXXXXXX 344
           L+Q+PLCAIS  LI+ +L+LP GCKG G+ S++ +    I +KL+RIDW           
Sbjct: 220 LVQVPLCAISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLF 279

Query: 345 XXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGS 404
                     KE+P+ SN F  L VA ++ G  F+YVE Y+S DPILP+ FL NR+ILG+
Sbjct: 280 AFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGA 339

Query: 405 SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK 464
           S ANWF MM  +T ++++PVYW+ V N+KPTDMGKR  P+FFSTA GS+GAGYYMKKTG+
Sbjct: 340 SFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGR 399

Query: 465 YKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHE 524
           Y   L+ F  L V+GQLQ+ L++P+I+ WRQYILL +P FG SVLITVTLLAMIAAVPHE
Sbjct: 400 YYGFLLKFTGLMVLGQLQVLLMKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHE 459

Query: 525 HQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSA 584
           HQAATTSISYAFRSTG TLGVS+G A+FR  L   L  +VMK  SDK+ +E L  II  A
Sbjct: 460 HQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQA 519

Query: 585 AHSSDYIHDSAPEFVRQALIESYHFACRNTYKFC-LASIFCALLSCIAVKEYKLHTSMDR 643
           + SS+Y+H +AP+F++  LI+ Y  AC++T+ FC L SIF A +SC  +KEYKLHTSM+R
Sbjct: 520 SESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIF-AWISCGVIKEYKLHTSMER 578

Query: 644 Q 644
           +
Sbjct: 579 K 579

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/630 (51%), Positives = 416/630 (66%), Gaps = 18/630 (2%)

Query: 15  LQAFVKLKERQRQLLNDEPKVVIQQNPAHSIEPTETTPFLQPIRRELVLDPTSDLPGFVA 74
           L+ F + K+ Q+   ND  +         S EP E +  L PI+ E++ DP++DLPGFVA
Sbjct: 11  LREFTRQKQLQQAKKNDMLEETRPLVAPSSAEPIEAS-LLLPIKPEILQDPSTDLPGFVA 69

Query: 75  GXXXXXXXXXXXXQTNASGYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGS 134
                        +  A+GY SI        K+ +   S+ E      +S AR+++IM S
Sbjct: 70  -------EEIGQQEEVANGYGSITDPHDGDNKS-ERPVSTAEE-----ISGARLRVIMLS 116

Query: 135 MYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRK 194
           MYLGIFLA++DNTIVST  AH+ASEFN++  +SWIAT+YLLSSATFQPLYGK+SDIFGRK
Sbjct: 117 MYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRK 176

Query: 195 PLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALY 254
            LL+F+NV F +GCL+CGLS   W LV  RF                  D+VPLR RA+Y
Sbjct: 177 CLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGGGGLTSMSSITITDLVPLRERAMY 236

Query: 255 QGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGS 314
           QGICN F+            WFS++ GGWR+AFLIQ+PL AIS  +I+ +L+LP      
Sbjct: 237 QGICNVFYGLGTACGGIVGGWFSDNKGGWRMAFLIQVPLSAISLLVIILHLKLPS----K 292

Query: 315 GIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVG 374
               ++DN I  KL  IDW                     KE+ + S  F  + ++ ++ 
Sbjct: 293 RATRNQDNSIKRKLLAIDWLGASTLVIFLVLFLLTASLGGKEIAYGSRTFALMLISSLLS 352

Query: 375 GATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKP 434
              F+YVE  V+ DPILP+ FL  R++LGSSL+NWF MM  MTTSY+LP+Y++GVLNM P
Sbjct: 353 CLVFIYVELRVAADPILPLRFLAIRSVLGSSLSNWFCMMATMTTSYYLPIYFSGVLNMSP 412

Query: 435 TDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWR 494
           TD+GKR +P+FFS A GSLGAGYYMKKT KY W  + FCA+AV+GQLQI LI+P I  WR
Sbjct: 413 TDVGKRLMPNFFSVAFGSLGAGYYMKKTRKYYWFSLIFCAVAVLGQLQILLIDPKIPTWR 472

Query: 495 QYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRK 554
           QYILL++PG G SVLITV LLAMIAAVPHEHQAATTSISYAFRS GCTLGVSIGGAIFR+
Sbjct: 473 QYILLLVPGVGTSVLITVALLAMIAAVPHEHQAATTSISYAFRSAGCTLGVSIGGAIFRE 532

Query: 555 SLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNT 614
           SL  L  R V++  S +HP+EEL KIID A+ SS+++H SAP+F+RQ L+E YH AC+NT
Sbjct: 533 SLSKLTTRYVLRYISKEHPKEELLKIIDKASESSEWVHHSAPDFIRQTLLECYHKACKNT 592

Query: 615 YKFCLASIFCALLSCIAVKEYKLHTSMDRQ 644
           + FC       L+S   +KE KLH+S+DR+
Sbjct: 593 FLFCFICSILTLVSFSIIKEKKLHSSLDRK 622

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/604 (52%), Positives = 409/604 (67%), Gaps = 20/604 (3%)

Query: 45  IEPTETTPFLQPIRRELVLDPTSDLPGFVAGXXXXXXXXXXXXQTNASGYDSIKKNTV-- 102
           + P E T FL PI ++++ DP++ L GFVA               + +G+DS     V  
Sbjct: 1   MSPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQD------YNSRTGHDSYGATAVDD 54

Query: 103 --ATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEF 160
             AT+   DL     E      LS +RI+IIM SM+LGIFLA+LD TIVSTLL  I SEF
Sbjct: 55  RTATSARCDLTFPPSETPE-FALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEF 113

Query: 161 NEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCL 220
           N +  +SWIAT+YLLSS+T QPLYGK+SD  GRKPLL+FSNV+F++GCLICG+S  +W +
Sbjct: 114 NSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWV 173

Query: 221 VAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHG 280
           V GRF                  D+VPLR RA+YQG+CNF F             F +  
Sbjct: 174 VVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD-- 231

Query: 281 GGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXX 340
             WR+AF IQ P+   SC+LIV+YLELP        + D+D   + KLR +DW       
Sbjct: 232 --WRMAFTIQCPISLASCALIVSYLELPPRH-----EDDKDRHWTSKLRDLDWAGVVTLV 284

Query: 341 XXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRT 400
                         KE+ + S  F  LCV  +V G+ F YVE YV+ DP+LP+AFLK R+
Sbjct: 285 CFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS 344

Query: 401 ILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMK 460
           +LGSSLANWF+MM M+TT+Y+LPVYWA VLNMKPTD+GKR+IPSFFS A GSLGAG YMK
Sbjct: 345 VLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMK 404

Query: 461 KTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAA 520
           +TGKY W L+AFC + ++GQL+I+L+ P   VW+QY+LLV+P FGLSVLITVTLLAMI+A
Sbjct: 405 RTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISA 464

Query: 521 VPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKI 580
           VPHEH AATTSISYAFRSTG TLGVSIG AIFR +L +LL+  V++ ASD+HPREEL +I
Sbjct: 465 VPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRI 524

Query: 581 IDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTS 640
           I++AAHS++++H  APEFVR  L+E YH+A ++T+KFCL ++  A  SC  ++E+ LHT+
Sbjct: 525 INNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTT 584

Query: 641 MDRQ 644
           + R 
Sbjct: 585 LKRD 588

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/599 (52%), Positives = 397/599 (66%), Gaps = 14/599 (2%)

Query: 48  TETTPFLQPIRRELVLDPTSDLPGFVAGXXXXXXXXXXXXQTNASGYDSIKKNTVATAKT 107
           +E +P L P+ R+ + DP++DLPGFVA             Q  A  Y S  K+++++   
Sbjct: 4   SEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRA--YGSTTKSSISSENE 61

Query: 108 IDLETSSIEAKNNTG---LSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMP 164
            +    +  A   +    L  +RI IIM SM+LGIFLA+LD TIVSTLL HI SEFN + 
Sbjct: 62  REDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLD 121

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
             SWIAT+YLLSS+T QPLYGK+SD  GRKPLL+FSN +FA+GCLICGLS  +W +VAGR
Sbjct: 122 KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGR 181

Query: 225 FXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWR 284
           F                  D+VPLR+RA+YQG+CNF F            +F +    WR
Sbjct: 182 FISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WR 237

Query: 285 VAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXX 344
           +AF++Q P+  +S  LIV YLELP     S       +  S +LRR+DW           
Sbjct: 238 LAFILQCPISVLSGILIVVYLELPPRASAS-----NKDCWSARLRRLDWAGATSLIAFLF 292

Query: 345 XXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGS 404
                       + + S  F A+C A +V GA FVYVE  V+ DP+LPV FL++R++LGS
Sbjct: 293 LFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS 352

Query: 405 SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK 464
           SLANWF MM MMTT+++LPVYW+ VL MK TD+GKR +PSFFS A GSLGAG YMK+TGK
Sbjct: 353 SLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGK 412

Query: 465 YKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHE 524
           Y + L+AFC LA+ GQ+QI LI P + VWRQY+L V+PGFG+SVLITVTLLAMIAAVPHE
Sbjct: 413 YYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHE 472

Query: 525 HQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSA 584
           H AATTSISYAFRSTG TLGVS+G A+FR SL SLL+  VM+ ASD H   EL  II SA
Sbjct: 473 HHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASA 532

Query: 585 AHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSMDR 643
           A SSD++H SAP FVR  L+E YHFA R T+KFCL ++  A +SC  +KE+KLHTS+ R
Sbjct: 533 ARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/634 (49%), Positives = 400/634 (63%), Gaps = 14/634 (2%)

Query: 15  LQAFVKLKERQRQLLNDEPKVVIQQ-NPA---HSIEPTETTPFLQPIRRELVLDPTSDLP 70
           L+ F K KERQR L       V Q   PA   H     E +  L+  R  LV DP+S L 
Sbjct: 16  LREFAKRKERQRALAGQNQAGVGQDAQPARRQHRPRAGEQSGLLEASRGTLVSDPSSGLS 75

Query: 71  GFVAGXXXXXXX----XXXXXQTNASGYDSIKKNTVATAKTIDLETSSIEA--KNNTGLS 124
           G VA                 ++ A+        +      + L  +++EA  ++  GL 
Sbjct: 76  GLVASELEVQRQQEVCAAVTAESMATSGSGSSYGSTQKPTEVYLTATAVEAAKEDAGGLG 135

Query: 125 PARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLY 184
             R +++M SM LG+FLA+LD TIV+TLL HIASEFNE+P ISWIATAYLLSSATFQPLY
Sbjct: 136 ATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLY 195

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXD 244
           GK+SDIFGR+PLL+FSN++F LG LICG+S  LW LV GRF                  D
Sbjct: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255

Query: 245 IVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAY 304
           IVPLR+RALYQGICN FF             F++   GWR+AFL+Q+PL  +S + I  +
Sbjct: 256 IVPLRSRALYQGICNVFFGLGTACGGLVGGLFADRAVGWRMAFLVQVPLTLLSTTAIQLF 315

Query: 305 LELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGF 364
           L LPK               + KLR +DW                     ++LP      
Sbjct: 316 LTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPH----L 371

Query: 365 YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPV 424
           Y + V I++ G+ F+Y E YV+ DPILP+ FL+NR++L +SL+NWF MMGMMTT +++PV
Sbjct: 372 YLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPV 431

Query: 425 YWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQIS 484
           Y+A VLNM PTD+GKR +PSFFSTA GSLGAGYYMK+TGKY W L+AFC + V+GQ+QIS
Sbjct: 432 YYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQIS 491

Query: 485 LIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLG 544
            + P+I+ WRQY L +IPGFG +VL+TVTLLA+I AVP  HQAATTSISYAFRSTG TLG
Sbjct: 492 YVTPSISTWRQYCLYMIPGFGSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLG 551

Query: 545 VSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALI 604
           VSIGGAIFR  L + L   +M L S +HP  EL +II+ AAHS++++H  APEF R  LI
Sbjct: 552 VSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILI 611

Query: 605 ESYHFACRNTYKFCLASIFCALLSCIAVKEYKLH 638
           + YH+A R T+ FCLA +  A ++C  + EYKLH
Sbjct: 612 DCYHYAGRYTFHFCLACMVLATVACCFIVEYKLH 645

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/607 (48%), Positives = 383/607 (63%), Gaps = 21/607 (3%)

Query: 49  ETTPFLQPIRRELVLDPTSDLPGFVAGXXXXXXXXXXXXQTNASGYDSIKKNTVATAKTI 108
           + +P L  IR EL+ D +  LPGFVA                ++ +      +VA +  +
Sbjct: 25  DKSPLLHAIRGELLQDSSFSLPGFVAAEIEEREELYREASIASNQHH--DYGSVANSIIL 82

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISW 168
           D        KNN  LSP R+++ M SMYLGIFL++LDNTIVSTLLA I SEFNE+P ISW
Sbjct: 83  D------NDKNN--LSPTRLRLAMSSMYLGIFLSALDNTIVSTLLARIGSEFNELPRISW 134

Query: 169 IATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXX 228
           IATAYLLSSATFQPLYGKISDIFGRK +L F NV F +GCLICG +   W LV GRF   
Sbjct: 135 IATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISG 194

Query: 229 XXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFL 288
                          DI+PLRNRALYQG+CNF++            WF+E  G WR AFL
Sbjct: 195 VGGGGITSMSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIGGWFTEKLGSWRGAFL 254

Query: 289 IQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQ---------ISEKLRRIDWXXXXXX 339
            Q+PL  IS   ++ +L+LPK  K  G++    N          I +KL+ IDW      
Sbjct: 255 FQVPLSVISTVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMKKLKTIDWYGAMSL 314

Query: 340 XXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNR 399
                           ++  +SN F  L +  V    +F+Y+E   +KDPILP+ FLK+R
Sbjct: 315 VIFLLSFMILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELKFAKDPILPLVFLKDR 374

Query: 400 TILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYM 459
           ++LGSSL+NWF+MM +MT SY+LP+Y+  V+ +   D+GKRT+P+FFS A GSLGAGYYM
Sbjct: 375 SVLGSSLSNWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPNFFSVAFGSLGAGYYM 434

Query: 460 KKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIA 519
           KKTGKY W +  FC + V+G LQI LI   I+VWRQY+L  +PG G +VLIT+ LL+MI 
Sbjct: 435 KKTGKYYWFVTFFCLVVVIGCLQIYLINDGISVWRQYLLSFVPGLGAAVLITIALLSMIV 494

Query: 520 AVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASD--KHPREEL 577
           AVPHE+QA TTSISYAFRSTGCTLGVSIG A+FR SL   L   +++L S    +  +EL
Sbjct: 495 AVPHEYQAVTTSISYAFRSTGCTLGVSIGAALFRDSLNKYLRAKILELGSQNGNYSEKEL 554

Query: 578 AKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKL 637
            +IID A+ S D++H+ AP F ++ ++E YH+AC+  + FCL     ALLS   +KE+KL
Sbjct: 555 LQIIDHASKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALLSISMIKEHKL 614

Query: 638 HTSMDRQ 644
           H+S+DR+
Sbjct: 615 HSSLDRK 621

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  522 bits (1345), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 257/537 (47%), Positives = 344/537 (64%), Gaps = 5/537 (0%)

Query: 105 AKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMP 164
           A+  +   +   + N + L   RI +I  SM+LGIFLA+LDNTIVSTLL HI SE N+MP
Sbjct: 57  ARNGNDSATDFSSNNLSDLMSRRIFMISASMFLGIFLAALDNTIVSTLLPHIGSELNDMP 116

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
           ++S +AT+Y+ S A FQPL+GK SD+FGRKPLLI SN++F  GCL CGLS  +W L+ GR
Sbjct: 117 NVSLVATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGR 176

Query: 225 FXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWR 284
                              DIVPLRNRA+YQG  N F+             FSE+G GWR
Sbjct: 177 LVTGIGGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWR 236

Query: 285 VAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXX 344
           +AF+IQ+P C +S   I+ YL+L    +  G  S     +  KLR IDW           
Sbjct: 237 MAFMIQLPFCFLSTISIIVYLDLSDDKQDLGRSS-----LYCKLRLIDWLGALTLVTFLL 291

Query: 345 XXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGS 404
                     + +P+ S  F+ LCVA+   G    YVE +++ DPILP++FL+N+ +LGS
Sbjct: 292 LFLVTMTIGGQHVPYGSLRFFLLCVAVCASGLALAYVEIFLANDPILPISFLRNKNVLGS 351

Query: 405 SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK 464
           SLANWF MMGMMT +Y+LP+YW+ V N  P  +GK++IPSFFS ALGS G  YY++K G 
Sbjct: 352 SLANWFCMMGMMTITYYLPIYWSSVSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQKNGT 411

Query: 465 YKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHE 524
           Y  LLM  C + + GQLQI  I P +  WRQYILL +PGFG+S+LITVTLLAMIAAVPH+
Sbjct: 412 YYRLLMTSCLIIIFGQLQIVYITPEMPQWRQYILLAVPGFGVSILITVTLLAMIAAVPHK 471

Query: 525 HQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSA 584
           HQAATTS+SYAFR+TGC +G S+ GAIF+ +L   +   VMK   D+H ++EL  +I+ A
Sbjct: 472 HQAATTSLSYAFRTTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKELNLVIEKA 531

Query: 585 AHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSM 641
             SSD++++ +PEFV +AL++ Y  AC  T++FCL      ++SC  + E  L T++
Sbjct: 532 LRSSDWVNNGSPEFVHEALLKCYENACGQTFRFCLLCFLLTVISCSFITEINLPTTL 588

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  489 bits (1260), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 259/594 (43%), Positives = 366/594 (61%), Gaps = 17/594 (2%)

Query: 49  ETTPFLQPIRRELVLDPTSDLPGFVAGXXXXXXXXXXXXQTNASGYDSIKKNTVATAKTI 108
           +++  L+PIR E + D ++D+ GFVAG            +    G   I   + A+  T+
Sbjct: 326 DSSQILKPIRDEFIQDASTDIAGFVAGELEEIEEEAREAREGEEGEALI--TSTASYGTL 383

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISW 168
            +E  S+E  N       ++ IIM SMYLG+FLA+LDNT+VSTL+AHI SEFN++P + W
Sbjct: 384 PIE-PSVEMSN------MKMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPW 436

Query: 169 IATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXX 228
           +AT+YLLSSA FQPLYGK+SDIFGRK LLIFSN++F  GC+ICG+S  L  LV GRF   
Sbjct: 437 VATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAG 496

Query: 229 XXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFL 288
                          DIVPLR+RA+YQGICNFFF             F +H  GWR+ F 
Sbjct: 497 IGGGGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVFW 556

Query: 289 IQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXX 348
            Q+P+  +S  LI ++L +P+         + +  +  KL R+DW               
Sbjct: 557 SQVPVSGLSTLLICSFLVVPR-------IKNYEVSLGRKLMRVDWLGSISMILWLTSFLL 609

Query: 349 XXXXXXK-ELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLA 407
                    L   S+ F+ L +   V    FV  E +V+ DP+LP+ FL NR++LG+SL 
Sbjct: 610 ITTMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLG 669

Query: 408 NWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKW 467
           N+F +MG MT  ++LP+Y+A VL++ PT +GKR  P+F  TALGSLGAG YMK+TGKY W
Sbjct: 670 NFFCVMGFMTICFYLPIYFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGKYYW 729

Query: 468 LLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQA 527
            ++ F  ++ +G   ++LI   +++  QY+L+V+PG G S++I V LLAMIAAVPH+HQA
Sbjct: 730 FVVLFALVSTLGHYYLTLIPLTVSITVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQA 789

Query: 528 ATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHS 587
           ATTSISYAFRSTG TLGV++G ++F ++L   L  +V++  S +HPR+EL +II  A+HS
Sbjct: 790 ATTSISYAFRSTGGTLGVALGSSVFHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHS 849

Query: 588 SDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSM 641
           ++++H  AP F+R  LI  Y  AC + + FC A    A +S   ++E +L T +
Sbjct: 850 TEWVHRKAPTFIRDTLITCYDVACHDVFVFCTACALLAAISLALIREERLATGL 903

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score =  457 bits (1176), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 258/652 (39%), Positives = 369/652 (56%), Gaps = 27/652 (4%)

Query: 15  LQAFVKLKERQRQLLNDEPKVVIQQNPAHSIE-----------PTETTPFLQPIRRELVL 63
           L+ F KLK RQR L +DE       + +++I              ET PFL  I + ++ 
Sbjct: 16  LKEFAKLKGRQRTLKSDEAGETYLGDKSNTISFGPYSRSSDESQGETIPFLTRIDKNVIQ 75

Query: 64  DPTSDLPGFVAGXXXXXXXXXXXXQTNASGYDSIKKNTVATAKTID--------LETSSI 115
           D +S  PGFV               + ++   +    + +T  T D        + +SS+
Sbjct: 76  DTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTPDSNKNGNVFIRSSSV 135

Query: 116 EAKN---NTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATA 172
           E  N   +  +S  R   I+ S+ +G+FL SLD TI+STLL +IASEF  +P+ISWIA +
Sbjct: 136 EVGNIGDSQNISQIRFAAIVSSLVVGVFLGSLDGTILSTLLDYIASEFEALPYISWIAAS 195

Query: 173 YLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXX 232
           YLLS+  FQPLYGK+SDIFGRK +L+FSN+MF LGCL+CG +P +W L+AGRF       
Sbjct: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAGIGGG 255

Query: 233 XXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIP 292
                      DIVPLR+RA YQ + N  +            W +E+GG WR+ FL+Q+ 
Sbjct: 256 GLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG-WRLVFLLQVV 314

Query: 293 LCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXX 352
              IS   I A+L LPK   G+GI       +  KL  +DW                   
Sbjct: 315 AALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTFCLVIFLASLTLTCSL 374

Query: 353 XXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSM 412
               +    N    L + + V G  FVY E  ++ DPIL V  L +R +L SSLAN+F M
Sbjct: 375 ----VDLNFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHLLTDRNVLASSLANFFCM 430

Query: 413 MGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAF 472
           +  + T +++P+Y+A VL M P ++GKRTI SF  T++GS G GYY+K+ GKY+  +   
Sbjct: 431 LNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKYRTFICLA 490

Query: 473 CALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSI 532
           C + ++GQLQI+LI+P+I+ WRQY+LL+IP    + + T  L+++IAAVP+++Q A  SI
Sbjct: 491 CIIGILGQLQIALIKPSISTWRQYLLLLIPILYTTTVRTSLLISLIAAVPYKNQTAAASI 550

Query: 533 SYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIH 592
           SY FRSTG  LG S+GG IFR SL SLL  N+M L S+ HP+ +L  IID A HS+D++H
Sbjct: 551 SYTFRSTGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPKSQLLHIIDKATHSTDWVH 610

Query: 593 DSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSMDRQ 644
             +PE+    LI  YH+ C+  + F +  +    +SC  +KEY +H S  ++
Sbjct: 611 RESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYPVHASQPQE 662

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/541 (36%), Positives = 293/541 (54%), Gaps = 17/541 (3%)

Query: 116 EAKNNTGLSPAR-IKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYL 174
           +A ++  + P R +  I+ ++++G +LA+LD TIV+TLL  IASE +    +SWIAT+YL
Sbjct: 18  QAAHDKNVEPLRDVNWIVFALFVGSYLAALDTTIVTTLLPTIASELDASNQMSWIATSYL 77

Query: 175 LSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICG--LSPGLWCLVAGRFXXXXXXX 232
           LS + FQPLYGK+SD+FGRKPLLI+SN+ F  GC++CG   +  LW L  GRF       
Sbjct: 78  LSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGG 137

Query: 233 XXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIP 292
                      DI+PLR R +YQG+ N  F             F +   GWR AFL Q+P
Sbjct: 138 GLNSLSTITTSDIIPLRQRGVYQGMGNIVFALGCASGSLIGA-FLQQRIGWRWAFLCQVP 196

Query: 293 LCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRR--IDWXXXXXXXXXXXXXXXXX 350
           L  +SCSLI+ +L LP G  G G+ +  + +I+    R  +D+                 
Sbjct: 197 LSLLSCSLIMKFLNLPAGSPGRGLINLSNKKITTADVREHVDFTGSFTLITTMLLLMIIL 256

Query: 351 XXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFL-KNRTILGSSLANW 409
                        +    V + + G TFV  E  V  +P++P+  L  NRT+L SSL NW
Sbjct: 257 SVLDNPSHLTYGTWALFIVGLALAGYTFVSTELSV-HNPMVPIRLLGSNRTVLASSLTNW 315

Query: 410 FSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLL 469
           F  M     +Y++PV+W  V ++KP ++G RT+ +FF  A+GS+  G YMK+TGKYK L 
Sbjct: 316 FFTMSTFVLAYYVPVFWQTVYHLKPWNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALS 375

Query: 470 MAFCALAVVGQLQISL----IEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEH 525
                + V G L + L     EP   +  +Y +L +PG G + ++T+TLL++IA+V   H
Sbjct: 376 NTLNTVTVAGTLIVYLSTYNTEPKGLL--EYFMLFLPGLGYASMLTITLLSLIASVDTSH 433

Query: 526 QAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVM--KLASDKHPREELAKIIDS 583
           QA  TSI YAFR+ G TLGVS  G I++  L + L RN++  K  +DK+   +L K   +
Sbjct: 434 QAQVTSIQYAFRAIGSTLGVSFAGLIYQSKLQTSLLRNIVENKTLNDKYSTHQLRKWCQT 493

Query: 584 AAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSMDR 643
              ++ +     P     A I S+    R    F + +    LLS + ++E+ LHT + R
Sbjct: 494 LLENNSFDVSFDPLLESLAKI-SFQGGSRLVLGFAVLASILGLLSSLFIREHVLHTDIQR 552

Query: 644 Q 644
           +
Sbjct: 553 R 553

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score =  303 bits (776), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 200/549 (36%), Positives = 289/549 (52%), Gaps = 33/549 (6%)

Query: 110 LETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWI 169
            ++S   A N++ L+  + +II+ +++LG FL++LD TIVSTLL  IAS+ +    +SWI
Sbjct: 22  FDSSYDAAANHSVLTETKTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDASSQMSWI 81

Query: 170 ATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICG--LSPGLWCLVAGRFXX 227
           AT+YLLS + FQPLYGK+SDIFGRK LL++SN++FA+GC +CG   +  +W L AGRF  
Sbjct: 82  ATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCGSPWTTNIWILSAGRFIA 141

Query: 228 XXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAF 287
                           DI+PLR R +YQG+ N  F               + G GWR AF
Sbjct: 142 GIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSLGCASGSVLGA-VLQQGIGWRWAF 200

Query: 288 LIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDN-----QISEKLRRIDWXXXXXXXXX 342
           LIQ+P+  IS  LIV  LELP    G G+   E       Q S+  + ID+         
Sbjct: 201 LIQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQWSKVTKMIDFVGSITLVMS 260

Query: 343 XXXXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFL-KNRTI 401
                              N +  L + +    A FV+ E  +  +P++P+  L +NRT+
Sbjct: 261 MLLLMITISFLSDPSQLSENSWVVLVLLVAGFCAKFVHTECTI-HNPMVPLRLLWENRTV 319

Query: 402 LGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKK 461
             SS  NWF  M      Y++PV+W  V    P D+G R+I +F   A GS+ AG YMK 
Sbjct: 320 FASSFTNWFMTMSTFAVMYYIPVFWQTVFKFTPYDIGFRSISNFVGIATGSMLAGVYMKC 379

Query: 462 TGKYKWLLMAFCALAVVGQLQISLI----EPNIAVWRQYILLVIPGFGLSVLITVTLLAM 517
           TGKY    +    L   G L +        P   +  +Y+L+ +PGFG + ++TVTLLA+
Sbjct: 380 TGKYWNFSLVTNILYFTGILSLFACTFRNTPQGVL--EYLLMFLPGFGYATMLTVTLLAL 437

Query: 518 IAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVM--KLASDKHPRE 575
           IA+V  EHQA  TSI YAFR+TG TLGVS+ G I++ SL   L R+++  +    K+ ++
Sbjct: 438 IASVDFEHQAQVTSIQYAFRATGSTLGVSLAGLIYQASLQYKLYRDILGDQTLLGKYGQD 497

Query: 576 ELAK----IIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCAL---LS 628
           +L K    I+   +  + +    A E  R      + F+      F LA+  C L   LS
Sbjct: 498 QLRKWCKEILQDNSFDTSFDQRLAKEVHR-----GFQFSSECALGFALAA--CTLGVVLS 550

Query: 629 CIAVKEYKL 637
           C  ++E+ L
Sbjct: 551 CF-MREHVL 558

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score =  303 bits (775), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 201/562 (35%), Positives = 295/562 (52%), Gaps = 33/562 (5%)

Query: 104 TAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEM 163
           T +T  ++T      +++ L P +++I + ++ +G FL++LD TIV+TLL  IAS+ +  
Sbjct: 16  TTETALVDTGEESTTSHSELPPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDAS 75

Query: 164 PHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSP---GLWCL 220
             +SWIATAYLLS + FQPLYGK+SDIFGRK LLI SN+ FALGC ICG SP    +W L
Sbjct: 76  SQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVWVL 134

Query: 221 VAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHG 280
             GRF                  DI+PLR R +YQG+ N  F               + G
Sbjct: 135 STGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVL-QQG 193

Query: 281 GGWRVAFLIQIPLCAISCSLIVA-YLELPKGCKGSGIQSDEDNQISEKLR------RIDW 333
            GWR AFL+Q+P+ A+ C+L++A  L+LP    G G+   E  +  ++L+       +D+
Sbjct: 194 IGWRWAFLVQVPM-ALVCALMIAVVLDLPADSPGRGLLWLELKR-GKRLKWCTVTEMVDF 251

Query: 334 XXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPV 393
                                      ++ +  L V +      F Y E   +++P++P+
Sbjct: 252 VGSFTLIASMILLMTAISLLSDPTQLSTSLWLLLGVLLTASSLQFAYTEC-TTRNPMVPL 310

Query: 394 AFL-KNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGS 452
             L +NRT+  SS  NWF  M   T  Y++PV+W  V    P D+G R++ +F   A GS
Sbjct: 311 RLLWENRTVCASSFTNWFMTMTTFTVMYYVPVFWHTVYKFTPWDIGVRSMSNFVGIASGS 370

Query: 453 LGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLI----EPNIAVWRQYILLVIPGFGLSV 508
           + AG YMK+TGKY    +A  +L  VG L +        P   V  +Y+L+ +PGFG + 
Sbjct: 371 MLAGMYMKRTGKYWSFSVATNSLFAVGVLSLFAFSFKGSPQGVV--EYLLMFLPGFGYAT 428

Query: 509 LITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMK-- 566
           ++TVTLLA+IA+V  EHQA  TSI YAFR+TG TLGV++   I++  L S L  NV+   
Sbjct: 429 MLTVTLLALIASVSVEHQAQVTSIQYAFRATGSTLGVALASLIYQSCLQSRLYNNVLTDG 488

Query: 567 --LASDKHPR--EELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASI 622
             LA     R  +    I+   +    + H  A E VRQ     + F+ +    F     
Sbjct: 489 PLLAQYGSRRLMDWCQSILQDNSFDISFDHRLA-ELVRQG----FQFSNQCALGFAFVVC 543

Query: 623 FCALLSCIAVKEYKLHTSMDRQ 644
              +LS   ++E+ LHTS+ R+
Sbjct: 544 VLGVLSSCFMREHVLHTSVSRK 565

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score =  181 bits (460), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 144/526 (27%), Positives = 233/526 (44%), Gaps = 49/526 (9%)

Query: 127 RIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGK 186
           RI +I  +++  +FL+ LD+TI +++   I +EF ++   SWI TAYL++  +FQPLYG 
Sbjct: 44  RILLIETALFTNVFLSGLDSTITASIYQLIGNEFEDVKVSSWITTAYLVTCTSFQPLYGS 103

Query: 187 ISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIV 246
            SD  GR+  L F+N +FALGCL CGL+  ++ L+  R                   DI+
Sbjct: 104 FSDTLGRRRCLFFANTIFALGCLGCGLTSTIYSLIIMRAVTGIGGGGLITLSTIVNSDII 163

Query: 247 PLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYL- 305
           P + R +YQ   N                 +    GWR  FL+Q+P+       ++AYL 
Sbjct: 164 PAKKRGMYQSFQNILVGTGAVVGASCGGEIASS-MGWRWCFLLQVPISI--GGAVMAYLF 220

Query: 306 -----ELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQ 360
                 + K  +   + S+       K+++ID+                          +
Sbjct: 221 VQDQDVVDKNPRSGALPSN-----VSKIKKIDFLGAFLLISGLVSQLIFLTINSSAQEGK 275

Query: 361 SNGF----YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFS----- 411
           S        AL +   V    F YVE   + +PI+P             L  W+S     
Sbjct: 276 STWLSGRSLALGLVTAVSLILFAYVEKTTTANPIIPHDL----------LGQWYSTTVLI 325

Query: 412 ---MMGMMTTSYF--LPVYWAGVLNMKPTDMGKR-TIPSFFSTALGSLGAGYYMKKTGKY 465
              ++G ++ +Y   LP+Y+  V+     + G R T+PS F T +G +  G  MK   + 
Sbjct: 326 VGVLVGFVSYAYIFTLPLYFQVVVGDTAAEAGLRLTVPS-FCTPIGGVIMGISMKDPKRL 384

Query: 466 KWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEH 525
             LL+   +L + G L   LI+P    W   +LLV    G  +    TL + + A P   
Sbjct: 385 PGLLIVGISLMLFGNLCFLLIKPTTPYWLTSLLLVPANIGQGITFPSTLFSFLFAFPPYK 444

Query: 526 QAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAA 585
           QA  T+  Y FRS GC  GV+   ++ +    S++ +   K        EE+  ++   +
Sbjct: 445 QATATATLYLFRSVGCVWGVAGTSSLIQ----SVVRKQATKRLQGILTDEEIKSLLVKLS 500

Query: 586 HSSDYIHDSAPEFVRQALIESYHFACRNTYKF----CLASIFCALL 627
           H +  I +  P+ VR A++ SY  + ++TY F    CL +I  AL+
Sbjct: 501 HKTSLI-EKLPDNVRAAVLTSYEISIKSTYFFSVILCLIAIILALM 545

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score =  173 bits (438), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 138/502 (27%), Positives = 225/502 (44%), Gaps = 29/502 (5%)

Query: 127 RIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGK 186
           ++ +I  +++  +FL+ LD+TI ++    I +EF ++   SWI TAYL++  +FQPLYG 
Sbjct: 41  KVLLIETALFTNVFLSGLDSTISASTYQLIGNEFGDVKLSSWITTAYLITCTSFQPLYGS 100

Query: 187 ISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIV 246
            SD  GR+  L F+N +FALGC  CG +  ++ L+  R                   DI+
Sbjct: 101 FSDTLGRRHCLFFANTIFALGCFGCGTTTTIYSLILMRALTGIGGGGLITLSTIINSDII 160

Query: 247 PLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGG------GWRVAFLIQIPLCAISCSL 300
           P + R +YQ   N                 +  GG      GWR  FL+Q+P+ ++  +L
Sbjct: 161 PAKKRGIYQAFQNVLLGTGAVVG-------ASCGGLIATTMGWRWCFLLQVPI-SVGGTL 212

Query: 301 IVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXX----XXXXXXXXXXKE 356
           +  +    +    +G  S       EKL +ID+                          E
Sbjct: 213 VAFFFVHDQRPDINGGVSAVRTTGWEKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSE 272

Query: 357 LPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMM 416
             + S     L ++  V    F YVE     +PI+P   L  R   G+++     ++G +
Sbjct: 273 SYWYSPQSIVLTLSTGVSLILFAYVEHTTKANPIIPHDLL--RQAHGATVLIISVLVGFV 330

Query: 417 TTSYF--LPVYWAGVLNMKPTDMGKR-TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFC 473
             +Y   LP+Y+  V+       G R T+PS F T +G L  G  MK       LL++  
Sbjct: 331 AYAYIFTLPLYFQVVIGDTAAKAGLRLTVPS-FCTPIGGLITGLSMKNPNHLPVLLISGI 389

Query: 474 ALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSIS 533
              ++G L    I+P    W+  +LLV    G  +    TL   + A P   QA  TS  
Sbjct: 390 TCMLLGNLCFLFIKPWTPYWQTSLLLVPANVGQGITFPSTLFTFLFAFPPYKQATATSTL 449

Query: 534 YAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHD 593
           Y FRS GC  GV+   ++ + ++ +  ++++  L ++K    E+ K++   +H++  I  
Sbjct: 450 YLFRSVGCVWGVAGTSSLIQYAVRNQAKKSLNGLLTEK----EIRKLLLQLSHTTSQIKK 505

Query: 594 SAPEFVRQALIESYHFACRNTY 615
             P+ VR A+I SY  A R  Y
Sbjct: 506 LPPD-VRSAVISSYDNAIRQAY 526

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score =  170 bits (431), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 140/506 (27%), Positives = 231/506 (45%), Gaps = 16/506 (3%)

Query: 126 ARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYG 185
            R +I    M   +F  ++D++I+  + + IASEF+E+  +S + +AYLLS+A  Q ++ 
Sbjct: 246 TRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQLVFL 305

Query: 186 KISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDI 245
           K+S I   K LL  +   F LG  +   S   W  +  R                   + 
Sbjct: 306 KLSLISSVKLLLCIAQFSFILGGYLSWSSAHFWTFIFAR-CVTGFGGGSLIALKSTIMNR 364

Query: 246 VPLRNRALYQGICNF--FFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVA 303
              +N + Y    +   F             + S HG GWR AFLI +P C ++ S+++A
Sbjct: 365 FSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLA 424

Query: 304 YLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNG 363
            +   K             +    L   D                        L   +  
Sbjct: 425 DMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEILTLTLFLLCFVQVTSLDLTGLKNNTMI 484

Query: 364 FYALCVAIVVGGATFVYVETYVS-KDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFL 422
              L   I+V G  F  +ET  +  + ++ ++   ++ ++ + +   F    +M    F 
Sbjct: 485 QALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFG 544

Query: 423 PVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK---YKWLLMAFCALAVVG 479
             Y+  VLN+    + +R  P FFS  LG     Y+ K  G+    K++L     L  V 
Sbjct: 545 TTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVA 604

Query: 480 QLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAA--TTSISYAFR 537
            + +SL   N+ VW+QYI L +P  G S+++T  LL+ +    HE + +  + SI Y F 
Sbjct: 605 LMGVSL---NLPVWKQYICLSLPFLGSSMILT--LLSNLYHEYHEQRKSPISGSIVYCFG 659

Query: 538 STGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPE 597
           + G T+G+S+GG +F K+L  L+   VM  +   + +++L KII  A  SSD++H+SAP+
Sbjct: 660 AVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPK 719

Query: 598 FVRQALIESYHFACRNTYKFCLASIF 623
           FV Q LIE Y  ACRN +K  L+++F
Sbjct: 720 FVFQTLIECYLQACRNVFK--LSTLF 743

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score =  163 bits (413), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 138/521 (26%), Positives = 227/521 (43%), Gaps = 30/521 (5%)

Query: 127 RIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGK 186
           RI  I  +++  +FL+ LD TI ++    I +EF+     +WI TAYL+++ +FQPLYG 
Sbjct: 43  RIVFIETALFANVFLSGLDGTITASTYQLIGNEFDNFEISNWITTAYLVATTSFQPLYGS 102

Query: 187 ISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIV 246
            SD  GR+  L F+N +FALGCL CGL+PG+  L+  R                   DI+
Sbjct: 103 FSDTLGRRHCLFFANTVFALGCLGCGLAPGILSLIFMRALTGIGGGGLITLSTIVNSDII 162

Query: 247 PLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLE 306
           P  +R +YQ   N                 + +  GWR  FL+Q+P+      +   +LE
Sbjct: 163 PPESRGIYQAFQNVLLGIGAVIGASTGGAVASY-LGWRWCFLLQVPVSVGGTIMAYMFLE 221

Query: 307 LPKGCKGSGIQSDEDNQ-ISEKLRRIDWXXX-------XXXXXXXXXXXXXXXXXXKELP 358
             KG      +S+   Q +  +  +ID                             + L 
Sbjct: 222 NQKGFVS---ESESSGQLLKNRFSKIDLKGSLLLIVGLASQLMYLTVNSSMASSGSQWLS 278

Query: 359 FQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFS-MMGMMT 417
            +S G   L V  +V    F++ E     +PI+P   L       S++    S ++G ++
Sbjct: 279 KESIGLILLTVLSLV---MFIHTERTTQANPIIPTKLLSQSH---STMVLVISVLVGFVS 332

Query: 418 TSYF--LPVYWAGVLNMKPTDMGKR-TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCA 474
            +Y   LP+++  V+       G R  IPS F T +G L  G  M+      +LL     
Sbjct: 333 YAYLFTLPLFFQIVVGDSAARAGFRLAIPS-FCTPIGGLITGLSMRIPKTLPFLLSFGMV 391

Query: 475 LAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISY 534
           L ++G     L++     W   +LL     G  V    TL + + +   E+QA  TS  Y
Sbjct: 392 LMMIGNAFFLLLKTTTPEWLVCLLLTPANVGQGVTFPATLFSFLFSFHPENQATATSTLY 451

Query: 535 AFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDS 594
            FRS G   GV+    + +  +G  +   +  + S     EE+A++     H + YI + 
Sbjct: 452 LFRSIGSLWGVAGTSGLIQLLVGRKIREKLHGILSP----EEIARLRSKIGHKTSYI-EK 506

Query: 595 APEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEY 635
            P  +++A++ESY  A +  +   L+  FC +   I++  +
Sbjct: 507 LPSEIKEAVVESYESAIK--FAHILSVSFCVIAIGISIVRH 545

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score =  160 bits (404), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 140/543 (25%), Positives = 242/543 (44%), Gaps = 15/543 (2%)

Query: 93  GYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTL 152
           GY SI +         D    +  + +       R +I    M   +F  ++D++I+  +
Sbjct: 213 GYGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVI 272

Query: 153 LAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICG 212
           ++ IASEF+E+  +S I + YLLS+A  Q L+ K+S I   K LL  +   F LG  +  
Sbjct: 273 VSKIASEFHELWRLSLIVSVYLLSNAIGQLLFLKLSIISSVKLLLCMAQFSFILGSYLSW 332

Query: 213 LSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICN--FFFXXXXXXXX 270
            S   W  +  RF                  +    +N + Y    +   F         
Sbjct: 333 SSSHFWTFIFARFVAGFGSGSLIALKSTIM-NRFSQKNESRYSLSASVIIFSLGVAIGPF 391

Query: 271 XXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYL-ELPKGCKGSGIQSDEDNQISEKLR 329
               + S HG GW+ AFLI +P C ++ S+++A +  +       G       ++ + L 
Sbjct: 392 VVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVKKILL 451

Query: 330 RIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVE---TYVS 386
             D                       EL  ++   + L   I++ G  F  +E   TY+ 
Sbjct: 452 SPDLYEILTLTLFLLCFVQVTTLDLTELEHRTMIQWVLFSVILICGVLFWLIEANDTYM- 510

Query: 387 KDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFF 446
            + ++ ++   ++ ++ +     F    +M    F   Y+  VLN+    + +R +P FF
Sbjct: 511 -NSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFF 569

Query: 447 STALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIA--VWRQYILLVIPGF 504
           S  +G     Y+ K   K +  L+ F    V   L I+L+   ++  VW+QY+ L +P  
Sbjct: 570 SIVIGYFSVCYFWK--SKKQNYLLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSLPFL 627

Query: 505 GLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNV 564
           G S+L+T+                + SI Y F + G T+G+S+GG +F K+L   L   V
Sbjct: 628 GSSMLLTLLSSLYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEV 687

Query: 565 MKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFC 624
           MK +   + +++L KII  A  SSD++H+SAP+F+ + LIE Y  ACRN +K  L+++F 
Sbjct: 688 MKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVFK--LSAVFF 745

Query: 625 ALL 627
            ++
Sbjct: 746 TIM 748

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  157 bits (396), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 146/568 (25%), Positives = 229/568 (40%), Gaps = 45/568 (7%)

Query: 88  QTNASGYDSIKKNTVATAKTIDLET-SSIEAKNNTGLSP-ARIKIIMGSMYLGIFLASLD 145
           + +A+ Y SI +  +      +LE     +   +  LS    + II  +++  +FL+  D
Sbjct: 12  RKSATSYGSISETRIPENSLEELENIHGADEDEDIKLSDIPNLWIIEAALFTNVFLSGFD 71

Query: 146 NTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFA 205
            T+ ++    I +EFN M   SWI TAYL++S +FQPLYG  SD  GR+  L F+N  F 
Sbjct: 72  GTVTASTYQTIGNEFNHMNISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFT 131

Query: 206 LGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXX 265
           +GCL CGLSP +  L   R                   D++P   R ++Q   N      
Sbjct: 132 IGCLACGLSPNIVVLSFMRALTGIGGGGLITLSTIVNSDMIPSSKRGIFQAFQNLLLGLG 191

Query: 266 XXXXXXXXXWFSEHGG------GWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSD 319
                      +  GG      GWR  F +Q+P+C  +  ++ +Y+   K          
Sbjct: 192 AICG-------ASFGGSIASSIGWRWCFFVQVPICITNSLIMSSYVPNQK--------EY 236

Query: 320 EDNQI------SEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKE--LPFQSNGFYALCVAI 371
           ED +I       + L+ ID                       +  + + S     L  A 
Sbjct: 237 EDREIGFLFHPKKILKDIDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVLPLLFAS 296

Query: 372 VVGGATFVYVETYVSKDPILPVAFLKNR---TILGSSLANWFSMMGMMTTSYFLPVYWAG 428
            +    FVY E   S   I+P+  +++     +L  S+   F+    + T   LP+++  
Sbjct: 297 GIILVLFVYNEAKTSARAIIPLELMRSSFSFVVLTISILVGFASYAYLFT---LPLFFQI 353

Query: 429 VLNMKPTDMGKR-TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIE 487
           VL       G R TIPS F T +G L  G  M +    + LL A   L  +G      IE
Sbjct: 354 VLGDSTAKAGLRLTIPSLF-TPVGGLITGICMSRYNCLQILLYAGVFLMALGNFLFLFIE 412

Query: 488 PNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSI 547
                W   + L+    G  +    TL   I A P   QA  TS  Y FRS G   GV++
Sbjct: 413 KGSPNWLVGLFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLYLFRSIGSVWGVAM 472

Query: 548 GGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESY 607
              + +   G  L  N+  L  +    E + KI      +S YI     E ++  +I+ +
Sbjct: 473 STGVIQLYFGKSLRSNLKDLLDEDKINELVTKI----TSNSSYIEKLHGE-LKDVVIDCF 527

Query: 608 HFACRNTYKFCLASIFCALLSCIAVKEY 635
             + +  +         AL  C+ +KE+
Sbjct: 528 DSSTKKAHLLSTILSLLALAFCV-IKEF 554

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score =  156 bits (394), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 135/503 (26%), Positives = 202/503 (40%), Gaps = 40/503 (7%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           II  +++  +FL+  D T+ ++    I +EFN+M   +WI TAYL++S +FQPLYG  SD
Sbjct: 54  IIEATLFSNVFLSGFDGTVTASTYQTIGNEFNQMSISNWITTAYLITSTSFQPLYGSFSD 113

Query: 190 IFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLR 249
             GR+  L F+N  F +GCL C LS  ++ L   R                   D++P  
Sbjct: 114 ALGRRNCLFFANAAFTIGCLACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSS 173

Query: 250 NRALYQGICNFFFXXXXXXXXXXXXWFSEHGG------GWRVAFLIQIPLCAISCSLIVA 303
            R ++Q   N                 +  GG      GWR  FLIQ+P+  IS  L+  
Sbjct: 174 KRGIFQAFQNLLLGFGAICG-------ASFGGTIASTIGWRWCFLIQVPISIISSVLMNY 226

Query: 304 YLELPKGCKGSGIQSDEDNQISEKLRR------IDWXXXXXXXXXXXXXXXXXXXXXKEL 357
           Y+   K        + E++ I    +R      I                        +L
Sbjct: 227 YVPNQKE------YNHENSNIFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKL 280

Query: 358 PFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNR----TILGSSLANWFSMM 413
            + S     L V  +     F+  E   +   I+P+  + +      +L S L  + S  
Sbjct: 281 SWTSPSVLLLLVGSIAILLLFISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYA 340

Query: 414 GMMTTSYFLPVYWAGVLNMKPTDMGKR-TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAF 472
            + T    LP+++  VL       G R  IPS F T +GSL  G+ M K    + LL   
Sbjct: 341 YLFT----LPLFFQIVLGDSTAKAGLRLAIPSLF-TPVGSLITGFSMSKYNCLRSLLYVG 395

Query: 473 CALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSI 532
            +L  +G      IE     W   + L+    G  +    TL   I   P   QA  TS 
Sbjct: 396 VSLMFLGNFLFLFIEKTSPNWLISLFLIPANLGQGITFPTTLFTFIFLFPKSDQATATST 455

Query: 533 SYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIH 592
            Y FRS G   GV+I   + + S    L  N+     D      +AK+I     +S YI 
Sbjct: 456 LYLFRSIGSVWGVAISAGVIQLSFAKYLRSNL----KDMLDENTIAKLITKLNANSSYIE 511

Query: 593 DSAPEFVRQALIESYHFACRNTY 615
               E V+  +IES+  A +  +
Sbjct: 512 SLHGE-VKNTVIESFDAATKRAH 533

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score =  155 bits (393), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 153/564 (27%), Positives = 229/564 (40%), Gaps = 47/564 (8%)

Query: 94  YDSIKKNTVATAKTIDLETSSIE-AKNNTGLSPARIK---IIMGSMYLGIFLASLDNTIV 149
           Y SI  + +  A     +   I+ A ++  +  +RI    II  +++  +FLA  D TI 
Sbjct: 19  YGSIDGSGIVIANNHVRDNEEIQNADDDEDIPLSRIPNLWIIEATLFSNVFLAGFDGTIT 78

Query: 150 STLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCL 209
           ++    I +EFN+M   SWI TAYL++S +FQPLYG  SD  GR+  L F+N +F +GCL
Sbjct: 79  ASTYQTIGNEFNQMSISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTIGCL 138

Query: 210 ICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXX 269
            C  S  ++ L   R                   D++P   R ++Q   N          
Sbjct: 139 ACSFSTNIYMLSFMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICG 198

Query: 270 XXXXXWFSEHGG------GWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQ 323
                  +  GG      GWR  FLIQ+P+  I+  L+  Y  +P        Q + D+Q
Sbjct: 199 -------ASFGGTITSTIGWRWCFLIQVPISMIASLLMNYY--VPN-------QKEYDDQ 242

Query: 324 -----ISEK--LRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVGGA 376
                +S K  L+ ID                          + +     L +A +V   
Sbjct: 243 KINILLSSKKILKDID-ITGSILIIAGLTLQLLYLSLGASFSWTNPPVLMLLLASIVIII 301

Query: 377 TFVYVETYVSKDPILPVAFLKNR---TILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMK 433
            F+  E   +   I+P+  + +     +L  S+   F+    + T   LP+++  VL   
Sbjct: 302 LFILNERKTTARAIIPMELVNSSFSFVVLSISILVGFASYAYLFT---LPLFFQIVLGDS 358

Query: 434 PTDMGKR-TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAV 492
               G R TIPS F T +GSL  G  M K    + LL     L  +G      IE     
Sbjct: 359 TAKAGLRLTIPSLF-TPVGSLITGISMSKYDCLQSLLYIGIFLMFLGNFLFLFIEKTSPN 417

Query: 493 WRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIF 552
           W   + L+    G  +    TL   I A P   QA  TS  Y FRS G   GV+I   + 
Sbjct: 418 WLIGVFLIPANLGQGITFPTTLFTFIFAFPKRDQATATSTLYLFRSIGSVWGVAISAGVI 477

Query: 553 RKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACR 612
           +      L  N+  L  D+H    + KII     +S YI     E V+  +I+S+  A +
Sbjct: 478 QLYFARYLRFNLKDLL-DEH---TINKIITRINANSSYIGSLHGE-VKNTVIKSFDSATK 532

Query: 613 NTYKFCLASIFCALLSCIAVKEYK 636
             +         AL+ CI     K
Sbjct: 533 KAHLMSTLLSLLALIFCIVKDNLK 556

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score =  157 bits (398), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 125/521 (23%), Positives = 232/521 (44%), Gaps = 45/521 (8%)

Query: 126 ARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYG 185
            R +I    M   +F  ++D++I+  + + IASEF+E+  +S + + YLL +A  Q ++ 
Sbjct: 252 TRKRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISVYLLGNAIGQLMFL 311

Query: 186 KISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDI 245
           K+S + G K LL  +   F LG  +   S   W  +  R                   + 
Sbjct: 312 KLSLVSGVKLLLCVAQFSFILGSYLSWSSIHFWTFILAR-SVTGFGSGSLIALKSTIMNR 370

Query: 246 VPLRNRALY--QGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVA 303
              +N   Y        F             + S HG GW+ AFLI +P C ++ S+++A
Sbjct: 371 FSQKNENQYPLSTSMTVFSLGVAVGPFLVSFFDSSHGSGWKNAFLIPVPFCLVNASIMLA 430

Query: 304 YLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXX-------------XXXXXXXXXXXXX 350
            +      K +         + ++ +++ W                              
Sbjct: 431 DI---YSVKNTIHHEGPTTTLQKRFKKVLWSPDLYEILTLALFLLCFVQATSLDSTRLEH 487

Query: 351 XXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWF 410
               +E+ F         V I+ G   FV  ++ V  + +  ++   ++ ++ + +  +F
Sbjct: 488 STMIQEIIFS--------VIIICGVLFFVIEKSDVRMNSVFSLSLQGDKHLIWTMMGIFF 539

Query: 411 SMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK---YKW 467
               +M    F   Y+  VLN+   ++ +R +P FFS  +G     Y+     +   +K+
Sbjct: 540 CFAALMCIIPFGTTYFMIVLNLDTLEIAERLLPFFFSIVVGYFSVCYFWNSERQNYLFKF 599

Query: 468 LLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQA 527
           +L     L  V  + ++L   +++VW+QY  L +P  G S+++T     +++ + HE+  
Sbjct: 600 VLSGVTLLLYVALMGMNL---SLSVWKQYTCLSLPLLGSSMILT-----LLSTLYHEYHV 651

Query: 528 A-----TTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIID 582
                 + SI+Y F + G T+GVS  G +F K+L   +   VMK +   + +++L KII 
Sbjct: 652 QRKSPISGSIAYCFAAMGGTIGVSSAGYVFHKTLVRTMNEEVMKFSKQGYLKKDLFKIIK 711

Query: 583 SAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIF 623
            A  SS+++H SAP+F+ + LIE Y  ACRN +K  L+++F
Sbjct: 712 HATQSSNWVHKSAPKFIFRTLIECYLQACRNVFK--LSALF 750

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score =  150 bits (380), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 131/542 (24%), Positives = 236/542 (43%), Gaps = 21/542 (3%)

Query: 88  QTNASGYDSIKKNTVATAKTIDLETSS----IEAKNNTGLSPARIKIIMGSMYLGIFLAS 143
           Q  A  Y SI +    T K ++  T+S    + + +       R +I    M   +F  +
Sbjct: 224 QMRAYEYGSISR----TVKDVENGTTSSYARVASSDKFVHDLTRRRIFSSCMCTYLFFIA 279

Query: 144 LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVM 203
           +D+TI+ ++++ IASEF+E+  +S I + YLLS+A  Q ++ K+S +   K LL  +   
Sbjct: 280 MDSTILMSIVSKIASEFHELWRLSLIISIYLLSNAIGQLVFLKLSIVTSVKLLLCVAQFS 339

Query: 204 FALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFX 263
           F LG  +   +   W  V  R                        +            F 
Sbjct: 340 FILGSYLSWSAFHFWTFVFARSITGFGSGALMALKSTIMNRFSDKKKNGYSLSASVIVFS 399

Query: 264 XXXXXXXXXXXWF-SEHGGGWRVAFLIQIPLCAISCSLIVAYL-ELPKGCKGSGIQSDED 321
                       F +  G GW+ AFLI +P C ++ S+++A +  +       G      
Sbjct: 400 LGVAIGPFLVYLFDNSRGSGWKNAFLIPVPFCLVNASIMLADIYSIKDNLHHGGSAPISW 459

Query: 322 NQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFVYV 381
            +I + L   D                        L   +     L   I+  G  F ++
Sbjct: 460 KRIKKILMSPDLYEILTLALLLLCFVQVTSLDITRLEHSAVIQGVLFFVIITCGILFWWI 519

Query: 382 ETYVS-KDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKR 440
           ET  +  + I+ ++   ++ ++ + +   F    +M    F   Y+  VLN+    + +R
Sbjct: 520 ETNETYANSIISMSLRGDKHLMWTIMGISFCFAALMCIIPFGTTYFTIVLNISTLQIAER 579

Query: 441 TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLV 500
            +P   +  +G     Y+ K   K   L +    + ++  + +     ++ VW+QY+ L 
Sbjct: 580 LLPLSVAIVVGYFSVCYFWKPQMKNYLLEVVLGGVTLILYIALMGASLSLPVWKQYVCLS 639

Query: 501 IPGFGLSVLITVTLLAMIAAVPHE-HQAATTSIS----YAFRSTGCTLGVSIGGAIFRKS 555
           +P  G ++++T     +++++ HE HQ   + IS    Y F + G T+G+S+GG +F K+
Sbjct: 640 LPLLGSAMILT-----LLSSLYHEYHQPKKSPISGSIVYCFSAMGGTIGISLGGYVFHKT 694

Query: 556 LGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTY 615
           L   +   VMK +   +  ++L KII+ A  SSD++H+SAP+F+ Q LIE Y  ACRN +
Sbjct: 695 LLKAVHDGVMKFSKHGYHEKDLLKIIEHATQSSDWVHESAPKFIFQTLIECYLQACRNVF 754

Query: 616 KF 617
           K 
Sbjct: 755 KL 756

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  145 bits (365), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 132/525 (25%), Positives = 217/525 (41%), Gaps = 32/525 (6%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           +I  ++Y  +FL+  D+T+ ++    I +EFN M   SWI  +YL++S +FQPLYG  SD
Sbjct: 68  LIEAALYTNVFLSGFDSTVTASTYQTIGNEFNHMDLSSWITASYLITSTSFQPLYGSFSD 127

Query: 190 IFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLR 249
           + GR+  L F++++F++GCL CG+S  +  L   R                   D++P  
Sbjct: 128 VLGRRKCLFFASMIFSIGCLGCGISINILWLSFMRAFTGIGGGGLITLSTIVNSDMIPTS 187

Query: 250 NRALYQGICNFFFXXXXXXXXXXXXWFSEHGG------GWRVAFLIQIPLCAISCSLIVA 303
            R ++Q   N                 +  GG      GWR  FL+Q+P+       ++ 
Sbjct: 188 KRGIFQAFQNLLLGLGAICG-------ASFGGVITSSIGWRWCFLLQVPISLAGA--LIG 238

Query: 304 YLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXX----XXXXXXXXXXXXXXXXKELPF 359
           +L +    +    +S E +Q  E L+ ID+                             +
Sbjct: 239 HLYVRNQDEYERRKSKESSQTKEMLKHIDFSGAFLIIIGLTLQLVYLSLGSAADESGNTW 298

Query: 360 QSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTS 419
            S G  A+ VA  +    FV  E   S   I+P   +  R++    +     ++G  + +
Sbjct: 299 SSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLV--RSLFSFLVLTISVLVGFASYA 356

Query: 420 YF--LPVYWAGVLNMKPTDMGKR-TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALA 476
           Y   LP+++  +L       G R  IPS F T +G L AG  M K    + LL    A  
Sbjct: 357 YLFTLPLFFQVILGDSTAKAGLRLAIPSVF-TPVGGLIAGICMSKFNCLQTLLYVGIAFM 415

Query: 477 VVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAF 536
            +G      I  +         L+    G  +    +L   I A     QA  TS  Y F
Sbjct: 416 CLGNFLFLYIGADATDSLIGFFLIPANLGQGITFPSSLFTFIFAFSKIDQATATSTLYLF 475

Query: 537 RSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHD-SA 595
           RS G   GV+    I +      LE+ +  L  ++  R+ + KI      ++ YI +   
Sbjct: 476 RSIGSVWGVTGSAGIVQFCFSHHLEKALEGLLDERKIRKLIKKI----TSNTSYIKELEG 531

Query: 596 PEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTS 640
           P  V+ A+IES+  A +  +    +    AL+ C+    +K  T+
Sbjct: 532 P--VKVAVIESFDTATKKVHLISTSFCLVALILCVIKDVFKPKTT 574

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score =  143 bits (360), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 129/509 (25%), Positives = 220/509 (43%), Gaps = 48/509 (9%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG F++SLD TIV+ ++  +A EF+E     WIAT++LL++  FQPLYGK+SD+
Sbjct: 37  ILTSLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDV 96

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GRK  L+ +     +GCL+  L+  +      R                   DI   + 
Sbjct: 97  TGRKFALLMAYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKE 156

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R +YQG  N  F             F +   GWR  F IQ+P+  +S  L  AY  +   
Sbjct: 157 RGIYQGYANIVFGMGQMLGAPLGGLFIDT-IGWRAIFGIQVPVVMVSAFL--AYRNV--N 211

Query: 311 CKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVA 370
            K S +    +    + L RID+                      +L         + +A
Sbjct: 212 IKLSHVPPISERFTRKNLSRIDFLGSVTLASTICGVLVLCSTDLNKL--------VVSLA 263

Query: 371 IVVGGATFVYVETYVSKDPILPVAFLKNRTILGS--SLANWFSMMGMMTTSYFLPVYWAG 428
                  F++VE + + + ILP   LK    L S  ++ + F + G +  S   P+Y   
Sbjct: 264 TAASFVLFLWVELFYAAERILPFELLKGPFGLSSVVTVCSSFVIFGDIFRS---PIYLQL 320

Query: 429 VLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALA---------VVG 479
           + ++  T+ G   I    S A+GSL  G  +++T K   L      LA         V+ 
Sbjct: 321 IHDLSVTNTGLFMIFPSVSVAVGSLVTGAVLRRTSKSLELCSYLFVLAGIALQLTGLVIS 380

Query: 480 QLQISLIEPNIA----------------VWRQYILL--VIPGFGLSVLITVTLLAMIAAV 521
              + ++EP ++                +W+   +   V+ GFG + L+  TL++++ ++
Sbjct: 381 YYLVGVVEPALSTQMASTLTFQFASQSTLWKLVFVFASVLVGFGYACLLVSTLVSIVFSI 440

Query: 522 PHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKII 581
               QA  T I Y +RS G  LG S+   +F+ SL + L + +++       ++    + 
Sbjct: 441 DKSQQATMTGIFYLWRSIGNVLGASLTLVVFQNSLTTSLRKYMLESHRSFTKKQYYKLLT 500

Query: 582 DSAAHSSDYIHDSAPEFV---RQALIESY 607
           DS+   + +  D+    +   R A + SY
Sbjct: 501 DSSYLRTHFSGDTLLGLLKVYRGAFLTSY 529

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score =  141 bits (356), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 139/562 (24%), Positives = 241/562 (42%), Gaps = 57/562 (10%)

Query: 116 EAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLL 175
           E  +   LS  +  I++ S++LG FL+SLD+TIV+ ++  +A EF E     WIAT++LL
Sbjct: 28  EQYHEYNLSLPKFPILL-SLWLGSFLSSLDSTIVANIMNKVAEEFEESDKKQWIATSFLL 86

Query: 176 SSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXX 235
           ++  FQPLYGK+SDI GRK  ++ S+  F LGC +   +  +      R           
Sbjct: 87  TNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFLTCFAQNITQFSIARAICGIGAGGVN 146

Query: 236 XXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCA 295
                   DI   R R +YQG  N  F             F +   GWRV F +Q+P+  
Sbjct: 147 AMSSITVSDICSTRERGIYQGYANIVFGLGQLLGAPLGGLFID-SVGWRVIFGVQVPMLL 205

Query: 296 ISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXK 355
           +  +L    + +    K + I   ++    + L RID                       
Sbjct: 206 LCSTLATRNINV----KLAHIPPRKERFTWKNLSRIDIFGSLALVGTISSLLFLTSTTLN 261

Query: 356 ELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGS--SLANWFSMM 413
           ++         L ++++     F+++E Y +K+ ILP   LK    L S  ++A+ F + 
Sbjct: 262 KI--------VLTLSMIASFILFIWIELYYAKERILPFDLLKGSFGLCSLVTVASSFVVF 313

Query: 414 GMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK------YKW 467
           G +  S   P+Y   V ++  T  G   +    + A GSL  G+ ++ T K      Y  
Sbjct: 314 GDIFRS---PIYLQLVQDISVTKTGLFLVFPSIAVAGGSLVTGWILRHTKKNLSHCAYGI 370

Query: 468 LLMAFC--------ALAVVGQLQISLIE------------PNIAVWR--QYILLVIPGFG 505
           +L   C        A  ++  L+ +++             PN  +W+    + L++  +G
Sbjct: 371 ILGGVCIQLCGLVIAYYLIKNLKPAMVHIDDSAMAFFTFTPNSIMWKIIYALALILVSYG 430

Query: 506 LSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVM 565
            + L+  TL++++  +    Q   T I Y +RS G  LG S+   I+  SL   L   + 
Sbjct: 431 YASLLVATLVSIVFTIEKSQQGTMTGIFYLWRSIGNVLGASLTLVIYENSLAKKLWNYMF 490

Query: 566 KLASDKH----PREELAKIIDSAAHSSDYIHDSA-PEFVRQALIESYHFACRNTYKFCLA 620
           +  + K      +EE   ++      S Y+  +  P    ++L+  Y  +   +Y   +A
Sbjct: 491 ETNNKKDSYIFSKEEYYTLV----RDSSYLRAANFPALTLRSLLNVYRDSFLISYWPNIA 546

Query: 621 SIFCALL-SCIAVKEYKLHTSM 641
             F  L+ S + V++Y   T +
Sbjct: 547 LAFLGLIVSWVLVRKYPRTTKI 568

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score =  139 bits (349), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 138/549 (25%), Positives = 232/549 (42%), Gaps = 80/549 (14%)

Query: 111 ETSSIEAK-NNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWI 169
           E  ++E + +   LS  ++ I++ S++LG FL+SLD TIV+ ++  +A EF E     WI
Sbjct: 19  EQDALEQEYHEHNLSLPKLPIVL-SLWLGSFLSSLDGTIVANIMNRVAEEFQESDKKQWI 77

Query: 170 ATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXX 229
           AT+YLL++  FQPLYGK+SD+ GRK  ++ ++  F LGCL+   +  +      R     
Sbjct: 78  ATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGV 137

Query: 230 XXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLI 289
                         DI   R R +YQG  N  F             F +   GWR+ F +
Sbjct: 138 GGGGINAMSSITVSDICTQRERGIYQGYANIVFGLGQILGAPIGGLFIDT-LGWRILFGL 196

Query: 290 QIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXX 349
           Q+P   +  SL+   + +    K S +   E+      L RID                 
Sbjct: 197 QVPTILLCSSLVHKNVNI----KLSHLLPVEERFKWSNLSRID----------------- 235

Query: 350 XXXXXKELPFQSNGFYALC----------VAIVVGGATFVYVETYVSKDPILPVAFLKNR 399
                  L F  +G   LC          +  V+    F+ +E Y SK+ I+P   LK  
Sbjct: 236 -ILGSSTLVFTISGVLFLCSTELNKALLSIFTVISFIAFILIELYYSKERIMPFELLKGS 294

Query: 400 TILGS--SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGY 457
             L S  ++ + F + G +  S   P+Y   +  +  T  G   +    S A+GSL  G+
Sbjct: 295 FGLASAATVISSFIIFGDIFRS---PIYLQLIQGVSVTKTGFFMLFPSISVAVGSLATGW 351

Query: 458 YMKKTGKYK------WLLMAFCALAVVGQLQ----ISLIEPNI---AVWRQYI------- 497
            ++ T K K      W++    ++ ++G +     I  +EP++   A++  ++       
Sbjct: 352 ILRHT-KMKLSHCAYWIVTIGMSIQLLGLVVAYYLIQNLEPSLSGSAIFGAFVQIGQNIS 410

Query: 498 ------------LLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGV 545
                        L++  FG + L+  TL+ ++  +P   Q   T I Y +RS G  LG 
Sbjct: 411 SQSYTWVVIYALALILVSFGYACLLVATLVNIVFTIPKSQQGTVTGIFYLWRSIGNVLGA 470

Query: 546 SIGGAIFRKSLGSLLERNVMKLASDKH--PREELAKIIDS-----AAHSSDYIHDSAPEF 598
           S+    + K + S L   +     D +   ++E  K++       + H  D I     + 
Sbjct: 471 SLTLVFYEKGVSSFLWNYMFNKQHDDYNFSKKEYRKLLSDTSYLRSGHFPDGILFELLKV 530

Query: 599 VRQALIESY 607
            R + + SY
Sbjct: 531 YRNSFLLSY 539

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score =  138 bits (348), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 138/516 (26%), Positives = 219/516 (42%), Gaps = 56/516 (10%)

Query: 125 PARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLY 184
           P     I+ S++L   + ++D TI+ST +  IAS F E   ++W+ATAY+L++   QPLY
Sbjct: 44  PNTFPYILLSLWLNTSICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLY 103

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXD 244
           GK SD+ GRK  L+F+ V+F +G ++CG +  +  L+  R                   D
Sbjct: 104 GKTSDLLGRKKCLLFAEVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSD 163

Query: 245 IVPLRNRALYQG----ICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSL 300
           + PL  R++Y G    I  F              WF     G R  F++QIP C  S SL
Sbjct: 164 LAPLSQRSIYWGWGSVIWGFSQSVGGPLGGLLLNWF-----GVRGLFVVQIPFCLFSLSL 218

Query: 301 IVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQ 360
            V Y+             D  NQ     R ID+                           
Sbjct: 219 TVKYIH------------DLSNQTQGTWRDIDFAGSFCLITGISAFIFLCSSSGDVTDDS 266

Query: 361 SNGFYAL-CVAI-VVGGATFVYVETYVSKDPILPVAFLKNRTILGS---SLANWFSMMGM 415
           +   + + C  I V+  + F+YVE  V+   ILP   LK    + S    LA+  S +G+
Sbjct: 267 AVSLFKVGCFLITVLSVSGFIYVEKNVAAKSILPAEVLKGSLGVISFIYGLASMLSYVGL 326

Query: 416 MTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTG---KYKWLL--- 469
                +L + W     +     G   + +  ST++GS G+G+ ++K G   K   LL   
Sbjct: 327 FVVPLYLQLVWG----VSVAGSGGYIMYAVISTSIGSFGSGWLLRKYGAPDKDATLLNSG 382

Query: 470 MAFCALAVVGQLQISLIEPNIAVWRQ--------------YILLVIPGFGLSVLI--TVT 513
           M      ++  L   ++  NI   +               + LL     GLS        
Sbjct: 383 MMLIGSTLINTLGFFVMFKNILEIKPAFEGVKSPSPDQKFWFLLGFAIMGLSAGFQSVSV 442

Query: 514 LLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHP 573
           +L  +A V  + QA++TS+++ FRS G  L VSI  ++F  SL   L+       SD + 
Sbjct: 443 MLYTVAKVGRKGQASSTSVTFLFRSLGNVLSVSISLSVFVASLKGKLKSYFQGQQSDLY- 501

Query: 574 REELAK--IIDSAAHSSDYIHDSAPEFVRQALIESY 607
           R+ L +   + S    SD + D    F + A+++++
Sbjct: 502 RKLLKENAFLRSGEVPSDQLKDLLQVF-KSAIVKAF 536

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score =  137 bits (344), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 128/467 (27%), Positives = 200/467 (42%), Gaps = 56/467 (11%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG F+++LD T+V+ ++  IA+EF E     WIAT+YLL++  FQPLYGK+SDI
Sbjct: 44  ILLSLWLGSFVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDI 103

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GRK  +I ++  FALGCL+   +  +      R                   DI   R 
Sbjct: 104 TGRKVAVITAHFFFALGCLLTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARE 163

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R +YQG  N  F             F     GWR  F IQ+P+  +   L +  + +   
Sbjct: 164 RGVYQGYANVVFGTGQLLGAPIGG-FLLDSIGWRSIFGIQVPMLMLCSVLALKNVNI--- 219

Query: 311 CKGSGIQSDEDNQISEKLRRID-WXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCV 369
            K   I    +    + L RID +                     K L         L +
Sbjct: 220 -KLVHIPPRNERFTWKNLSRIDIFGSISLVATISGILFLTSSNWNKSL---------LGI 269

Query: 370 AIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGV 429
             V+  + F+Y+E YV+K+ I+P   LK    L SS+A   +   +    +  P+Y   +
Sbjct: 270 FTVLSFSLFIYIELYVAKERIMPFELLKGSFGL-SSIATVITSFIIYGEIFRSPIYLQLI 328

Query: 430 LNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV--GQLQ----- 482
            N+  T  G   I    + ALGS+  G  ++ T     + +A CA A++  G +      
Sbjct: 329 QNVSVTVTGLYLIFPSVAIALGSIVTGSILRNTK----MDLAHCAAAIIFGGMIMQLAGL 384

Query: 483 ------ISLIEPNI--------------------AVWRQYIL---LVIPGFGLSVLITVT 513
                 +S + P +                    ++W + +    LVI   G + L+  T
Sbjct: 385 ALSYYLLSHVNPALDLADLPANLFSAATIYFVSDSIWWKIVYVGALVIGSSGYASLLVAT 444

Query: 514 LLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLL 560
           L++++  V    Q   T I Y +RS G  LG SI   +F +SLG +L
Sbjct: 445 LVSIVFTVDRSKQGTITGIFYLWRSIGNVLGASITLVVFERSLGRML 491

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score =  133 bits (335), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 124/461 (26%), Positives = 186/461 (40%), Gaps = 30/461 (6%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFX 226
           +WI TAYL++S +FQPLYG  SD  GR+  L F+N  F +GCL CG S  ++ L   R  
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFMRAL 64

Query: 227 XXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGG----- 281
                            D++P   R ++Q   N                 +  GG     
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICG-------ASFGGTIAST 117

Query: 282 -GWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXX 340
            GWR  FLIQ+P+  IS  L+  Y  +P   + +   S+  N   + L  ID        
Sbjct: 118 IGWRWCFLIQVPISMISSILMNYY--VPNQKEYNDQNSNIFNDPKKILTGIDVMGSILII 175

Query: 341 XXXXXXXXXXXX--XXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKN 398
                             L + S     L    V+    F+  E   +   I+P+  + +
Sbjct: 176 TGLTLQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSS 235

Query: 399 R---TILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKR-TIPSFFSTALGSLG 454
                +L  S+   F+    + T   LP+++  VL       G R TIPS F T +GSL 
Sbjct: 236 SYSFVVLSISILVGFASYAYLFT---LPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLI 291

Query: 455 AGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTL 514
            G+ M K    + LL    +L  +G      IE     W   + L+    G  +    TL
Sbjct: 292 TGFSMSKYNCLRSLLYLGISLMFLGNFLFLFIEETSPNWLISLFLIPANLGQGITFPTTL 351

Query: 515 LAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPR 574
              I   P   QA  TS  Y FRS G   GV+I   + + S  + L  N+  L  +   +
Sbjct: 352 FTFIFMFPKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFANFLCTNLKGLLDENTIK 411

Query: 575 EELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTY 615
           + + K+ D    +S YI     E V+ A+I+S+  A +  +
Sbjct: 412 KLVIKLSD----NSSYIGSLHGE-VKSAVIKSFDAATKRAH 447

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 129/476 (27%), Positives = 190/476 (39%), Gaps = 30/476 (6%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFX 226
           +WI TAYL++S +FQPLYG  SD  GR+  L F+N  F +GCL CG S  ++ L   R  
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAL 64

Query: 227 XXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGG----- 281
                            D++P   R ++Q   N                 +  GG     
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICG-------ASFGGTIASS 117

Query: 282 -GWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXX 340
            GWR  FLIQ+P+  IS  L+  Y  +P   + +   S       + LR ID        
Sbjct: 118 IGWRWCFLIQVPISVISSILMNYY--VPNQKEYNRQNSSIFQNPGKILRDIDVMGSILII 175

Query: 341 XXXXXXXXXXXX--XXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKN 398
                            +L + S     L V  V+    F+  E   S   I+P+  + +
Sbjct: 176 TGLTLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNS 235

Query: 399 R---TILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKR-TIPSFFSTALGSLG 454
                +L  S+   F+    + T   LP+++  VL       G R TIPS F T +GSL 
Sbjct: 236 SYSVVVLSISILVGFASYAYLFT---LPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLI 291

Query: 455 AGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTL 514
            G+ M K    + LL    +L  +G      IE     W   + L+    G  +    TL
Sbjct: 292 TGFSMSKYNCLRLLLYIGISLMFLGNFLFLFIEKTSPNWLIGLFLIPANLGQGITFPTTL 351

Query: 515 LAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPR 574
              I       QA  TS  Y FRS G   GV+I   + + S   LL  N+  L  +    
Sbjct: 352 FTFIFMFSKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFAGLLRSNLKGLLDE---- 407

Query: 575 EELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCI 630
            ++ K+I   + +S YI     E V+  +I+S+  A +  +         AL+ CI
Sbjct: 408 NKIKKLIVQLSANSSYIGSLHGE-VKNTVIKSFDEATKRAHLMSTLLSSLALILCI 462

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score =  134 bits (337), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 128/493 (25%), Positives = 211/493 (42%), Gaps = 59/493 (11%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG FL+SLD+TIV+ ++  +A EF+E     WIAT++LL++  FQPLYGK+SDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GRK  L+ +   F LGCL+   +  +      R                   DI   R 
Sbjct: 98  TGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R +YQG  N  F             F E   GWR  F IQ+P+  +   L +  + +   
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIET-IGWRALFGIQVPVIMLCSVLAIKNINI--- 213

Query: 311 CKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVA 370
            K   +   ++    + L RID                        L   S+    L +A
Sbjct: 214 -KLFHVPPMKERYTLKNLSRID----------IFGSLSLVATISGVLFLCSSQLNKLYLA 262

Query: 371 IVVGGA--TFVYVETYVSKDPILPVAFLKNRTILGSSLA--NWFSMMGMMTTSYFLPVYW 426
           +   G+   F+ VE Y + + ILP   L     L S++   + F + G +  S   P+Y 
Sbjct: 263 LFTIGSFIVFILVERYYATEKILPFELLTRSFCLSSAVTVISSFVVFGEIFRS---PIYL 319

Query: 427 AGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV--GQLQ-- 482
             + N+  T  G   I    S A+GSL  G+ ++ T     + +A CA  ++  G +   
Sbjct: 320 QLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMIMQL 375

Query: 483 ---------ISLIEPNI--------------AVWRQYILL---VIPGFGLSVLITVTLLA 516
                    +S + P+               ++W + I +   V+  FG + L+  TL++
Sbjct: 376 LGLGLGYFLLSHLNPDYTIYDMLESITFRSNSIWWKLIYVFASVLVSFGYACLLVATLVS 435

Query: 517 MIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKH---P 573
           ++  V    Q   T + Y +RS G  LG S+    +  SL S+L   + K   D      
Sbjct: 436 IVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKTKRDDEYHFT 495

Query: 574 REELAKIIDSAAH 586
           +++   +I+ +++
Sbjct: 496 KKQYYSLINDSSY 508

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  132 bits (332), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 123/464 (26%), Positives = 197/464 (42%), Gaps = 56/464 (12%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG FL+SLD+TIV+ ++  +A EF+E     WIAT++LL++  FQPLYGK+SDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GR+P L+ +   F LGCL+   +  +      R                   DI   R 
Sbjct: 98  IGRRPALLTAQFFFGLGCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARE 157

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R +YQG  N  F             F E   GWR  F +Q+P+  +   L +  + +   
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGIFIET-IGWRALFGVQVPMIIVCSILAIKNINI--- 213

Query: 311 CKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVA 370
            K   +   ++    + L RID                        L   S+    + +A
Sbjct: 214 -KLFHVPPMKERYTLKNLSRID----------IFGSLSLVATISGVLFLCSSHMNKIYLA 262

Query: 371 IVVGGA--TFVYVETYVSKDPILPVAFLKNRTILGSSLA--NWFSMMGMMTTSYFLPVYW 426
           +   G+   FV VE Y + + ILP   L     L S++   + F + G +  S   P+Y 
Sbjct: 263 LFTIGSFIVFVLVERYYATERILPFELLTGSFCLSSAVTVISSFVVFGEIFRS---PIYL 319

Query: 427 AGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAV--------- 477
             + N+  T  G   I    S A+GSL  G+ ++ T     + +A CA  +         
Sbjct: 320 QLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----MNLAHCAYQIIFGGMVTQL 375

Query: 478 ------------------VGQLQISLIEPNIAVWRQYILL---VIPGFGLSVLITVTLLA 516
                             V  +  S+   + ++W + I +   V+  FG + L+  TL++
Sbjct: 376 LGLGMGYLLLGHLYPDYTVYDMLESITFKSHSIWWKLIYVFASVLVSFGYACLLVATLVS 435

Query: 517 MIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLL 560
           ++  V    Q   T + Y +RS G  LG S+    +  SL S+L
Sbjct: 436 IVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSML 479

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score =  131 bits (330), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 128/520 (24%), Positives = 217/520 (41%), Gaps = 58/520 (11%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG FL+SLD+TIV+ ++  +A +F+E     WIAT++LL++  FQPLYGK+SDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GRK  L+ +   F LGCL+   +  +      R                   DI   R 
Sbjct: 98  TGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R +YQG  N  F             F E   GWR  F +Q+P+  +   L +  + +   
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIET-IGWRALFGVQVPMIMLCTILAIKNINI--- 213

Query: 311 CKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVA 370
            K   +   ++    + L RID                       +L         L + 
Sbjct: 214 -KLFHVPPMKERYTLKNLSRIDLFGSLSLVATISGVLFLCSSHLNKL--------YLSLF 264

Query: 371 IVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLA--NWFSMMGMMTTSYFLPVYWAG 428
            +     FV VE Y + + ILP   L     L S++   + F + G +  S   P+Y   
Sbjct: 265 TIGSFIVFVLVERYYATERILPFELLTPSFCLSSAVTVISSFVVFGEIFRS---PIYLQL 321

Query: 429 VLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAV----------- 477
           + N+  T  G   I    S A+GSL  G+ ++ T     + +A CA  +           
Sbjct: 322 LQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMVTQLLG 377

Query: 478 ----------------VGQLQISLIEPNIAVWRQYILL---VIPGFGLSVLITVTLLAMI 518
                           V  +  S+   + ++W + I +   V+  FG + L+  TL++++
Sbjct: 378 LGLGYLLLAHLNPDYTVYDMLESITFKSNSIWWKLIYVFASVLVSFGYACLLVATLVSIV 437

Query: 519 AAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKH---PRE 575
             V    Q   T + Y +RS G  LG S+    +  SL S+L   + K   +      ++
Sbjct: 438 FTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKSKREDEYHFSKK 497

Query: 576 ELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTY 615
           +   +ID +++      ++ P++V   +++ Y  A   +Y
Sbjct: 498 QYYSLIDDSSYLRG---NNFPKYVFVRILDVYKKAFLISY 534

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  129 bits (325), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 128/514 (24%), Positives = 218/514 (42%), Gaps = 57/514 (11%)

Query: 109 DLETSSIEAK-NNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHIS 167
           ++ET  +E K +   L+  +  I+  S++LG FL+SLD TIV+ ++  +A EF+E     
Sbjct: 16  EVETLPLEQKFHEYNLALPKFPILF-SLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQ 74

Query: 168 WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXX 227
           WIAT++LL++  FQPLYGK+SDI GRK  L+ ++  F +GCL+   +  +      R   
Sbjct: 75  WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAIC 134

Query: 228 XXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAF 287
                           DI   R R +YQG  N  F             F E   GWR  F
Sbjct: 135 GIGAGGLNAIGSIAVSDICTARERGVYQGYANIVFGLGQLLGAPLGGVFIET-IGWRALF 193

Query: 288 LIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXX 347
            +Q+P+  +   L +  + +    K   +   ++    + L RID               
Sbjct: 194 GVQVPVIMLCSVLAIKNINI----KLFHVPPMKERYTLKNLSRIDIFGSLSLVATISGVL 249

Query: 348 XXXXXXXKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLA 407
                   +L         L +  +     F+ VE Y + + ILP+  L     L S++ 
Sbjct: 250 FLCSSHLNKL--------YLTLFTIGSFIVFILVERYYATEKILPLELLTRSFCLSSAVT 301

Query: 408 --NWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKY 465
             + F + G +  S   P+Y   + N+  T  G   I    S A+GSL  G+ ++ T   
Sbjct: 302 VISSFVVFGEIFRS---PIYLQLLQNISVTKTGLFLIFPSVSVAVGSLVTGWLLRNTK-- 356

Query: 466 KWLLMAFCALAVVGQLQI---------------------------SLIEPNIAVWRQYIL 498
             + +A CA  ++    I                           S+   + ++W + I 
Sbjct: 357 --INLAHCAYQIIFGGMITQLLGLGLGYLLLAYLNPDYTIYDMLESITFESDSIWWKLIY 414

Query: 499 L---VIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKS 555
           +   V+  FG + L+  TL++++  V    Q   T + Y +RS G  LG S+    +  S
Sbjct: 415 VFASVLVSFGYACLLVATLVSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENS 474

Query: 556 LGSLLERNVMKLA-SDKH--PREELAKIIDSAAH 586
           L S+L   + +   SDK+   +++   +I+  ++
Sbjct: 475 LSSMLWNYMFETKRSDKYHFTKKQYYSLINDTSY 508

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score =  128 bits (321), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 120/461 (26%), Positives = 196/461 (42%), Gaps = 53/461 (11%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S+++G FL +LD TIV+ ++  +A EF E     WIAT++LL++  FQPLYGK+SDI
Sbjct: 53  IVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDI 112

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GRK  L+ ++  F LGCL+   +  +      R                   DI   R 
Sbjct: 113 TGRKFALLVAHTFFCLGCLLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDICTARE 172

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R  YQG  N  F             F+    GWR  F +Q+P+  I   +++ Y  +   
Sbjct: 173 RGAYQGYANVVFSTGQLLGAPLGG-FALDRIGWRAIFGLQVPMLLI--CMVLGYRNV--N 227

Query: 311 CKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVA 370
            K + +   E+    + L RID                        L   S       ++
Sbjct: 228 IKLAHVPPLEERFTWKNLSRID----------IGGSITLVCTISGVLFLCSTSLNKAILS 277

Query: 371 IVVGGA--TFVYVETYVSKDPILPVAFLKNRTILGS--SLANWFSMMGMMTTSYFLPVYW 426
           +  G +   F+Y E Y++++ ILP   L     L S  ++ + F + G +  S   P++ 
Sbjct: 278 VFTGLSFMLFMYNELYLARERILPFELLGGSFGLASILTVGSSFVIFGDVFRS---PIFL 334

Query: 427 AGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKT----GKYKWLLMAF------CALA 476
             V N+  T  G   + S  +TA  SL  G+ ++ T     K  +L++ F      C L 
Sbjct: 335 QLVQNISVTKTGGFLLFSSIATAAASLITGWILRNTKMNLAKCSYLIVFFSIFLQLCGLV 394

Query: 477 VVGQL-------QISLIEPNIAVWRQYILL--------------VIPGFGLSVLITVTLL 515
           +   L       Q SL+  N  + R Y+                   G+G + L+  TL+
Sbjct: 395 IAVTLLSYLEPNQTSLMANNTRLKRDYLFKSDSLAWKCVYICASAFTGYGYASLLVSTLV 454

Query: 516 AMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSL 556
           +++  +    QA  T + Y +RS G  LG S+  +++  +L
Sbjct: 455 SIVFTIDKSQQATITGLFYLWRSIGNVLGASLTLSLYEATL 495

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score =  127 bits (320), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 120/462 (25%), Positives = 194/462 (41%), Gaps = 51/462 (11%)

Query: 125 PARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLY 184
           P    +++ S++L   + ++D TI+ST +  +AS F E   ++W+ATAY+L++ + QPLY
Sbjct: 47  PKTFPLVLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLY 106

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXD 244
           GK SD+ GRK  L+F+ V+F +G ++CG++  +  L   R                   D
Sbjct: 107 GKTSDLLGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSD 166

Query: 245 IVPLRNRALYQG----ICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSL 300
           + PL  R++Y G    I  F              WF   G      F+IQ+P C  S  L
Sbjct: 167 LAPLSQRSIYWGLGSLIWGFSQSIGGPLGGLLLNWFGVSG-----LFVIQVPFCLFSLFL 221

Query: 301 IVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQ 360
            V Y+             D  +Q     R ID+                           
Sbjct: 222 TVRYIH------------DLTDQRQGTWRDIDFAGSFCLIIGISAFIFSCSAGDGVDSND 269

Query: 361 SNGFYALCVAIVVGG-ATFVYVETYVSKDPILPVAFLKNRT-ILG--SSLANWFSMMGMM 416
              F  +C+ + +   A FV VE  ++   ILP   LK    ++G    L++  S +G+ 
Sbjct: 270 EGPFKVVCLIVTIAAVAGFVVVEKRMATKSILPAHVLKGSLGVVGLIYGLSSMLSYVGLF 329

Query: 417 TTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTG---------KYKW 467
               +L V W           G   I +  ST++GS  +G+ +++ G             
Sbjct: 330 IVPLYLQVVWG----TSVAGSGGYIIYAVVSTSVGSFSSGWLLRRYGSPTRCTTLFNSGI 385

Query: 468 LLMAFCALAVVGQL----QISLIEPNI-------AVWRQYILL--VIPGFGLSVLITVTL 514
           +L++   + V+G       I  I PN           + + LL  VI G          +
Sbjct: 386 MLVSSTLINVLGFAILFRNILSISPNFENTGGPSGSQKFWFLLGFVIMGCSQGFQNVSVM 445

Query: 515 LAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSL 556
           L  +A V  + QAA+TS+++ FRS G  L VSI  +++  SL
Sbjct: 446 LYTVAKVGRKGQAASTSVTFLFRSLGNVLSVSIALSVYVASL 487

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score =  127 bits (320), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 149/585 (25%), Positives = 236/585 (40%), Gaps = 83/585 (14%)

Query: 101 TVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEF 160
           T ++A   DLE   +  ++N  L    I   + S+++G FL SLD+TIV+ ++  +A EF
Sbjct: 17  TSSSADEDDLE--EMYHRHNLALPKGPI---LYSLWMGSFLGSLDSTIVANIMNKVAEEF 71

Query: 161 NEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCL 220
            E     WI T++LL++  FQPLYGK+SD+ GRK  L+ ++  F +GCL   LS  L   
Sbjct: 72  EESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVGCLFTALSRNLVEF 131

Query: 221 VAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHG 280
              R                   DI   + R +YQG  N  F            W  +  
Sbjct: 132 SIARAVCGMGAGGISALSSISVSDICTPKERGVYQGYANVVFGTGSMLGGPIGGWLMD-S 190

Query: 281 GGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXX 340
            GW+V F  Q+PL  I   + + Y  +    K   +    +    E ++RID        
Sbjct: 191 FGWKVIFAGQVPL--IMTCMFLGYRNV--NIKLLHVPPRHERYRWENIKRID-------- 238

Query: 341 XXXXXXXXXXXXXXKELPFQSNGFYALC----------VAIVVGGATFVYVETYVSKDPI 390
                           L    +GF  LC             ++    F+  E Y + + I
Sbjct: 239 ----------LGGSISLIGTISGFLCLCSTDLNKPLLATLTLLSLVLFIMNELYWAPERI 288

Query: 391 LPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTAL 450
           +P   L   T   +SL   FS        +  PVY   V N+ PT  G   + S  S+AL
Sbjct: 289 IPTDLLSG-TFGITSLLTVFSSFIAFGDVFRNPVYLQLVQNISPTSTGGFLLFSSISSAL 347

Query: 451 GSLGAGYYMKKTG------KYKWLLMAFCALAV---VGQLQISLIEPNIAV--------- 492
            SL  G+ ++ T        Y  + +A C   +   +G   IS +EPN            
Sbjct: 348 ASLATGWILRNTSLGLATCSYLLITIAVCLHFISLSLGYTTISHLEPNPTSHVSALDTSG 407

Query: 493 -----------WR--QYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRST 539
                      WR    I +++  +G + L+  TL++++  +P   QA  T   Y +RS 
Sbjct: 408 TNYWFTSNQFRWRVLYVIAMILNSWGYASLLVATLVSIVFTIPKSQQATITGCFYLWRSI 467

Query: 540 GCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFV 599
           G  LG S    IF  S  + L + +  +  DK          +S  H + ++ +     +
Sbjct: 468 GTVLGASSVLTIFESSATTKLYQYLHPINMDKE--------YESLIHDTSFLRNHFSGKI 519

Query: 600 RQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSMDRQ 644
            + L+E Y+ +   +Y    A    AL     +  +KL  S D++
Sbjct: 520 LRDLLEIYNESFLISYIPTFAVSILAL-----IIAFKLFISCDKE 559

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score =  127 bits (319), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 137/518 (26%), Positives = 211/518 (40%), Gaps = 74/518 (14%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG F+ SLD TIV+ ++  +A EF E     WIAT++LL++  FQPLYGK+SDI
Sbjct: 35  ILTSLWLGSFIGSLDGTIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDI 94

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GR+  L+ ++  F LGCL+   +  +      R                   DI   + 
Sbjct: 95  TGRRFALLTAHFFFGLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTAKE 154

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGG------GWRVAFLIQIPLCAISCSLIVAY 304
           R  YQG  N  F                 GG      GWR  F +Q+P+    CS +   
Sbjct: 155 RGSYQGYANIVFGTGQMLG-------GPIGGLLIDTIGWRAIFAVQVPIIMF-CSFLTY- 205

Query: 305 LELPKGCKGSGIQSDEDNQISEK-----LRRIDWXXXXXXXXXXXXXXXXXXXXXKELPF 359
                  K   I+      +SE+     L RID                       ++  
Sbjct: 206 -------KNITIKLSHIPPVSERFTWMNLSRIDIMGSSSLVVVICGILFICSTNWNKV-- 256

Query: 360 QSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTS 419
                  L    +VG   F+  ETY +K+ ILP+  LK  + L  SL    S        
Sbjct: 257 ------ILSTFTIVGFLFFIVTETYFAKECILPLKLLKGASGL-CSLVTVLSSFITFGEI 309

Query: 420 YFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVG 479
           +  P+Y+  V +M  T  G   +    S A+GS+  G  ++ T   K  L  +C L ++ 
Sbjct: 310 FRAPIYYQVVQDMSVTKTGLFVLFPAVSVAVGSVVTGTALRHT---KLDLGHYCYLIILR 366

Query: 480 QLQISLI------------EPNIAV--------WRQY--------ILLVIPG----FGLS 507
            +   LI            EP I          W Q+        ILLV  G    +G S
Sbjct: 367 SIFTQLIGLLLAYVVINGTEPTIGASSSTFAVHWFQFSSDSIWWKILLVSAGCMVSYGYS 426

Query: 508 VLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKL 567
            L+  TL++++ +V    QA  T I Y +RS G  LG S+   I+  SL   L   +   
Sbjct: 427 GLLVATLVSIVCSVEKSEQATLTGIFYLWRSIGSVLGTSLTLVIYENSLTKSLWGAMFGS 486

Query: 568 ASDK---HPREELAKIIDSAAHSSDYIHDSAPEFVRQA 602
            +D    + ++E   +I  +++   +    + E++ +A
Sbjct: 487 RNDDSYHYTKKEYYNLIGDSSYLRSHFPVQSIEYLLKA 524

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score =  126 bits (316), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 117/465 (25%), Positives = 194/465 (41%), Gaps = 55/465 (11%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG F +SLD+TIV+ ++  +A EF E     WIAT++LL++  FQPLYGK+SDI
Sbjct: 45  ILSSLWLGSFFSSLDSTIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDI 104

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GRK  ++ ++  F LGCL+   +  +      R                   DI   R 
Sbjct: 105 TGRKFAVLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRE 164

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R ++QG  N  F             F +H  GWR  F IQ+P+      L +  + +   
Sbjct: 165 RGIFQGYANIVFGMGQVLGAPLGGLFLDH-IGWRTLFGIQVPMIMFCSYLTITNVNI--- 220

Query: 311 CKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVA 370
            K   +   ++    + L RID                       +L         L + 
Sbjct: 221 -KLLHVPPRKERFTWKNLSRIDIFGSLSLVATISGILFLTSTQLDKL--------LLSLF 271

Query: 371 IVVGGATFVYVETYVSKDPILPVAFLKNRTILGS--SLANWFSMMGMMTTSYFLPVYWAG 428
             +    F+++E Y +K+ ILP   L     L S  ++ + + + G +  S   P+Y   
Sbjct: 272 TFISFGLFMWIELYYAKERILPFDLLNGSFGLCSVVTVISSYVVFGDIFRS---PIYLQL 328

Query: 429 VLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALA------------ 476
           + ++  T  G   I    + A GSL  G+ ++ T K     ++ CA              
Sbjct: 329 IQDISVTKTGLFLIIPSIAMAGGSLVTGWILRNTTKN----LSHCAYGIILSGVIIQLAG 384

Query: 477 -VVGQLQISLIEP---------NIAV---------WRQYIL--LVIPGFGLSVLITVTLL 515
            V+  L I  + P         NIA+         W+   +  L++  +G S ++  TL+
Sbjct: 385 LVIAYLLIGHLNPSLNQLGNVFNIAMENFTSGSRTWKVIFVFSLLLGSYGYSSILVATLV 444

Query: 516 AMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLL 560
           +++  +    Q   T I Y +RS G  LG S+   ++R +L   L
Sbjct: 445 SIVFTIEKSQQGTMTGIFYLWRSIGNVLGASLTLVLYRNTLAKRL 489

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score =  120 bits (301), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 103/349 (29%), Positives = 153/349 (43%), Gaps = 20/349 (5%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG FL+S+D+TIV+ ++  +A EF E     WIAT++LL++  FQPLYGK+SDI
Sbjct: 36  ILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQPLYGKLSDI 95

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GRK  L+ +   F LGC +  LS  +      R                   DI   ++
Sbjct: 96  TGRKFALLTALSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKD 155

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R +YQG  N  F             F     GWR  F IQ+PL  I+  L   Y+ +   
Sbjct: 156 RGIYQGYANIVFGMGQLLGAPVGGLFIAT-IGWRALFWIQVPLVIIAIILGEMYVNI--- 211

Query: 311 CKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVA 370
            K   +    +    + + RID+                          +SN      ++
Sbjct: 212 -KLVHVPPPSERFKWKNISRIDFLGSFTLVSSITCFIILIST-------KSNVILLSLLS 263

Query: 371 IVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVL 430
           ++   A F+YVE YVSKD ILP   LK  +   +S+A   S   +    +  P+Y   V 
Sbjct: 264 VLSFIA-FIYVELYVSKDRILPFELLKG-SFGCNSIATVISSYVIFGEIFRSPIYLQLVQ 321

Query: 431 NMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTG------KYKWLLMAFC 473
           +      G   I    +TA+GSL  G  +K+T        YK +L+  C
Sbjct: 322 DFSVIKTGIFLIFPAITTAIGSLVTGAILKRTKLDLAYCSYKLVLLGLC 370

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score =  115 bits (288), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 119/519 (22%), Positives = 210/519 (40%), Gaps = 59/519 (11%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG FL++LD TIV+ ++  +A +FN      WIAT+YLL++  FQPLYG++SDI
Sbjct: 68  ILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDI 127

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GRK   +     F +G  +   S  L      R                   DI  ++ 
Sbjct: 128 IGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKE 187

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R +YQG  N F+               +   GWR  F  Q+P+ A++  L   YL +   
Sbjct: 188 RGMYQGYANIFYGAGQLIGAPIGGLLIDR-IGWRALFAFQVPMVAVAMFLSFTYLNI--- 243

Query: 311 CKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVA 370
            K + +   E+    + L ++D                        +    NG   + + 
Sbjct: 244 -KLAHLPPKEERYKWKHLSKLDIFGSITLVITIGICI---------VILSDNGLNRMVLG 293

Query: 371 I--VVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAG 428
              ++    F+ +E Y +K  ILP+  L+  +   +SL    S   +    +  P+Y   
Sbjct: 294 AMGLLSFGLFLIIEKYYTKHQILPLKCLQG-SFGYASLTIIISTYVIFGEYFRTPIYLQV 352

Query: 429 VLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTG------KYKWLLMAFCALAVVGQLQ 482
           + N   +  G   +      A GS+  G  +K++        Y+ +  + C    VG L 
Sbjct: 353 IQNFTVSQSGIFLLFPTICVAGGSVLTGRVLKQSKMDLEKCSYQLIFYSVCT-QFVGLLM 411

Query: 483 ISLI------------EPNIA-----------VWRQYILLV--IPGFGLSVLITVTLLAM 517
           ++L+            +P +             W+    +   +  FG + ++  TL+++
Sbjct: 412 LTLLINYLHIFNSNNTKPGVGNIFHELTTVDFSWKIIFCIATSLVTFGYASILVATLVSI 471

Query: 518 IAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPR--- 574
           +  V    Q + T + Y +RS G  LG SI    +  +L S L +  M    ++H     
Sbjct: 472 VHTVEKSQQGSITGLFYLWRSLGNVLGTSITLITYENNLTSKLYK-FMFENPEQHMDYIF 530

Query: 575 --EELAKIIDSAAH-SSDYIHDSAPEFV---RQALIESY 607
             EE   ++ ++ +  S +  D   E +   R A ++SY
Sbjct: 531 TIEEYKALVKNSGYLRSHFSKDVVEELLAVYRNAFVQSY 569

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 126/540 (23%), Positives = 224/540 (41%), Gaps = 68/540 (12%)

Query: 125 PARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLY 184
           P   K ++ S++    L++LD TIVST +  +AS F +   ++W+ATAYLL++   QPLY
Sbjct: 98  PKTFKWVLTSLWTNSALSALDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLY 157

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXD 244
           GKISDI GR+  L+F  ++FA+G  +C  S  +  L   R                   D
Sbjct: 158 GKISDIIGRRKCLLFGEIVFAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSD 217

Query: 245 IVPLRNRALYQG----ICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSL 300
           + PL  R  Y G    +   F             +F   G      F+ QIP C  +  L
Sbjct: 218 MAPLSERGKYWGYGSMLGGVFQSLGGPLGGILLTYFGVSG-----LFIPQIPFCLATLYL 272

Query: 301 IVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQ 360
              Y++            D +       +RID+                          +
Sbjct: 273 SWKYVQ------------DYNQDTKGSWKRIDFGGSICLLVGISSFIFFFSADENPSISE 320

Query: 361 SNGF-------YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMM 413
            +G+       +A+ V   +    F+ VE YV+ + I+P+  LK    L + +    SM+
Sbjct: 321 HSGWSPYKKWSFAIFVLFTI---LFLVVEKYVALENIIPMEVLKGTLGLLAFIQGLVSMI 377

Query: 414 GMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK-YKWLLMAF 472
              T  + +P++   V  +  +  G   +    S ++GSL +G  +KK  K  +   + +
Sbjct: 378 N-YTELFIVPLFLQLVWGISVSTSGAYIVCIVISYSVGSLLSGALIKKVAKPSRESTIYY 436

Query: 473 CALAVVGQLQISLIEPNIAVWRQYILLVIPGFG---------LSVLITVTLLAM------ 517
             +++     IS++        + +    P +G           ++  +TLL +      
Sbjct: 437 SGVSIFYMSLISMV--GYYFLDRAVRYTKPVYGDTKVPESLNFQLIFGITLLGLCQGSQG 494

Query: 518 -------IAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASD 570
                  +A V  + QA++TS+ + FRS G  L VS+   +F  +    L + + K+ + 
Sbjct: 495 VTIMLYNVAKVGRKGQASSTSVQFLFRSLGNVLSVSLAFNVFTNA----LRKTLGKVLAG 550

Query: 571 KHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCI 630
           K+  E  A ++   A   +      P     +++E++H A  +++  C   I+C +LS I
Sbjct: 551 KND-ELFALLLKDNAFLRN---KDMPTDDLDSILEAFHKALVSSFVPC---IWCLILSVI 603

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score =  108 bits (270), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 118/471 (25%), Positives = 195/471 (41%), Gaps = 62/471 (13%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG FL +LD TIV+ ++  IA EF E     WIAT++LL++  FQPLYGK+SD+
Sbjct: 42  ILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDV 101

Query: 191 -FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLR 249
             GRK   + +   F LG +I   +  +     GR                   DI   +
Sbjct: 102 ATGRKGAALVAQFFFCLGLVISCFAQNVTQFAVGRAVCGIGGGGIAAMSSIVVSDICTAK 161

Query: 250 NRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIP---LCAI----SCSLIV 302
            R +YQG  N  F                   GWR  F IQ+P   LC +    + ++ +
Sbjct: 162 ERGMYQGYANIVFGSGQLLGAPLGG-LLITTLGWRAIFAIQVPVTLLCMVLAFRNVNIKL 220

Query: 303 AYLELPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSN 362
           A+L  PK C              + L R+D                       +L     
Sbjct: 221 AHLPPPKECF-----------TLKNLSRLDLLGSCTLVMSISGLLFLFSTTLNKL----- 264

Query: 363 GFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLA--NWFSMMGMMTTSY 420
            + ++  A+  G   FVY E Y + + I+P   L+  + + S+L   + F M G +  S 
Sbjct: 265 -WISIFTAVSFG--LFVYNEYYWATERIIPFELLRGESGVTSALTVLSSFVMFGDVFRS- 320

Query: 421 FLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTG----KYKWLL---MAFC 473
             P+Y   V N+     G   +    + A  S+  G+ +++T     K  +L+   M   
Sbjct: 321 --PIYLQVVQNVSLARSGLFILFGSIACAGSSMLTGWLIRRTNMGLVKCAYLIVLGMIIS 378

Query: 474 ALA--VVGQLQISLIEPNIA------------------VWRQYIL--LVIPGFGLSVLIT 511
            LA   +  + I+ ++PN                    +W+   +   V+  FG   ++ 
Sbjct: 379 QLAGTAINAVLIAKLKPNQTSHALTDSITQQTLQPEGLLWKIIYVSATVLNTFGYGGVLV 438

Query: 512 VTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLER 562
             L++++  VP   QA  T + Y +RS G  LG S+   ++  +L + L +
Sbjct: 439 AVLVSIVFTVPKSQQATLTGVFYLWRSIGNVLGTSVTLTLYDLTLKAKLWK 489

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 116/459 (25%), Positives = 187/459 (40%), Gaps = 53/459 (11%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG FLAS+D +IV+ ++  IA EF+E     W+AT++LL++A FQPLYG+ SDI
Sbjct: 46  ILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDI 105

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GRK  L+ +   F LG L+   +  +      R                   DI   + 
Sbjct: 106 VGRKCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKE 165

Query: 251 RALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKG 310
           R +YQG  N  F               E    WR+ F  Q+   AI   +I+AY  +   
Sbjct: 166 RGMYQGYANVIFGAGQVLGAPVGGLIME-TFNWRIIFAAQV--VAIMICMILAYRNI--N 220

Query: 311 CKGSGIQSDEDNQISEKLRRID-WXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCV 369
            K   I         + L RID +                     + L F         +
Sbjct: 221 LKLLHIPPFHQRFTRKNLSRIDLFGSSMLSCSLVSFLMLFSSGVSRSLWF---------L 271

Query: 370 AIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGV 429
             +V    F   E Y++ + +LP   L+    L + L    S M M    Y +PVY   +
Sbjct: 272 LTLVSLTLFCINERYIATERLLPNGILRGHFGLSALLIVVSSFM-MFAELYRMPVYLQLI 330

Query: 430 LNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKT----GK--YKWLLMAFCALAVVGQL-- 481
            ++  +  G   + +  S++  SL  G+ ++ T    GK  YK + +A   + +VG +  
Sbjct: 331 QDISVSRSGIFLLFASVSSSGASLFTGWLLRTTKQDLGKLVYK-IALASSFIQLVGMMLA 389

Query: 482 --QISLIEPNIAV------------------------WRQY--ILLVIPGFGLSVLITVT 513
               S+ EP+ AV                        WR    + L+   F  + L+   
Sbjct: 390 LFTTSVTEPSQAVHAGWAVFSPRSAGQMHYFKSDSIAWRVLLTVALMCSSFAYASLLVSI 449

Query: 514 LLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIF 552
           L++++       QA    + Y +RS G TLG S+  +++
Sbjct: 450 LVSIVDTTEKSQQATMIGVFYLWRSIGNTLGASVPLSVY 488

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score =  105 bits (262), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 114/461 (24%), Positives = 177/461 (38%), Gaps = 59/461 (12%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           ++ S++    LA+LD TIVST +  IAS+F +   ++W+ATAYLL++   QPLYGKISDI
Sbjct: 62  VLTSIWTNSALAALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDI 121

Query: 191 FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRN 250
            GR+  L+F  V+FALG L+C  +  +  L   R                   DI+PL  
Sbjct: 122 IGRRKCLLFGEVIFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSV 181

Query: 251 RALYQG----ICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLE 306
           RA Y      + + F             WF   G      F  QIP C  S  L   Y+ 
Sbjct: 182 RATYWSYGAILASIFQSLGGPIGGLLLKWFGVGG-----LFTPQIPFCIGSIYLSYKYIH 236

Query: 307 LPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYA 366
                       D         +RID+                          + +G+  
Sbjct: 237 ------------DYKEHARSSWKRIDF-GGSICLLVGISSFIFFFSASDNTTIEDDGWST 283

Query: 367 ----LCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMM-----T 417
                 V ++V    F ++E +V+ + I+P      R IL  +L     + G++     T
Sbjct: 284 PKKWSVVLLIVSIIAFAFIENFVAVECIIP------RVILEGTLGLMVCIHGLVAVINYT 337

Query: 418 TSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAV 477
             + +P++      +  +  G   +     ++ GSL     + +  K       FCA + 
Sbjct: 338 CLFMVPLFLQLNWGVSVSRSGGYIMFIVIFSSAGSLFTSMILNRFSKPTRSSQLFCAASA 397

Query: 478 VGQLQISLIE----------------------PNIAVWRQYILLVIPGFGLSVLITVTLL 515
           +  + I  I                       P    W   + + I GF          +
Sbjct: 398 IFYMSILTIVGYYYMQKAIYYSKPIYGSDTQIPKYDNWSIILGIAILGFCQGSQNVTISI 457

Query: 516 AMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSL 556
             +A V  + QA++TS++  FRS G  L VSI   IF   L
Sbjct: 458 YNVAKVGRKEQASSTSVNLLFRSMGNVLSVSIALNIFTNVL 498

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  102 bits (254), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 115/493 (23%), Positives = 195/493 (39%), Gaps = 52/493 (10%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I+ S++LG FL +LD TIV+ ++  IA EF E     WIAT++LL++  FQPLYGK+SD+
Sbjct: 42  ILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDV 101

Query: 191 -FGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLR 249
             GRK   + +   F LG +I   +  +     GR                   DI   +
Sbjct: 102 ATGRKLATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAK 161

Query: 250 NRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPK 309
            R +YQG  N  F                   GWR  F IQ+P+ A+ C  +        
Sbjct: 162 ERGMYQGYANIVFGSGQLLGAPLGG-LLITTIGWRAIFAIQVPM-ALFCMFLTGR---NV 216

Query: 310 GCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCV 369
             K + + S  +    + L R+D                            +        
Sbjct: 217 NIKLAHLPSRNERFTLKNLSRLDLLGSCTLVLSISGLLFLFSTSMNRTWISA-------- 268

Query: 370 AIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGV 429
             +V  A F+Y E + +K+ I+P   L   + + +SL    S   M    +  P+Y   V
Sbjct: 269 FTIVTFAIFIYNERFWAKERIIPFDLLCGTSGI-TSLLTVLSSFIMFGDVFRSPIYLQIV 327

Query: 430 LNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTG----KYKWLL-MAFCALAVVGQLQIS 484
            N+     G   +    + A  S+  G+ +++T     K  +L+ +    L +VG    +
Sbjct: 328 QNVSLAKSGIFILFGSVACAATSVLTGWIIRRTTMDLVKCTYLIVLVMIFLQLVGTASNA 387

Query: 485 LIEPNIA----------------------VWRQYILL--VIPGFGLSVLITVTLLAMIAA 520
           ++  N+                        W+   +   V+  FG   ++   L++++  
Sbjct: 388 ILIANLIPNNTTYADKDVAIKVALSAKGFTWKVVYVFSTVLNSFGYGGVLVAVLVSIVFT 447

Query: 521 VPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKI 580
           VP   QA  T + Y +RS G  LG SI  A++      L+ ++ +++  + H    L+K 
Sbjct: 448 VPKSQQATLTGVFYLWRSIGNVLGTSITLALY-----DLILKSKLRVFMEAHG---LSKS 499

Query: 581 IDSAAHSSDYIHD 593
                  S Y+ +
Sbjct: 500 YSKLVRDSGYLRN 512

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 100/473 (21%), Positives = 187/473 (39%), Gaps = 51/473 (10%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S+++  FLAS+D TI++ ++  +  EF E   I W+AT++LL+S  FQP+YGK+SD+ GR
Sbjct: 52  SLWMANFLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKLSDVTGR 111

Query: 194 KPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRAL 253
           + +L+ +  +F LGCL+   +  +W    GR                   D+  ++ +++
Sbjct: 112 RFVLVLAYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVKEQSI 171

Query: 254 YQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKG 313
           YQ   +  +              +    GWR  FL Q+P+  I   L +   +L +    
Sbjct: 172 YQSYAHIIYTIGEVLGAPIGG-IALETVGWRAIFLAQVPVLTICIYLTLCDDDLAQ---- 226

Query: 314 SGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVV 373
                     I     R+ W                       L   +   Y + + ++ 
Sbjct: 227 --------QHIPPHGERLTWKNISRMDLSGSILLIISLCGVILLSSATIIEYWMWLLVIA 278

Query: 374 GGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTS-YFLPVYWAGVLNM 432
               F+  E Y   + I+P  F K +  +G +         +  +  Y  P++   V NM
Sbjct: 279 SAGLFIINELYWVSECIIP--FRKLKGAIGLTSLLLLVSSFIEYSELYRTPLFLQLVQNM 336

Query: 433 KPTDMGKRTIPSFFSTALGSLGAGYYMKKT-------------GKYKWLLMAFCALAVV- 478
             +  G   + S  ++A+ +L +G+ ++ T             G     +     + V+ 
Sbjct: 337 STSTTGVVLLFSSAASAVATLLSGWVLRTTRTNLGEASFNHMFGSMTLQVAGLTTILVLI 396

Query: 479 -------GQLQIS--------LIEPNIAVWRQYILLVIPGF--GLSVLITVTLLAMIAAV 521
                    +Q++        ++  + AVW+   +  +     G + L+  TL ++    
Sbjct: 397 HFLNPDQSSIQVTSEHRLAPFMMNSDSAVWKIIYVAALSTVSSGHAGLLVSTLTSIFVHT 456

Query: 522 PHEHQAATTSISYAFRSTGCTLGVSIGGAIFR----KSLGSLLERNVMKLASD 570
               +A  T   Y FR  G  LG S   +++     K L + L+ N MK + D
Sbjct: 457 ETPDRAMFTGAFYLFRYIGSVLGASTALSVYESVLSKRLWNYLDLNNMKDSYD 509

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 89.4 bits (220), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 115/527 (21%), Positives = 207/527 (39%), Gaps = 42/527 (7%)

Query: 139 IFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLI 198
           +F+ +LD  IV T++  + + F +     WI T Y L +A F  L+G++S + G +  +I
Sbjct: 54  MFVTALDVLIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVI 113

Query: 199 FSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGIC 258
              ++F  G LI  L+  +  L++GR                    +V  ++R L   + 
Sbjct: 114 SCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLL 173

Query: 259 NFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGC----KGS 314
           N  F             F+ H   WR  F I +P+  ++ ++ + +   P+G     KGS
Sbjct: 174 NCTFAVASIVGPFLGGAFTTH-VTWRWCFYINLPIGGLAIAIFIFFYN-PEGADLLEKGS 231

Query: 315 ----GIQSDEDNQISEK------LRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSN-- 362
                + S     +S K      L   D                      +  P++S   
Sbjct: 232 QTFKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFTAGWLLFLLALTFGGQTHPWKSGIV 291

Query: 363 ------GFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMM 416
                 G   + ++++     F +++T  +  P+L    +  R IL ++   +FS +   
Sbjct: 292 ISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNANFTGFFSTIAYN 351

Query: 417 TTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALA 476
               +   ++  V        G   IP   ST + S+ +G  +KKTG  K LL+   A+ 
Sbjct: 352 VQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGHIKPLLVFGSAMG 411

Query: 477 VVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQA------ATT 530
           V+G   + L+        Q  +L++PG  L  ++   L+     +     +       TT
Sbjct: 412 VLGSGLMILLNNTSTKHTQIGVLILPGVALGFVLPAALITCHVQLDRTSPSYGADMLETT 471

Query: 531 SISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDY 590
           S++   +S G T+G  +   +F  SL      N MK   + +   E++  +DS A S   
Sbjct: 472 SVNALLKSLGTTVGSILSTMVFSTSL-----HNKMK---NSNILFEVSGELDSIA-SYRL 522

Query: 591 IHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKL 637
            H   P      ++     + RNT+   L S   A L  + V   K+
Sbjct: 523 DHFDGPRSEMGCMLND---SIRNTFWMALGSSVVAFLCSLLVSRRKV 566

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 125/265 (47%), Gaps = 22/265 (8%)

Query: 382 ETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRT 441
           ET  +K+PI+P+ F++N+ I   SL  +F+ M ++T  ++ P Y    LN+   D+ KRT
Sbjct: 444 ETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRT 503

Query: 442 IPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCA-LAVVGQ-LQISLIEPNIA---VWRQY 496
            P F +     +     +       + L+ F   + ++GQ + ++ +  + A   +W+Q 
Sbjct: 504 SPMFLTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQC 563

Query: 497 ILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSL 556
           ++ ++P  G + L+  TL+ +      +     ++ S+A  + G  LG+ I G IF + L
Sbjct: 564 MIGILPILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGL 620

Query: 557 GSLLERNVMKLASDKHPREE--LAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNT 614
              L           H  EE  L KII    ++S+Y  +S+  +    ++ESY       
Sbjct: 621 YDELWV---------HSTEEKGLGKIIRKMINNSEY--ESSSRYYCYEILESYFIVSGYV 669

Query: 615 YKFCLASIFCALLS-CIAVKEYKLH 638
           + F    +  A++S C  +K  + H
Sbjct: 670 FLFSAICLLVAVISFCFTIKNKRHH 694

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 57/126 (45%), Gaps = 8/126 (6%)

Query: 104 TAKTIDLETSS--IEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFN 161
           T + +DLET++  I   N   L+   I +    ++  IF  +L   + +T  +H+    N
Sbjct: 173 TEEVVDLETNNRDISLLNEPQLTAGMIFLFSLLLFTIIFDFTLAMMLSTTSGSHVKQSSN 232

Query: 162 EMPHISWIATAYLLSSATFQPLYGKISDIFGR-KPLLIFSNVMFALGCLICGL-SPGLWC 219
                SWI  +YL++    Q L  ++S  +   K L     ++F +G  I  + +   W 
Sbjct: 233 S----SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWW 288

Query: 220 LVAGRF 225
           +V  RF
Sbjct: 289 IVMARF 294

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 118/553 (21%), Positives = 215/553 (38%), Gaps = 53/553 (9%)

Query: 96  SIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIM----GSMYLGIFLASLDNTIVST 151
           S+    V T+KT   +T   E + N    P    II+    G++ L  FLA+LD  IV+T
Sbjct: 21  SVDSVQVHTSKTDTAQTLEEEVEYNEFGQPLPKGIILWACTGALALANFLAALDIMIVTT 80

Query: 152 LLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIF-GRKPLLIFSNVMFALGCLI 210
           ++  + + F+      WI   Y L +A    L+G+I+  F G K  ++ + V+F +G LI
Sbjct: 81  IINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEIGSLI 140

Query: 211 CGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXX 270
           C L+  +  L+ GR                    +V  R R       +  F        
Sbjct: 141 CALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFGIASVIGP 200

Query: 271 XXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRR 330
                F+ H   WR  F I +P+ A++  +I  ++  P G K   +   +  ++SEK+++
Sbjct: 201 FIGGAFTSH-VTWRWCFWINLPVGAVAL-VIFTWVYNPTGKKQVLLTIHDLKELSEKVKK 258

Query: 331 IDWXXXXXXXXXXXXXXXXXXXXXK------ELPFQSNGF----YALCVAIVVGGATFVY 380
           + +                               F  N F    Y++ +  V+GG   + 
Sbjct: 259 VRFKDLLKHLLFKLDIIEFMLISAGIVCILLAFTFGGNRFKWGSYSIILLFVIGGCLVIV 318

Query: 381 V---------------ETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVY 425
                             Y+   P++    L+ R I  +S+  +F  +G M+ + +   +
Sbjct: 319 ALVYDFVIFPNLQIVKANYIQYQPLISWKNLRIRGIFTASMTTFFFCIGYMSQTVYYVQF 378

Query: 426 WAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISL 485
           +  + N  P       I     T L ++  G+   K G  K + +A   LAV+G   ++L
Sbjct: 379 FQLIYNSSPWKASIHLIAVMIPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIGAGLLTL 438

Query: 486 IEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQA--------ATTSISYAFR 537
           ++ +    +   LL++PG         T++A  A +  + ++        A T+++   +
Sbjct: 439 LDNHSNSAQHIGLLILPGVAFGACNQCTMMA--AQIELDKKSPTFKSDFVAVTTLNSFLK 496

Query: 538 STGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSS-------DY 590
           + G  +G  I  ++F    G  +   + K +     R     II  A H         + 
Sbjct: 497 NCGQAVGSIISASVF----GGAVMNKIGKSSYHSEIRSVDDLIIYRAEHFDGARSVLGNM 552

Query: 591 IHDSAPEFVRQAL 603
           I DS  +    AL
Sbjct: 553 ISDSVKDVFYMAL 565

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 142 ASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSN 201
           A+LD  IV TL   I  +FN+   + W+ T Y LSSA F  L+G+++ + G K  L+ S 
Sbjct: 56  AALDIVIVVTLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSV 115

Query: 202 VMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFF 261
           ++F +G LI  +S  +  L+AGR                    +V  R+R +   +  F 
Sbjct: 116 LIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTSLVSERSRGMVIMVLTFA 175

Query: 262 FXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPL 293
           F              +EH   WR  F I +P+
Sbjct: 176 FVGSNAGGPILGGALNEH-ASWRWCFFINLPI 206

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 117/517 (22%), Positives = 193/517 (37%), Gaps = 75/517 (14%)

Query: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           D  IV TL   I  +F++  +I W+ T Y L++A F  L+G++++I G    L+ S ++F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIF 83

Query: 205 ALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXX 264
            +G LI  LS  +  L++GR                    IV   +R          +  
Sbjct: 84  EVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVI 143

Query: 265 XXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLE-----LPKGCKGSGIQSD 319
                      F+EH   WR  F I +P+ A +  +I+A+       LPK    S I+S 
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPIGAFAL-IILAFCNTSGESLPKVSLLSKIKSI 201

Query: 320 EDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVGGATFV 379
              +  E  +   W                       +   S GF  L + +  GG  F 
Sbjct: 202 MSYKYDEVFKASFWKKAFKVFVFKLDMI--------GVTLSSAGFTLLMLGLSFGGNNFA 253

Query: 380 YVETYV----SKDPILPVAFL----------------------------KNRTILGSSLA 407
           +  + +    +  PIL + F                              N  I  SS+ 
Sbjct: 254 WNSSTIISLFTVGPILLILFCAYDFHFLPLLGLRYENKRTKPLLTWSIASNSGIFTSSVT 313

Query: 408 NWFSMMGMMTTSYFLPVYWAGVLNMKPT----DMGKRTIPSFFSTALGSLGAGYYMKKTG 463
            +FS       S +L   +  VL  KPT     + + +IP+  +T    +   Y   K G
Sbjct: 314 GFFSCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSIPAIIAT----MAIAYLNAKYG 369

Query: 464 KYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLA---MIAA 520
             K  ++      +VG    +LI    +    Y +L  PG     +   TLL+    I +
Sbjct: 370 IIKPAIVFGVLCGIVGSGLFTLINGKSSQSIGYSIL--PGLAFGSIFQATLLSSQVQIKS 427

Query: 521 VPHEHQAATTSISYAFRSTGCTLGVSIGG----AIFRKSLGSLLERNVMKLASDKHPREE 576
              E Q     ++ AF S   +LG + GG     IF  SL     +N M+ +    P  E
Sbjct: 428 DDPEFQNKFIEVT-AFNSFAKSLGFAFGGNMGAMIFTASL-----KNQMRSSHLSLP--E 479

Query: 577 LAKIIDSAAHSSDYIHDSAPEFVRQALIESYH--FAC 611
              +    A+++++ +D +   + Q +  + H  F C
Sbjct: 480 FTSVETLLAYNTEH-YDGSQSLLSQLINTAIHDVFYC 515

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 113/507 (22%), Positives = 190/507 (37%), Gaps = 77/507 (15%)

Query: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           D  IV TL   I  +F++  +I W+ T Y LS+A F  L+G++++I G K  L+ S ++F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVF 83

Query: 205 ALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXX 264
            +G LI  LS  +  L++GR                    IV   +R +        +  
Sbjct: 84  EIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVI 143

Query: 265 XXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQI 324
                      F+EH   WR  F I +P+ A +  +I+A+      C  SG +  +   +
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPIGAFAF-IILAF------CNTSG-EPHQKMWL 194

Query: 325 SEKLRRIDWXXXXXXXXXXXXXXXXXXXXXK----ELPFQSNGFYALCVAIVVGGATFVY 380
             K+++I                       K     +   S GF  L + +  GG  F +
Sbjct: 195 PSKIKKIMNYDYGELLKASFWKNTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPW 254

Query: 381 ----VETYVSKDPILPVAFL----------------------------KNRTILGSSLAN 408
               +  + +  PIL + F                              N  I  SS+  
Sbjct: 255 NSGIIICFFTVGPILLLLFCAYDFHFLSLSGLHYDNKRIKPLLTWNIASNCGIFTSSITG 314

Query: 409 WFSMMGMMTTSYFLPVYWAGVLNMKPT----DMGKRTIPSFFSTALGSLGAGYYMKKTGK 464
           + S       S +L   +  V   KPT     + + +IP+  +T    +   Y   K G 
Sbjct: 315 FLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMIAT----MAIAYLNSKYGI 370

Query: 465 YKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLA---MIAAV 521
            K  ++      +VG    +LI   ++    Y +L  PG     +   TLL+    I + 
Sbjct: 371 IKPAIVFGVLCGIVGSGLFTLINGELSQSIGYSIL--PGIAFGSIFQATLLSSQVQITSD 428

Query: 522 PHEHQAATTSISYAFRSTGCTLGVSIGG----AIFRKSLGSLLERNVMKLA--------- 568
             + Q     ++ AF S   +LG + GG     IF  SL + +  + + +          
Sbjct: 429 DPDFQNKFIEVT-AFNSFAKSLGFAFGGNMGAMIFTASLKNQMRSSQLNIPQFTSVETLL 487

Query: 569 --SDKH---PREELAKIIDSAAHSSDY 590
             S +H   P+  L+K I++A H   Y
Sbjct: 488 AYSTEHYDGPQSSLSKFINTAIHDVFY 514

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 1/189 (0%)

Query: 132 MGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIF 191
           +GS+ L +FLA+LD   VST++  ++ +F +   + W+ T Y L +A    ++G+I+ + 
Sbjct: 46  LGSLVLCLFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLV 105

Query: 192 GRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNR 251
           G K   + + V+F +G L+  L+  +  L+ GR                    +V  RNR
Sbjct: 106 GFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERNR 165

Query: 252 ALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGC 311
            L   + +  F             F+ H   WR  F I +P+  ++  L + +    K  
Sbjct: 166 GLIIAVMSSSFGIASVVGPFLGGAFTTH-VTWRWCFYINLPVGGLAFFLFLTFYNPEKWV 224

Query: 312 KGSGIQSDE 320
                  DE
Sbjct: 225 VNKDTAEDE 233

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 77/166 (46%), Gaps = 1/166 (0%)

Query: 132 MGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIF 191
           +GS+ L +FL++LD  IVST++  ++ +FNE     W+ T Y L +A    ++G+ + I 
Sbjct: 46  LGSLTLALFLSALDILIVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASII 105

Query: 192 GRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNR 251
           G K  ++ S ++F +G L+  L+  +  L+ GR                    +V  R+R
Sbjct: 106 GFKSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERSR 165

Query: 252 ALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAIS 297
            +   + +  F             F+ H   WR  F I +P+  ++
Sbjct: 166 GMAISVLSCSFAVASIVGPFLGGAFTTH-VTWRWCFYINLPIGGLA 210

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 122/549 (22%), Positives = 196/549 (35%), Gaps = 72/549 (13%)

Query: 127 RIKIIMG-SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYG 185
           R++ I+G S++L   +A+LD T       +  S FN    +S +  A  +  A  +P   
Sbjct: 75  RVRWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPFIA 134

Query: 186 KISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDI 245
           KISD+  R        +++ +G +I   SP +   V G                    D 
Sbjct: 135 KISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQSGISLMNMVIIADT 194

Query: 246 VPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEH------GGGWRVA---FLIQIPLCAI 296
             L+ R+        FF            W S +         WR     F I  P+   
Sbjct: 195 TTLKWRS--------FFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPVALT 246

Query: 297 SCSLIVAYLE--------LPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXX 348
              L++AYLE        +P G      +  E  +      R  W               
Sbjct: 247 PAILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLIEIDAFGL 306

Query: 349 XXXXXXKELPFQSNGFYA----------LCVAIVVGGA---TFVYVETYVSKDPILPVAF 395
                   L       Y+          +    VVGG    ++V  E + +  P+LP   
Sbjct: 307 ILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLISYVVFEVFFAPFPLLPKRV 366

Query: 396 LKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNM---------KPTDMGKRTIPSFF 446
           L NRT +   + ++   M    +  F   Y   VLN+           T MG      FF
Sbjct: 367 LMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMGL----CFF 422

Query: 447 STALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQ---LQISLIEPNIAVWRQYILLVIPG 503
               G+L  G++     +YK   +   A+ ++G    +  S  E +  +      LV+  
Sbjct: 423 GVVWGALFRGFH-----RYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIGLVVAALVVTN 477

Query: 504 FGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERN 563
           FG +  +  T +A  AAVPH+  AAT S+   + S G  +G +I  AI+   L   L + 
Sbjct: 478 FGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAIWTDRLPGALSKY 537

Query: 564 VMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIF 623
           V         RE+ A   +S     +    SA    R+  I++Y     N   FC+    
Sbjct: 538 V-------PDREKAAAFFESLTTVWEEPWGSAN---REGAIDAYQEV--NYTLFCMGLGV 585

Query: 624 CALLSCIAV 632
            A++  +A+
Sbjct: 586 SAIMFIVAL 594

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 68/157 (43%), Gaps = 1/157 (0%)

Query: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           D  IV TL   I  +F +   I W+ T Y L +A F  L+G+++ I G K  L FS V+F
Sbjct: 23  DIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIF 82

Query: 205 ALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXX 264
            +G LI  +S  +  ++ GR                    +V  RNR +   +    F  
Sbjct: 83  EIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 265 XXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLI 301
                      F+E+   WR  F I +P+  ++ +++
Sbjct: 143 AFAVGPVIGGAFTEN-VSWRWCFYINLPIGGVALTML 178

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 76/334 (22%), Positives = 122/334 (36%), Gaps = 39/334 (11%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S+ L +FL +LD  I  TL   I   FN+  ++ W+ T Y L +A    L+G+I+ + G 
Sbjct: 12  SLSLTLFLGALDIVICITLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIASLVGL 71

Query: 194 KPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRAL 253
           K  L+ S V+F  G L+  L+  +  L+ GR                    +V  ++RA 
Sbjct: 72  KNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDEKHRAR 131

Query: 254 YQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKG 313
              I    +             F+EH   WR  F I IP+  ++ + I+ +   P G   
Sbjct: 132 VVTILGIAYMLAEGAGPFIGGAFAEH-VSWRWCFFINIPIGGVALA-ILCWGYNPAGRT- 188

Query: 314 SGIQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXX-XKELPFQSNGFYALCVAIV 372
                +  N   +  R+  W                        L   S GF  + +A+ 
Sbjct: 189 ---PINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSSGGFALIMLALT 245

Query: 373 VGGATFVY-------------------------VETYVSKD-------PILPVAFLKNRT 400
            GG  F +                         V  Y+ +        P++P +   N  
Sbjct: 246 FGGNKFAWNSASIICMFTIGIALLGIFMLYDFVVLPYIGRRLENGEAMPLVPWSLACNMP 305

Query: 401 ILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKP 434
           IL SS+A +F+       S +L  Y+  V N  P
Sbjct: 306 ILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGP 339

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 104/480 (21%), Positives = 173/480 (36%), Gaps = 51/480 (10%)

Query: 123 LSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQP 182
           +S   I I+  S++L  ++A+LD T       +  S FN    +S +  A  +  A  +P
Sbjct: 72  MSTKVIWILGLSIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKP 131

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXX 242
              KISD+  R        +++ +G +I   SP +   V G                   
Sbjct: 132 FIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVGQSGISLMNMVII 191

Query: 243 XDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEH------GGGWRVA---FLIQIPL 293
            D   L+ R+        FF            W S +         WR     F I  P+
Sbjct: 192 ADTTTLKWRS--------FFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPV 243

Query: 294 CAISCSLIVAYLE--------LPKGCKGSGIQSDEDNQISEKLRRIDWXXXXXXXXXXXX 345
                 L++AYLE        +P G      +  E  +   +  ++ W            
Sbjct: 244 ALTPAILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKVYWELLKVSLIEIDA 303

Query: 346 XXXXXXXXXKELPFQSNGFYA----------LCVAIVVGGA---TFVYVETYVSKDPILP 392
                      L       Y+          +    VVGG    ++V  E + +  P+LP
Sbjct: 304 FGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGILLISYVVFEVFFAPFPLLP 363

Query: 393 VAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTD---MGKRTIPS--FFS 447
              L NRT +   + ++   M    +  F   Y   VLN+   D   +   T     FF 
Sbjct: 364 KRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTTTMGLCFFG 423

Query: 448 TALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQ---LQISLIEPNIAVWRQYILLVIPGF 504
              G+L  G++     +YK   +   A+ ++G    +  S  + +  +      LV+  F
Sbjct: 424 VVWGALFRGFH-----RYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLVVAALVVTNF 478

Query: 505 GLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNV 564
           G +  +  T +A  AAVPH+  AAT S+   + S G  +G +I  A++   L   L + V
Sbjct: 479 GDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTDQLPGALFKYV 538

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 113/514 (21%), Positives = 180/514 (35%), Gaps = 90/514 (17%)

Query: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           D  IV TL   I  +F++  +I W+ T Y LS+A F  L+G++++I G    L+ S V+F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 205 ALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXX 264
            +G LI  LS  +  L+ GR                    IV    R +        +  
Sbjct: 84  EIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVI 143

Query: 265 XXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSG--------- 315
                      F+EH   WR  F I +P+ A       A++ L   C   G         
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPIGAF------AFISLAFCCASGGKWLSKKWLL 196

Query: 316 --IQSDEDNQISEKLRRIDWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVV 373
             I S    +  E  +   W                       +   S GF  L + +  
Sbjct: 197 SKINSITSYKYYEIFKASFWKKVFQILVFKLDMI--------GIILSSAGFTLLMLGLSF 248

Query: 374 GGATFVY----VETYVSKDPILPVAFL----------------------------KNRTI 401
           GG  F +    + ++ +  PIL + F                              N  I
Sbjct: 249 GGNNFAWNSSIIISFFTLGPILLILFCAYDFHILPLLGVHYKSKYARPLLTWKIASNAGI 308

Query: 402 LGSSLANWFSMMGMMTTSYFLPVYWAGVLN----MKPTDMGKRTIPSFFSTALGSLGAGY 457
             SS+  +FS       S +L   +  VL     +    + + +IP+  +T    +   Y
Sbjct: 309 FTSSITGFFSCFAYELQSAYLVQLYQLVLKRNSMLASIHLWELSIPAMITT----MATAY 364

Query: 458 YMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLL-A 516
              K G  K  ++      +VG    +LI   I+    Y LL  PG     +   TLL +
Sbjct: 365 LNAKYGIIKPAIVFGVLCGIVGSGIFTLINGEISQSIGYSLL--PGIAFGSIFQATLLSS 422

Query: 517 MIAAVPHEHQAATTSI------SYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKL--- 567
            +   P +       I      S+A +S G + G +IG  IF  SL + L  +   L   
Sbjct: 423 QVQITPDDPDFQNKFIEVTAFNSFA-KSLGFSFGGNIGAMIFTASLKNQLRSSNANLPQF 481

Query: 568 -----------ASDKHPREELAKIIDSAAHSSDY 590
                       +   P+  L++ I++A H+  Y
Sbjct: 482 TSIETLLAYRTENYDGPQSLLSQFINTAIHNVFY 515

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 64/117 (54%), Gaps = 3/117 (2%)

Query: 111 ETSSIE--AKNNTGLSPARIKII-MGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHIS 167
           ETS  E   K N  LS   I  + + ++ L +FLA+LD  IVST++  +A +      I 
Sbjct: 40  ETSIPEDNVKKNVELSKGSILYVSLVAVALSLFLAALDVMIVSTIIEEVAKQLGSYSEIG 99

Query: 168 WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
           W+ T Y L +A    ++G+I+   G K  ++F+ V+F +G LI  L+  +  L+ GR
Sbjct: 100 WLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLIGGR 156

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 84/199 (42%), Gaps = 4/199 (2%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S+ L IFLA+LD  IVST++ ++A EF +     WI   Y L SA    ++G+I+ + G 
Sbjct: 60  SLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAVCGF 119

Query: 194 KPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRAL 253
           K  ++ + ++F +G L+  L+  +  L+ GR                    +V    R L
Sbjct: 120 KSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEESKRGL 179

Query: 254 YQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKG 313
                   F             F+ H   WR  F I +P+  ++ +  + +   P G   
Sbjct: 180 LIACMGSAFGIASVVGPFLGGAFTTH-VTWRWCFWINLPIGGLAFAFFILFYN-PHGSDQ 237

Query: 314 S--GIQSDEDNQISEKLRR 330
           +  G  +D   Q+   L+ 
Sbjct: 238 TFVGYVTDFFKQVGGWLKN 256

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 120/281 (42%), Gaps = 18/281 (6%)

Query: 363 GFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFL 422
           G   + +++V     F  ++T  S  P+L    + NR+IL S+   +FS +       + 
Sbjct: 298 GVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVAYNVQMIYS 357

Query: 423 PVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQ 482
             ++  V        G   IP   ST + S+ +G   KKTG  K LL+   A+ V+G   
Sbjct: 358 VQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIKPLLVFGSAMGVLGGGL 417

Query: 483 ISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQA------ATTSISYAF 536
           ++L++       Q  +L++PG  L  ++   L+A    +   + +       TTS++   
Sbjct: 418 MTLLDNKSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKGNPSYGADLLETTSVNALL 477

Query: 537 RSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAP 596
           +S G TLG  +   +F  S+ + ++   + L       EE  ++   A++  D  H   P
Sbjct: 478 KSLGTTLGSILSTMVFSTSMNNKMKHGGLSL-------EEYDRLDGIASYRMD--HFDGP 528

Query: 597 EFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKL 637
              R  +      + +N +   L S   A L  I V + K+
Sbjct: 529 ---RSEMGYILSDSIKNAFWMALGSSAIAFLCSIFVSKRKI 566

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 2/174 (1%)

Query: 139 IFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLI 198
           +F+ +LD  IV T++  +   F +     WI T Y L +A F  L+ ++S + G +  ++
Sbjct: 54  MFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVV 113

Query: 199 FSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGIC 258
              ++F  G LI  L+  +  L+AGR                    +V  ++R L   + 
Sbjct: 114 SCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 173

Query: 259 NFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCK 312
           N  F             F+ H   WR  F I +P+  ++ ++ V +   P+G  
Sbjct: 174 NCTFAVASIVGPFLGGAFTTH-VTWRWCFYINLPIGGLAIAIFVFFYN-PEGVN 225

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 82/186 (44%), Gaps = 2/186 (1%)

Query: 127 RIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGK 186
           ++   +GS+ L +FLA+LD  I+S  +  IA +F +     WI + Y L+ A    L+G+
Sbjct: 116 KLYTTIGSLTLVLFLAALDVLIISASIEVIAEQFKDYSKSGWIVSGYSLTEALLTLLWGR 175

Query: 187 ISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIV 246
            + I G K  L+ S ++F  G LI  +S  +  L+ GR                    + 
Sbjct: 176 FATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTLT 235

Query: 247 PLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLE 306
           P R+R +   + +  +              + H   WR  F I +P+  ++  +++A + 
Sbjct: 236 PDRSRVIIISVLSCSYAVAAVVGPFLGGALTTH-VTWRWCFYINLPIGGLAF-VVLAMVY 293

Query: 307 LPKGCK 312
            P G K
Sbjct: 294 NPSGRK 299

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 100/467 (21%), Positives = 175/467 (37%), Gaps = 57/467 (12%)

Query: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           D  IVST++  +A +F       WI   Y L +A    L+G+I+ I G K  ++ + ++F
Sbjct: 94  DIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIF 153

Query: 205 ALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXX 264
            +G LI G++  +  L+ GR                   ++V  R R L     +  F  
Sbjct: 154 EIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAV 213

Query: 265 XXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSL-IVAYLELPKGCKGSGIQSDEDNQ 323
                      F+ H   WR  F I +P+  ++ +L +V Y    K  +G  I S    +
Sbjct: 214 ASVIGPFLGGAFTTH-ATWRWCFYINLPVGGVAFALFVVFYNPQRKSLEGISILSSLK-E 271

Query: 324 ISEKLRRI-------DWXXXXXXXXXXXXXXXXXXXXXKELPFQSNGFYALCVAIVVGGA 376
               LR+I       +W                      E  F S GF  + +A   GG 
Sbjct: 272 FCNTLRQITVIKNLKNWPTWKSIVYSLVFRFDII-----EFIFCSAGFVLVLLAFTFGGN 326

Query: 377 TFVY-----VETYVSKDPILPVAFLKNRTI-----------LGSSLANW--FSMMGMMT- 417
            + +     +  +V    +L V+ L +  I           L   L  W  FS  G+ T 
Sbjct: 327 QYNWSSASIIVMFVIGIILLIVSLLYDFVIFPRFKAVKENSLYQPLIKWSIFSHPGIFTA 386

Query: 418 --------TSY-----FLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK 464
                   T+Y     ++  ++  V            I +   T + +  +G    K G 
Sbjct: 387 NAALFFECTAYICQTVYIIQFFQLVRGNTAWKAAVHLIATVVPTVITTFSSGIANSKFGL 446

Query: 465 YKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHE 524
            K +       ++VG   ++L++ N +  +   LL++PG G    +  T++   A +  +
Sbjct: 447 VKHVTFIGVVTSLVGAGLLTLLDNNSSSAKHIGLLILPGIGFGATMQSTMIG--AQIQLD 504

Query: 525 HQAAT--------TSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERN 563
            +A T        T+++   +  G  LG  I   +F  S+ + L  N
Sbjct: 505 KKAVTYRSDFIAVTTLNAFLKGAGQALGGIICDTVFSASIVNKLNAN 551

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 88/198 (44%), Gaps = 5/198 (2%)

Query: 109 DLETSSIEAKNNTG----LSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMP 164
           D  ++  E+  + G    LS  ++   MGS+ L +FLA+LD  I+S  +  I+ +FN+  
Sbjct: 17  DRSSAQDESSGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQFNDYS 76

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
              WI + Y L  A    L+G+ + IFG K  L+ S ++F  G LI  +S  +  L+ GR
Sbjct: 77  KSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGR 136

Query: 225 FXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWR 284
                               +   R+R +   + +  +             F+ H   WR
Sbjct: 137 VVAGIGGSGIQSLCFVIASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTH-VTWR 195

Query: 285 VAFLIQIPLCAISCSLIV 302
             F I +P+  ++ +++V
Sbjct: 196 WCFYINLPIGGLAFAVLV 213

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 89/198 (44%), Gaps = 5/198 (2%)

Query: 109 DLETSSIEAKNNTG----LSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMP 164
           D  ++  E+  + G    LS  ++   MGS+ L +FLA+LD  I+S  +  I+ +FN+  
Sbjct: 17  DRSSAQDESSGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQFNDYS 76

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
              WI + Y L  A    L+G+ + IFG K  L+ S ++F  G LI  +S  +  L+ GR
Sbjct: 77  KSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGR 136

Query: 225 FXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWR 284
                               +   R+R +   + +  +             F+ H   WR
Sbjct: 137 VVAGIGGSGIQSLCFVIASTLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTH-VTWR 195

Query: 285 VAFLIQIPLCAISCSLIV 302
             F I +P+ +++ +++V
Sbjct: 196 WCFYINLPIGSLAFAVLV 213

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 47/80 (58%)

Query: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           D  IV T+L  IA +FN    I W+ T Y LS+A F  L+G+ + IFG K  L+ S ++F
Sbjct: 36  DIIIVVTILNTIADKFNAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIF 95

Query: 205 ALGCLICGLSPGLWCLVAGR 224
            +G L+  +S  +  ++ GR
Sbjct: 96  EIGSLVIAVSNSMDMIIGGR 115

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 106/478 (22%), Positives = 169/478 (35%), Gaps = 66/478 (13%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           I+  S+ L  ++A+LD T       +  S FN    +S +  A  +  A  +P   KISD
Sbjct: 80  ILAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPFIAKISD 139

Query: 190 IFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLR 249
           +  R        +++ +G +I   SP +   V G                    D   L+
Sbjct: 140 LSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFIAVGQSGINLMNMVIVADTTSLK 199

Query: 250 NRALYQGICNFFFXXXXXXXXXXXXWFSEH------GGGWRVA---FLIQIPLCAISCSL 300
            R+        F             W S +         WR     F I  P+      L
Sbjct: 200 WRS--------FITSLLSVPYLVTTWISGYIVQNIISSNWRWGYGMFAIITPVALTPAIL 251

Query: 301 IVAYLELPKGCKGS-GIQSDEDNQISEKLRRID----------WXXXXXXXXXXXXXXXX 349
           ++AYLE      G   I SD    ++EK R I           W                
Sbjct: 252 VMAYLEHEANKTGEIPIGSDP---LTEKKREIRESGISGFKGYWQLLKTSLIEIDAFGLI 308

Query: 350 XXXXXKELPFQSNGFYA----------LCVAIVVGGA---TFVYVETYVSKDPILPVAFL 396
                  L       Y+          +    V+GG    ++V  E + +  P+LP   L
Sbjct: 309 LLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLISYVIFEVFFAPFPLLPKRVL 368

Query: 397 KNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNM---------KPTDMGKRTIPSFFS 447
            NRT +   + ++   MG   +  F   Y   VLN+           T MG      FF 
Sbjct: 369 VNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLSNTTTMGL----CFFG 424

Query: 448 TALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQ---LQISLIEPNIAVWRQYILLVIPGF 504
              G L      +   +YK   +   A+ ++G    +  S  + +  +      L++  F
Sbjct: 425 VVWGVL-----FRYFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLIVAALIVTNF 479

Query: 505 GLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSL-GSLLE 561
           G +  +  T +A  AAVPH+  AAT S+   + S G  +G +I  A++   L G+LL+
Sbjct: 480 GDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTNELPGALLK 537

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 81/187 (43%), Gaps = 5/187 (2%)

Query: 111 ETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIA 170
           E  + +AKNN      R+ + + S+ L +F+ +LD  IV T++  +   F +     WI 
Sbjct: 29  ECETSKAKNNN----TRLLLSLFSLGLSMFVTALDVLIVGTIIDTVCKSFGDYTKSGWIV 84

Query: 171 TAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXX 230
           T Y L +A F  L+G+IS   G +  ++   V+F  G LI  L+  +  L+AGR      
Sbjct: 85  TGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSLISALARSMNMLIAGRVVSGVG 144

Query: 231 XXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQ 290
                         +V  ++R L   + N  F             F+ H   WR  F I 
Sbjct: 145 GSGLQTLSLVIGCQLVDEKSRPLVLSLLNCTFAIASIIGPFIGGAFTTH-VTWRWCFYIN 203

Query: 291 IPLCAIS 297
           +P+  ++
Sbjct: 204 LPIGGVA 210

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 107/257 (41%), Gaps = 18/257 (7%)

Query: 389 PILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFST 448
           P+L    +   TI+ S+ + +FS +       +   ++  V        G   IP   ST
Sbjct: 323 PLLCWRLMSQPTIVLSNFSGFFSTVAYNVQMIYSVQFFQLVYGFTAWKAGLHLIPILVST 382

Query: 449 ALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSV 508
            + S+ +G   KKTG  K LL+   A+ V+G   ++L+        Q  +L++PG  L  
Sbjct: 383 VVFSIMSGVLTKKTGHIKPLLVFGSAMGVLGGGLMTLLNNTSTKHTQIGVLILPGVALGF 442

Query: 509 LITVTLLAMIAAVPHEHQA------ATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLER 562
           ++   L+A    +   +          TS++   +S G TLG  +   IF  S+ + ++ 
Sbjct: 443 VLPSALIACHVQLDKSNSRYGADMLEVTSVNALLKSLGTTLGSILSTMIFSTSMYNKMKS 502

Query: 563 NVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASI 622
             M L       EE  K +D  A       D A   +   L +S     +NT+   L S 
Sbjct: 503 RGMSL-------EEYMK-LDGIASYRMSNFDGARSEMGYMLSDS----IKNTFWMALGSS 550

Query: 623 FCALLSCIAVKEYKLHT 639
             A L  + V + K++T
Sbjct: 551 ATAFLCSLFVSKSKVNT 567

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 1/170 (0%)

Query: 128 IKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKI 187
           + + + S+ + +FL +LD  I  TL   I  EFN+  ++ W+   Y L +A F  L+G+I
Sbjct: 6   VIVCVTSLCVTLFLGALDIVICITLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRI 65

Query: 188 SDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVP 247
           + + G K  L+ S V+F  G L+ G +  +  L+  R                    IV 
Sbjct: 66  ASLVGLKCSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTSIVE 125

Query: 248 LRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAIS 297
            ++RA    +    +              +EH   WR  F + +P+  ++
Sbjct: 126 EKHRARVITVLGIAYMLAEGAGPFVGGGLAEH-VSWRWCFYVNLPIGGVA 174

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 68/160 (42%), Gaps = 1/160 (0%)

Query: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           D  IVST++  +A +F     I W+ T Y L +A    ++G+I+   G K  ++F+ V+F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 205 ALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXX 264
            +G LI  L+  +  L+ GR                   ++V   NR +   I +  F  
Sbjct: 152 EVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAI 211

Query: 265 XXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAY 304
                      F+     WR  F I +P+  ++  L + +
Sbjct: 212 ASVVGPFLGGVFTSR-VTWRWCFYINLPIGGLTFFLFLMF 250

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 115/267 (43%), Gaps = 43/267 (16%)

Query: 378 FVYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTD 436
           F   E + ++DP+LP   +K+R +  +  ++     +  M   Y   V    V     + 
Sbjct: 338 FALWEKFFARDPLLPAKLVKDRGVWSAMGISFLIDFIYYMAADYLYTVLIVAVDESVKSA 397

Query: 437 MGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLI 486
               ++ SF ST      A Y  + +    W+++  C+L ++          G+   S I
Sbjct: 398 TRISSLSSFVSTVASPFFALYLTRCSRLKPWIMLG-CSLWMLAMGLLYYFRGGRESHSGI 456

Query: 487 EPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVS 546
              + VW         G G ++      +++ AAV HE+ A  T+ +Y     G  +G +
Sbjct: 457 IGALCVW---------GVGTTLFTYPVTVSVQAAVSHENMATVTAANYTLYRIGSAIGAA 507

Query: 547 IGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSS------DYIHDSAPEFVR 600
           + GAI+ ++L   L +++  +A            + +AA+SS      +Y   + PE  R
Sbjct: 508 VSGAIWTQTLYKQLYKHLQDIA------------LATAAYSSPYTFTTNYAWGTPPE--R 553

Query: 601 QALIESYHFACRNTYKFCLASIFCALL 627
           +A++++Y +  R   +  +A +FC  L
Sbjct: 554 EAVVQAYRYVQR--LETVVALVFCVPL 578

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 80/190 (42%), Gaps = 4/190 (2%)

Query: 132 MGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIF 191
           + S+ L +F+ +LD  IV T++  +A +F       W+ T Y L +A    ++G+ + I 
Sbjct: 40  LASLTLVLFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRFASII 99

Query: 192 GRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNR 251
           G +  LI + ++F  G LI  L+  +  L+ GR                    +V  R+R
Sbjct: 100 GFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSR 159

Query: 252 ALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGC 311
            L   I +  F             F+ H   WR  F I +P+  ++   I+ +L   K  
Sbjct: 160 PLVISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYINLPIGGLA---IIMFLLTYKAE 215

Query: 312 KGSGIQSDED 321
               +Q  +D
Sbjct: 216 NKGILQQIKD 225

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 57/131 (43%), Gaps = 6/131 (4%)

Query: 438 GKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYI 497
           G   IP   +  + ++ +G   KK G  K LL+    L V+G   ++L+        Q  
Sbjct: 373 GLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTSTKSTQIG 432

Query: 498 LLVIPGFGLSVLITVTLLAMIAAVPHEHQAA------TTSISYAFRSTGCTLGVSIGGAI 551
           +L++PGF L   +  +L++    +  +   A       T+ +   +S G TLG  +   +
Sbjct: 433 VLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLGTTLGGVLSTTV 492

Query: 552 FRKSLGSLLER 562
           F  S  + + R
Sbjct: 493 FSASFHNKVSR 503

>TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 66/168 (39%), Gaps = 6/168 (3%)

Query: 468 LLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQA 527
           LL A   L  +G      IE     W   + L+    G  +    TL   I A P   QA
Sbjct: 10  LLYAGVFLMALGNFLFLFIEKGSPNWLVGLFLIPANLGQGITFPATLFTFIFAFPKSRQA 69

Query: 528 ATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHS 587
             TS  Y FRS G   GV++   + +   G  L  N+  L  +    E + KI      +
Sbjct: 70  TATSTLYLFRSIGSVWGVAMSTGVIQLYFGKSLRSNLKDLLDEDKINELVTKI----TSN 125

Query: 588 SDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEY 635
           S YI     E ++  +I+    A + T+         AL  C+ +KE+
Sbjct: 126 SSYIEKLHGE-LKDVVIDVLILARKKTHLLSTILSLLALAFCV-IKEF 171

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%)

Query: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           D  IVST++  +A +F     I W+ T Y L +A    ++G+I+   G K  ++F+ V+F
Sbjct: 83  DIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIF 142

Query: 205 ALGCLICGLSPGLWCLVAGR 224
            +G LI  L+  +  L+ GR
Sbjct: 143 EIGSLISALANSMSMLIGGR 162

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 5/120 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMP---- 164
           D + +S+    N G+SP  I I+     +  FL   D   +S+ L  I ++ +  P    
Sbjct: 115 DEDDTSVIINFNQGISPF-IVILTFVASISGFLFGYDTGYISSALISIGNDLDNRPLTYG 173

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
              +I  A  L +       G  +D+FGRKP L+FSN+MF +G ++   +   W + AGR
Sbjct: 174 DKEFITAATSLGALISSIFAGTAADVFGRKPCLMFSNLMFVVGAIVQITAHKFWQMTAGR 233

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 91/208 (43%), Gaps = 18/208 (8%)

Query: 429 VLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEP 488
           VL     + G   IP   ++ L ++  G + KKTG  K++++A  AL ++G    +L++ 
Sbjct: 402 VLGYTAWNAGLHLIPLVIASLLSAIFCGGFTKKTGHVKYVMIANIALLLIGSGVCTLLDN 461

Query: 489 ------NIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSIS--YAFRSTG 540
                  I VW      ++PGFGL   +   L++    +      A T +    AF S  
Sbjct: 462 YSNNSMQIGVW------ILPGFGLGATLQCALISSQLQIDKNSPDAKTELVEITAFNSFC 515

Query: 541 CTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVR 600
            +LG SIG  +   +  S L R + K   + +  +++ +++     + D     A E + 
Sbjct: 516 KSLGSSIGAVLSTTTFISALWRKINKAKLEGYYGKKINELVKYRLQNFDGKSTEAAE-IF 574

Query: 601 QALIESYHFACRNTYKFCLASIFCALLS 628
            A +    + C   Y F   + FCA LS
Sbjct: 575 SAAVTYVFWMC---YAFSALAFFCACLS 599

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 82/203 (40%), Gaps = 4/203 (1%)

Query: 94  YDSIKKNTVATAKTIDLE---TSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVS 150
           Y+  K    A    +DL+   TS  E   ++ ++  R+ + + ++ L   + +LD  IV+
Sbjct: 37  YEDKKAGEDAEDVPVDLKNVFTSDNEKTQSSIMAGMRLYVCLFALVLAQLIVALDVFIVN 96

Query: 151 TLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
           T++  ++          W+ T Y L ++    ++G+ + + G +  ++ S  +F +G ++
Sbjct: 97  TVIDVVSKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLISIFIFEVGSIV 156

Query: 211 CGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXX 270
              +  +  LV GR                    +V  RNR +   +    F        
Sbjct: 157 SATATSMNNLVVGRVVAGIGGSGLQTVSMIIGCSLVEERNRTIVIAVIMSAFAVSSLIGP 216

Query: 271 XXXXWFSEHGGGWRVAFLIQIPL 293
                F+ H   WR  F I +P+
Sbjct: 217 FIGGAFTTH-ATWRWCFWISLPV 238

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 110/257 (42%), Gaps = 32/257 (12%)

Query: 382 ETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKR 440
           E   ++DPI+P   +K+R +  S +++     +  M   Y   V   GV     +     
Sbjct: 358 EYKFARDPIIPYKLVKDRGVWASFAISFLIDFIYYMAADYLYTVLIVGVNESVKSATRIS 417

Query: 441 TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLIEPNI 490
           ++ +F ST +GS      + +  + K  ++  C L ++          G    S I   +
Sbjct: 418 SLSTFVST-VGSPIFSLLITRFSRLKPFIICGCGLWMLAMGLLYHYRGGAESHSGIIGAL 476

Query: 491 AVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGA 550
            VW         G G ++      +++ AA  HEH A  T+++Y F   G  +G ++ GA
Sbjct: 477 CVW---------GVGTTLFTYPVNVSVQAATSHEHMATVTALNYTFYRIGSAVGAAVSGA 527

Query: 551 IFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFA 610
           I+ ++L   L + V   A          K I +      Y  D+ PE  RQA++++Y + 
Sbjct: 528 IWTQTLYKQLLKRVGDAALATEAYASPYKFIVT------YTWDT-PE--RQAVVQAYRYV 578

Query: 611 CRNTYKFCLASIFCALL 627
            R   +  +A +FCA L
Sbjct: 579 QR--LETIVALVFCAPL 593

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 44/112 (39%)

Query: 144 LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVM 203
           LD         +  S + +   +S I     + SA  Q +Y ++SD++GR  L   S V+
Sbjct: 107 LDGNTRYIYTGYATSSYAQHSLLSTINVINAVISAASQIVYARLSDVYGRFALFCVSIVL 166

Query: 204 FALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQ 255
           +++G +I   +  +    AG                    D   LR R +YQ
Sbjct: 167 YSVGTIIQSQAYDVQRYAAGSIFYNTGYVGVILVLLLILSDFSSLRWRLVYQ 218

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 66/141 (46%), Gaps = 6/141 (4%)

Query: 90  NASGYDSIKKNTVATAKTI-DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTI 148
           + SG  S + N     K + D + +S+    N G+SP  I +   +   G F+   D   
Sbjct: 81  DRSGKKSFEINDRIVIKPVNDEDNTSVIINFNQGISPFIIILTFVTSISG-FMFGYDTGY 139

Query: 149 VSTLLAHIASEFNEMP----HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           +ST L  I ++ +       +  +I  A  L +       G  +DIFGRKP ++ SN+MF
Sbjct: 140 ISTALISIGTDLDHKELTYGNKEFITAATSLGALISSIFAGISADIFGRKPCILLSNLMF 199

Query: 205 ALGCLICGLSPGLWCLVAGRF 225
            +G +I   +   W +V GRF
Sbjct: 200 LIGAIIQVTAHTFWQMVVGRF 220

>CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103w ITR2 myo-inositol permease minor
          Length = 570

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 13/148 (8%)

Query: 88  QTNASGYDSIKK----NTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLAS 143
           +  +  YD  K+    N V      D +  S+    N G+S   I +   +   G FL  
Sbjct: 30  ENKSESYDDNKEFEGSNRVVIKPVNDEDDVSVMINFNQGVSHFIIMLTFVASLSG-FLFG 88

Query: 144 LDNTIVSTLLAHIASEFNEMP------HISWIATAYLLSSATFQPLYGKISDIFGRKPLL 197
            D   +S+ L  I ++ +          I+  AT+  L +  F  + G   DIFGRKP L
Sbjct: 89  YDTGYISSALISIGTDLDNKELTYGEKEITTAATS--LGALIFALVAGFSVDIFGRKPCL 146

Query: 198 IFSNVMFALGCLICGLSPGLWCLVAGRF 225
           +FSN+MF +G ++   +   W + AGRF
Sbjct: 147 MFSNIMFLIGAILQVTAHKFWQMTAGRF 174

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 85/200 (42%), Gaps = 4/200 (2%)

Query: 104 TAKTIDLETSSIEAKNNTG---LSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEF 160
           TA    ++ ++ +  +N+    +S  R+ + + ++ L  F+ +LD  IV+T++  +++  
Sbjct: 30  TADNASIDANTPDHNDNSNVRLMSGLRLYVCVAALVLATFIFALDVFIVNTIIDSVSASL 89

Query: 161 NEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCL 220
                  W+   Y L ++ F  ++G+ + + G +  +  S  +F +G ++   +  +  L
Sbjct: 90  GGYSKSGWLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNL 149

Query: 221 VAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHG 280
           + GR                    IV  +NRA+   I    F             F+ H 
Sbjct: 150 IVGRVIAGVGGSGLQTLSLVIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTH- 208

Query: 281 GGWRVAFLIQIPLCAISCSL 300
             WR  F I +P+ A++  L
Sbjct: 209 VIWRWCFWINLPIGAVTALL 228

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 86/185 (46%), Gaps = 8/185 (4%)

Query: 389 PILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFST 448
           P+L    L NR IL  +L    S +       +   ++  V+     + G   IP   ++
Sbjct: 345 PMLVKGLLNNRFILLPNLVTCASAIAFSGYMLYSVQFFQLVMGSSAWNAGLHLIPLVIAS 404

Query: 449 ALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSV 508
            + ++  G  MKKTG+ K L+++  ++ ++G    +L++ +     Q  + ++PGFGL  
Sbjct: 405 IVSAIICGGIMKKTGQVKPLMISTVSILLIGGGVSTLLDNHSGNSMQIGVWILPGFGLGA 464

Query: 509 LITVTLLAMIAAVPHEHQAATTSI--SYAFRSTGCTLGVSIGG----AIFRKSLGSLLER 562
            +   L++    +  E   +   +    AF S   +LG SIGG    AIF  SL S  + 
Sbjct: 465 ALQCALISSQLQIDKESPNSEIELVEVTAFNSFTKSLGSSIGGVLCTAIFTSSLWS--KI 522

Query: 563 NVMKL 567
           N +KL
Sbjct: 523 NAVKL 527

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 85/201 (42%), Gaps = 9/201 (4%)

Query: 132 MGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIF 191
           + S+ L +F+ +LD  IV T++  +A +F       W+ T Y L +A    L+G+ + I 
Sbjct: 48  LASLTLVLFITALDILIVGTIIDVVAKQFGNYSKTGWLVTGYSLPNAVLSLLWGRFASII 107

Query: 192 GRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNR 251
           G +  LI + ++F  G L+  L+  +  L+ GR                    +V  R+R
Sbjct: 108 GFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVDERSR 167

Query: 252 ALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGC 311
            L   I +  F             F+ H   WR  F I +P+  ++   ++ +L L    
Sbjct: 168 PLVISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYINLPIGGLA---VIMFL-LTYDA 222

Query: 312 KGSGIQSDEDNQISEKLRRID 332
           K  GI      Q+   LR+I 
Sbjct: 223 KNDGII----QQMKGALRKIS 239

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 72/161 (44%), Gaps = 6/161 (3%)

Query: 438 GKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYI 497
           G   IP   +  + ++ +G   KK G  K LL+    L V+G   ++L++ N     Q  
Sbjct: 381 GLHLIPIVITNVIAAIASGIITKKLGLVKPLLIFGGFLGVIGAGLMTLMKNNSTSSTQIG 440

Query: 498 LLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISY----AFRSTGCTLGVSIGGAIFR 553
           +L++PGF L   +  +L++  A +        T + +    AF +   +LG ++GG +  
Sbjct: 441 VLILPGFSLGFALQASLMS--AQLQINKDRPETPMDFIEITAFNTFMKSLGTTLGGVLST 498

Query: 554 KSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDS 594
               + L   V  +  + +  + + ++I    H+ D  H +
Sbjct: 499 TVFSTSLHNKVSHVHLEPYAGKTVDEMILYRLHNFDGAHST 539

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 111/260 (42%), Gaps = 31/260 (11%)

Query: 382 ETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKR 440
           E + ++DP++P A +K+R +  S  ++     +  M + Y   V    V     +     
Sbjct: 337 EYFFARDPLIPYALIKDRGVWASMGISFLIDFIFYMASDYLYTVLIVAVHESVKSATRIS 396

Query: 441 TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLIEPNI 490
           ++ SF ST      A   + +  + K  +M  C+L ++          G+   S I   +
Sbjct: 397 SLSSFVSTVASPFFA-LLLTRCSRLKPFIMVGCSLWMLSMGLLYHFRGGEQSHSGIIGAL 455

Query: 491 AVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGA 550
            VW         G G ++      +++ +A  HE+ A  T+I+Y     G  +G ++ GA
Sbjct: 456 CVW---------GIGTTLFTYPVNVSVQSATSHENMATVTAINYTCYRLGSAIGAAVSGA 506

Query: 551 IFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEF---VRQALIESY 607
           I+ + L   + + V ++          A  I + A+SS Y   +   +   VR A++ESY
Sbjct: 507 IWTQKLYPDILKRVTEVVGATE-----AVTIATEAYSSPYTFITKYTWGTPVRDAVVESY 561

Query: 608 HFACRNTYKFCLASIFCALL 627
            +  R   +  +A +FC  L
Sbjct: 562 RYIQR--LETIVALVFCVPL 579

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%)

Query: 144 LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVM 203
           LD  I      +  S + E   +S +     + SA  Q +Y ++SD FGR  L + + V+
Sbjct: 86  LDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFGRFILFVIAIVL 145

Query: 204 FALGCLI 210
           + +G +I
Sbjct: 146 YVVGTII 152

>KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3.84
           YDR497C
          Length = 618

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 81/203 (39%), Gaps = 6/203 (2%)

Query: 88  QTNASGYD-SIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDN 146
           ++ + G D ++ K+ +      D + +S+    N G+SP  I +   +   G FL   D 
Sbjct: 80  RSGSEGSDGALDKDRIEIKPVNDEDDTSVMITFNQGVSPFIITLTFVASISG-FLFGYDT 138

Query: 147 TIVSTLLAHIASEFN----EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNV 202
             +S+ L  I ++ +       +   +  A  L +     + G  +D++GRKP ++FSN+
Sbjct: 139 GYISSALISIGTDLDGRVLTYGNKEIVTAATSLGALISSTMAGTAADMYGRKPCIMFSNI 198

Query: 203 MFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFF 262
           MF +G ++   +   W + AGR                   +I P   R     I + + 
Sbjct: 199 MFLVGAILQVSAHKFWQMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWL 258

Query: 263 XXXXXXXXXXXXWFSEHGGGWRV 285
                        F+    GWR+
Sbjct: 259 TGGQLIAYGLGAAFNHVNNGWRI 281

>NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa]
           {ON} Anc_3.84
          Length = 602

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 73/167 (43%), Gaps = 9/167 (5%)

Query: 65  PTSDLPGFVAGXXXXXXXXXXXXQTNASGYDSIKKNT--VATAKTIDLETSSIEAKNNTG 122
           PT+D   F+               T +  Y++   N   +      D + +S+    N  
Sbjct: 34  PTTDYEEFLNEQEESTKKMKNKQTTTSFDYENASDNDDRIQIKPVNDEDNTSVIITFNQK 93

Query: 123 LSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISW----IATAYLLSSA 178
           +SP  I +   +   G F+   D   +S+ L  I ++ +    +S+    I TA     A
Sbjct: 94  ISPFIITLTFVASISG-FMFGYDTGYISSALISIGTDLDN-KVLSYGDKEIVTAATSLGA 151

Query: 179 TFQPLY-GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
               ++ G  +D+FGRKP L+FSNVMF +G ++   +   W + AGR
Sbjct: 152 LISSIFAGTAADVFGRKPCLMFSNVMFIIGAILQISAHKFWQMAAGR 198

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 4/197 (2%)

Query: 98  KKNTVATAKTIDLETS-SIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHI 156
           K ++ A  K  D +T  ++ + +  G     + + + S+ L +F+ +LD  IV T++  +
Sbjct: 5   KNSSQAEVKAYDSDTELNVNSSDERG--GISLYLCLTSLTLVLFITALDILIVGTIIDVV 62

Query: 157 ASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPG 216
           A +F       W+ T Y L +A    ++G+ + I G +  LI + ++F  G L+  L+  
Sbjct: 63  AEQFGNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLVAALANS 122

Query: 217 LWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWF 276
           +  L+ GR                    +V  R+R L   I +  F             F
Sbjct: 123 MNMLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAIVGPIIGGAF 182

Query: 277 SEHGGGWRVAFLIQIPL 293
           + H   WR  F I +P+
Sbjct: 183 TTH-VTWRWCFYINLPI 198

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 65/149 (43%), Gaps = 10/149 (6%)

Query: 438 GKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYI 497
           G   IP   +  + ++ +G   KK G  K LL+    L V+G   ++L+  N     Q  
Sbjct: 371 GLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGILGVIGAGLMTLMSNNSTSSTQIG 430

Query: 498 LLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSI--SYAFRSTGCTLGVSIGGAIFRKS 555
           +L++PG  L   +  +L++    +  +   ATT      AF +   +LG ++GG +    
Sbjct: 431 VLILPGLSLGFALQASLMSAQLQIKKDRPEATTDFIEITAFNTFMKSLGTTLGGVLSTTV 490

Query: 556 LGSLLERNVMKLASDKHPREEL--AKIID 582
             + L   V      KH + E+   K +D
Sbjct: 491 FSASLRNKV------KHAQLEMYVGKTVD 513

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 10/70 (14%)

Query: 544 GVSIGGA------IFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPE 597
           GV+I GA        RKSL + LE    +L S++HP+E+L +I+  A  SS +I  SAPE
Sbjct: 582 GVAITGASILFNVALRKSLWTALE----QLVSEEHPQEQLQQILHRALESSHWIQHSAPE 637

Query: 598 FVRQALIESY 607
           F ++ +  S+
Sbjct: 638 FAQETIYASF 647

>TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa]
           {ON} Anc_3.84 YDR497C
          Length = 638

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 64/134 (47%), Gaps = 7/134 (5%)

Query: 96  SIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAH 155
           S++ + +      D + +SI    N  +SP  I +   +   G F+   D   +S+ L  
Sbjct: 106 SLESDRIMIKPINDEDDTSIMITFNQKISPFIIILTFVASISG-FMFGYDTGYISSALLS 164

Query: 156 IASEFNEMPHISWIATAYLLSSATFQPLY-----GKISDIFGRKPLLIFSNVMFALGCLI 210
           I  + +    +++    Y+ ++ +   L      G  +D+FGRKP L+FSNVMF +G ++
Sbjct: 165 INKDLDN-KILTYGEKEYITAATSLGALITSIGAGTAADVFGRKPCLMFSNVMFVVGAIL 223

Query: 211 CGLSPGLWCLVAGR 224
              S   W + AGR
Sbjct: 224 QISSHTFWQMCAGR 237

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/260 (23%), Positives = 109/260 (41%), Gaps = 38/260 (14%)

Query: 382 ETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKR 440
           E  V++DPI+P   +K+R +  S  ++     +  M   Y   V    V     +     
Sbjct: 346 EYRVARDPIIPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMLVAVNESIKSATRIS 405

Query: 441 TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLIEPNI 490
           T+ SF S  + S   G  M +  + K  +M  C L ++          G+   S I   +
Sbjct: 406 TLSSFVS-VVASPFFGLIMTRCTRLKPFIMFGCCLWMLAMGLLYRYRGGRESHSGIIGAL 464

Query: 491 AVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGA 550
            VW         G G ++      +++ +AV HE+ A  T+++Y     G  +G ++ GA
Sbjct: 465 CVW---------GLGTTLFTYPVTVSVQSAVSHENLATVTALNYTLYRIGSAVGAAVSGA 515

Query: 551 IFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEF---VRQALIESY 607
           I+ ++    L + ++K   D          + +AA++S Y       +    R AL+ +Y
Sbjct: 516 IWTQT----LYKQILKRMGD--------VTLATAAYTSPYTFIETYTWGTPQRVALVNAY 563

Query: 608 HFACRNTYKFCLASIFCALL 627
            +  R   +  +A +FCA L
Sbjct: 564 KYVQR--LETIVALVFCAPL 581

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 46/112 (41%)

Query: 144 LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVM 203
           LD  I      +  S ++E   +S I     + SA  Q +Y ++SD+FGR  L I + ++
Sbjct: 95  LDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVIL 154

Query: 204 FALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQ 255
           + +G +I   +  +    AG                    D   L+ R LYQ
Sbjct: 155 YVVGTIIQSQAYDVQRYAAGSIFYNAGYVGVILILLIILSDFSSLKWRLLYQ 206

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 112/267 (41%), Gaps = 55/267 (20%)

Query: 371 IVVGGA---TFVYVETYVSKDPILPVAFLKNRTI---LGSSLANWFSMMGMMTTSYFLPV 424
           +V GG     FV+ ET  +K+P+LP   L +R I   LG +  N+F+    +   +  PV
Sbjct: 307 LVFGGVLFCIFVFWETAYAKNPLLPFKLLGDRGIWAPLGVAFFNYFTFF--IACDFLYPV 364

Query: 425 YWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQIS 484
               +     T      +P F    L     G  + K  + K+ ++  CA  ++      
Sbjct: 365 LLVSMNESSTTATRILNLPDFVGATLSPF-YGILVAKARRLKFSVVGGCAAWMI------ 417

Query: 485 LIEPNIAVWRQY--------------ILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATT 530
               ++ ++ QY              +++ + G   S  + V+L AM     H   A  T
Sbjct: 418 ----SMGLFYQYRGGSESHGGAIAASVIMGMSGLLCSNSVIVSLQAMTT---HGRMAVIT 470

Query: 531 SISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDY 590
           SI + F   G  +G S+ GA++ + + + L +     ++D          +  AA+ S Y
Sbjct: 471 SIYFTFSKVGAAVGASVSGAVWTQIMPNQLRK---AFSNDT---------LADAAYESPY 518

Query: 591 --IHD---SAPEFVRQALIESYHFACR 612
             I++    +PE  R A++E+Y +  R
Sbjct: 519 TFIYEYPWGSPE--RIAVVEAYRYVQR 543

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 57/132 (43%)

Query: 124 SPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPL 183
           +P    +++ + +L  F  SLD+T+ ST   +  + + E   +S I     + S   Q +
Sbjct: 50  TPKYRALMIATAFLCGFGYSLDHTLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVV 109

Query: 184 YGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXX 243
           + ++SD FGR  L + + +++ +G ++   +  +    AG                    
Sbjct: 110 FSRLSDYFGRVELFVAATILYVIGTIVQSQAYSVSIYAAGAVFYNSGNVGVTLVLLLILS 169

Query: 244 DIVPLRNRALYQ 255
           D   L+ R LYQ
Sbjct: 170 DFSSLKWRILYQ 181

>NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84
          Length = 607

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 59/134 (44%), Gaps = 5/134 (3%)

Query: 95  DSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLA 154
           D  + + +      D + +S+    N G+S   I +   +   G F+   D   +S+ L 
Sbjct: 78  DENENDRIVIKPVNDEDDTSVIITFNQGISAFIITLTFVASISG-FMFGYDTGYISSALV 136

Query: 155 HIASEFNE----MPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
            I ++ +           I  A  L +     + G  +DIFGR+P L+FSNVMF +G ++
Sbjct: 137 SIGTDLDNKVLSYGDKEIITAATSLGALITSTMAGTAADIFGRRPCLMFSNVMFVIGAIL 196

Query: 211 CGLSPGLWCLVAGR 224
              +   W +  GR
Sbjct: 197 QITAHKFWQMAVGR 210

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 108/257 (42%), Gaps = 30/257 (11%)

Query: 369 VAIVVGGA----TFVYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLP 423
           +A +V G      F+Y E   +K P+LP   L +R I     +  +      ++  Y  P
Sbjct: 309 IATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGIWAPLGVTFFNFFTFFISCDYLYP 368

Query: 424 VYWAGVLNMKPTDMGKRTIPSF--FSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQL 481
           V    +++MK +      I +   F  A  S      + KT K K  ++  CA  +V   
Sbjct: 369 VL---LVSMKESSTSAARIVNLPDFVAATASPFYSLLVAKTRKLKLSVIGGCAAWMVCMG 425

Query: 482 QISLIE----PNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFR 537
                      +  V    +++ + G   S  + V L AM     H   A  T I Y F 
Sbjct: 426 LFYKYRGGSGSHEGVIAASVIMGLSGLLCSNSVIVILQAM---TTHSRMAVITGIQYTFS 482

Query: 538 STGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHS--SDYIHDSA 595
             G  +G S+ GAI+ +++ + L +N+          + LA+I  ++ ++  SDY   S 
Sbjct: 483 KLGAAIGASVSGAIWTQTMPNQLYKNL--------GNDTLAEIAYASPYTFISDYPWGS- 533

Query: 596 PEFVRQALIESYHFACR 612
           PE  R A++ESY +  R
Sbjct: 534 PE--RDAVVESYRYVQR 548

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 68/164 (41%), Gaps = 5/164 (3%)

Query: 97  IKKNTVATAKTIDLETSSIEAKNNTGLSPA----RIKIIM-GSMYLGIFLASLDNTIVST 151
           I++   +   T  + ++  + K N  +S      + KI++  + ++  F  SLD T+ ST
Sbjct: 23  IERERHSNDDTYSMTSTFFKLKENEIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRST 82

Query: 152 LLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLIC 211
              +  + ++E   +S +     + S   Q +Y ++SD FGR  L + + + + +G +I 
Sbjct: 83  YTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQ 142

Query: 212 GLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQ 255
             +  L    AG                    D   L+ R  YQ
Sbjct: 143 SQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLKWRMFYQ 186

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 114/272 (41%), Gaps = 33/272 (12%)

Query: 367 LCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVY 425
           L + +V+     VY E   +++PILP   +K+R +  S S++  +  +  M   Y   V 
Sbjct: 348 LVLGVVLLPMLIVY-ELKWAREPILPWKLIKDRAVWASMSISFLYDFIFYMAYDYLYTVM 406

Query: 426 WAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV------- 478
              V     +     ++ +F ST      A  Y+ +  + K  ++A C L +V       
Sbjct: 407 IVAVDESVKSATRISSLSAFVSTVFSPFFA-LYITRVTRLKPYIIAGCGLWMVAMGLLYH 465

Query: 479 ---GQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYA 535
              G+   S I   + VW         G G ++      +++ +A  HE+ A  TS++Y 
Sbjct: 466 FRGGKSSHSGIIGGLCVW---------GVGTTMFTYPVNVSVQSATSHENMATVTSLNYT 516

Query: 536 FRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSA 595
               G  +G+++ G I+ ++L   + + V       +  E+    I      ++Y   + 
Sbjct: 517 LYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYEQPYNFI------AEYTWGTP 570

Query: 596 PEFVRQALIESYHFACRNTYKFCLASIFCALL 627
              +RQ ++E+Y    +   +  +  +FCA L
Sbjct: 571 ---IRQQVVEAYMHVQK--LETLVGLVFCAPL 597

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 1/131 (0%)

Query: 125 PARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLY 184
           P RI ++  +   G +   LD+ I     +++ + F+E   +S +     + SA  Q +Y
Sbjct: 93  PFRILLLFCAFICG-YGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNVINAVISAASQIVY 151

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXD 244
            +++D+FGR  L I + V +++G +I   S  +    AG                    D
Sbjct: 152 ARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLVLLLILSD 211

Query: 245 IVPLRNRALYQ 255
              L+ R  YQ
Sbjct: 212 FSSLKWRLFYQ 222

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 108/257 (42%), Gaps = 30/257 (11%)

Query: 369 VAIVVGGA----TFVYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLP 423
           +A +V G      F+Y E   +K P+LP   L +R I     +  +      ++  Y  P
Sbjct: 309 IATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGIWAPLGVTFFNFFTFFISCDYLYP 368

Query: 424 VYWAGVLNMKPTDMGKRTIPSF--FSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQL 481
           V    +++MK +      I +   F  A  S      + KT K K  ++  CA  +V   
Sbjct: 369 VL---LVSMKESSTSAARIVNLPDFVAATASPFYSLLVAKTRKLKLSVIGGCAAWMVCMG 425

Query: 482 QISLIE----PNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFR 537
                      +  V    +++ + G   S  + V L AM     H   A  T I Y F 
Sbjct: 426 LFYKYRGGSGSHEGVIAASVIMGLSGLLCSNSVIVILQAM---TTHSRMAVITGIQYTFS 482

Query: 538 STGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHS--SDYIHDSA 595
             G  +G S+ GAI+ +++ + L +N+          + LA+I  ++ ++  SDY   S 
Sbjct: 483 KLGAAIGASVSGAIWTQTMPNQLYKNL--------GNDTLAEIAYASPYTFISDYPWGS- 533

Query: 596 PEFVRQALIESYHFACR 612
           PE  R A++ESY +  R
Sbjct: 534 PE--RDAVVESYRYVQR 548

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 68/164 (41%), Gaps = 5/164 (3%)

Query: 97  IKKNTVATAKTIDLETSSIEAKNNTGLSPA----RIKIIM-GSMYLGIFLASLDNTIVST 151
           I++   +   T  + ++  + K N  +S      + KI++  + ++  F  SLD T+ ST
Sbjct: 23  IERERHSNDDTYSMTSTFFKLKENEIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRST 82

Query: 152 LLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLIC 211
              +  + ++E   +S +     + S   Q +Y ++SD FGR  L + + + + +G +I 
Sbjct: 83  YTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQ 142

Query: 212 GLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQ 255
             +  L    AG                    D   L+ R  YQ
Sbjct: 143 SQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLKWRMFYQ 186

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 106/249 (42%), Gaps = 36/249 (14%)

Query: 378 FVYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTD 436
           F + E   SK P++P   +K+R +  S +++     +  M   Y   V   GV     + 
Sbjct: 375 FTFWEWKFSKSPLIPSKLVKDRAVWSSMAISFLIDFIFYMAVDYLYTVLIVGVNESVKSA 434

Query: 437 MGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLI 486
               ++ SF ST +GS      + +  + K  ++A CAL ++          G    + I
Sbjct: 435 TRISSLSSFVST-VGSPIFALLITRFTRLKPFIVAGCALWMLSMGLLYHYRGGASSHNGI 493

Query: 487 EPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVS 546
             ++ VW         G G ++      +++ AAV H   A  T+++Y     G  +G +
Sbjct: 494 IASLCVW---------GVGTTLFTYPINVSVQAAVSHADMATVTALNYTMYRIGSAVGAA 544

Query: 547 IGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDY---IHDSAPEFVRQAL 603
           + GAI+ ++L   L           H R   A +  +AA+SS Y   ++ +    VR  +
Sbjct: 545 VSGAIWTQTLYKQL-----------HKRMGDATLA-TAAYSSPYSFIVNYTWGTTVRDQM 592

Query: 604 IESYHFACR 612
           +E+Y +  R
Sbjct: 593 VEAYRYVQR 601

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 45/112 (40%)

Query: 144 LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVM 203
           LD  I      +  S + E   +S I     ++SA  Q +Y + SD+FGR  L I S V 
Sbjct: 128 LDGNIRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVYARASDVFGRLSLFIVSVVF 187

Query: 204 FALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQ 255
           +A+G +I   +  +    AG F                  D   L+ R  YQ
Sbjct: 188 YAVGTIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLLILSDFSSLKWRLFYQ 239

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 61/121 (50%), Gaps = 3/121 (2%)

Query: 90  NASGYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIV 149
           ++S  D +K     T   I  ++  +  K +T    A   I + S ++  F   LD++I 
Sbjct: 34  DSSPRDEMKDKLKGTKSLIIRKSELMAKKYDTWQLKA---IFLFSAFICTFAYGLDSSIR 90

Query: 150 STLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCL 209
            T + +  + ++    IS ++   L+ SA  Q ++G +SDIFGR  L + S V++ +G +
Sbjct: 91  GTYMTYAMNSYSAHSLISTVSVIVLMISAVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTI 150

Query: 210 I 210
           I
Sbjct: 151 I 151

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 65/136 (47%), Gaps = 1/136 (0%)

Query: 88  QTNASGYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNT 147
           + N + Y S++ + V      ++  ++IE  +    +P +  I+  S++L  +  SLD+T
Sbjct: 16  KVNETSY-SLEAHDVPEDDYYNVGVTNIEIYSEFYNTPMKRIILFSSIFLVCYSYSLDST 74

Query: 148 IVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALG 207
           +  T      + F+E   +S++     + SA  +  + + +DIFGR  +     V + +G
Sbjct: 75  LRKTFKTDATNSFSEHSLVSFVNCFSAIVSAIGELFFARSADIFGRTSIFYICLVFYVVG 134

Query: 208 CLICGLSPGLWCLVAG 223
            +I   S G+    AG
Sbjct: 135 TIIVATSKGISQFAAG 150

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 57/115 (49%), Gaps = 1/115 (0%)

Query: 102 VATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFN 161
           +A+ K  +L  +  E +N    SP ++ + +G ++LG     L+   + +L+  +A ++N
Sbjct: 1   MASNKIANLTKALQEIRNKCQKSPYQLNVNVGLIFLGCTFDLLNVASMISLIDDLAKKYN 60

Query: 162 -EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSP 215
                 SW  T+Y ++ A F    G++ DI G   L   S   FA+  L+C + P
Sbjct: 61  ISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMP 115

>KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {ON}
           Anc_3.84 YDR497C
          Length = 577

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 58/120 (48%), Gaps = 5/120 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFN--EMPH- 165
           D + +S+    N  +SP  I +   +   G F+   D   +S+ L  I ++ +  E+ + 
Sbjct: 62  DEDDTSVMITFNQSVSPFIITLTFVASISG-FMFGYDTGYISSALVSIGTDLDNKELTYG 120

Query: 166 -ISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
              +I  A  L +       G  +D++GRKP L+FSNVMF +G ++   +   W +  GR
Sbjct: 121 DKEFITAATSLGALISSIFAGVAADMYGRKPCLMFSNVMFLIGAILQISASNFWQMTVGR 180

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 104/257 (40%), Gaps = 32/257 (12%)

Query: 382 ETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKR 440
           E   ++DPILP   +K+R +  S  ++     +  M   Y   V    V     +     
Sbjct: 341 EYRFARDPILPYRLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRIA 400

Query: 441 TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLIEPNI 490
           T+ SF ST      A   + +  + K  +M  CAL +V          G    S I   +
Sbjct: 401 TLSSFVSTVASPFFA-LLVTRCTRLKPFIMFGCALWMVAMGLLYHFRGGSQSHSGIIGAL 459

Query: 491 AVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGA 550
            VW         G G ++      +++ +AV HE+ A  T+++Y     G  +G ++ GA
Sbjct: 460 CVW---------GVGTTLFTYPVTVSVQSAVSHENMATVTALNYTLYRIGSAVGSAVSGA 510

Query: 551 IFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFA 610
           I+ ++L   + + +  +A      E     I++    +       P+  R AL+ +Y + 
Sbjct: 511 IWTQTLYKQILKRMGDVALATTAYESPYTFIETYTWGT-------PQ--RNALMNAYKYV 561

Query: 611 CRNTYKFCLASIFCALL 627
            R   +  +A +FC  L
Sbjct: 562 QR--LETIVALVFCVPL 576

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 53/126 (42%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           I++ S ++  +   LD  I      +  S ++E   +S I     + SA  Q +Y ++SD
Sbjct: 76  ILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSD 135

Query: 190 IFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLR 249
           +FGR  L I + +++ +G +I   +  +    AG                    D   L+
Sbjct: 136 VFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLK 195

Query: 250 NRALYQ 255
            R LYQ
Sbjct: 196 WRLLYQ 201

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 122/266 (45%), Gaps = 26/266 (9%)

Query: 378 FVYVETYVSKDPILPVAFLKNRTILGSSLANWF-SMMGMMTTSYFLPVYWAGVLNMKPTD 436
           F+Y E+  +KDP+ P   LK+R I  S   N+    +  M   Y  PV    V     + 
Sbjct: 326 FIYWESKWAKDPLAPFELLKDRGIWASMCFNFLMDFVYCMAAGYLYPVLIVAVDESTKSA 385

Query: 437 MGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQY 496
               ++ SF ST + S   GY + ++ + K  +++ C +     L   L+    +    +
Sbjct: 386 TRITSLASFVST-VASPFMGYAVSRSTRLKPYIVSGCGMWF---LATGLLYHYRSGLESH 441

Query: 497 ILLVIPGFGLSVLITVTL----LAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIF 552
             ++     L +  T+++    ++  +   HE+ A+ T+++Y     G  +GV++ GAI+
Sbjct: 442 SGIIGGLVLLGLGCTLSIYPINVSAQSLTSHENMASVTALNYTVYRIGGAVGVAVSGAIW 501

Query: 553 RKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSS--DYIHDSAPEFVRQALIESYHFA 610
            ++    L  +++K   D      LA    SA +S    Y  D+    VRQA++E+Y   
Sbjct: 502 TQT----LYNDLLKRLGDA----TLAMSAYSAPYSFVLTYGWDTP---VRQAVVEAYREV 550

Query: 611 CRNTYKFCLASIFCA--LLSCIAVKE 634
            R   +  +A IF A  LLS + +++
Sbjct: 551 QR--LEVLIALIFTAPLLLSSLFLRD 574

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           I++ S ++  F   LD+ I      +  S + +   +S +A    L SA  Q  Y ++SD
Sbjct: 65  ILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVAIINNLLSAASQIFYARLSD 124

Query: 190 IFGRKPLLIFSNVMFALGCLI 210
           +FGR  L + S V + +G +I
Sbjct: 125 VFGRLSLFVVSMVFYVIGTII 145

>NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {ON}
           Anc_3.84
          Length = 587

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 60/139 (43%), Gaps = 5/139 (3%)

Query: 90  NASGYDSIKKNTVATAKTI-DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTI 148
           N S  D  + N     K + D +  S+    N G+SP  I I+     +  F+   D   
Sbjct: 50  NVSLSDDEEDNDRIQIKPVNDEDDVSVIITFNQGISPF-ILILTFVASISGFMFGYDTGY 108

Query: 149 VSTLLAHIASEFNEM---PHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFA 205
           +S+ L  I  +            I  A  L +       G  +DIFGRKP L+FSNV+F 
Sbjct: 109 ISSALISINKDLGRTLTYGDKEIITAATSLGALISSIFAGTAADIFGRKPCLMFSNVLFV 168

Query: 206 LGCLICGLSPGLWCLVAGR 224
           +G ++   +   W + AGR
Sbjct: 169 IGAILQITAHRFWQMNAGR 187

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 47/81 (58%)

Query: 131 IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           I  S++L  F+  LD+ +  ++ A+  + + +   +S +     +++A   PLY ++SD+
Sbjct: 77  IFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVNVVRSVAAACGLPLYSRLSDV 136

Query: 191 FGRKPLLIFSNVMFALGCLIC 211
           FGR  L++ S +++  G +IC
Sbjct: 137 FGRIELIVVSVLLYVAGTIIC 157

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 6/90 (6%)

Query: 140 FLASLDNTIVSTLLAHIASEFNEMPHISW----IATAYLLSSATFQPLY-GKISDIFGRK 194
           F+   D   +S  L  +  + +   ++S+    I TA     A    L+ G ++DIFGRK
Sbjct: 90  FMFGYDTGYISAALVSLGKDLDN-KYLSYGEKEIITAATSLGALITSLFAGTLADIFGRK 148

Query: 195 PLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
           P+ + SNVMF +G ++   +   W + AGR
Sbjct: 149 PVTMSSNVMFLIGAILQACTRSFWQMAAGR 178

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 92/224 (41%), Gaps = 30/224 (13%)

Query: 369 VAIVVGGATFVYV---ETYVSKDPILPVAFLKNRTILGSSLANWF-SMMGMMTTSYFLPV 424
           V +VVG   FV+    E++++  P LP   LK+R I    LA +   ++   +  Y  PV
Sbjct: 199 VPLVVGSVLFVFYIVWESFMASYPALPFKLLKDRGIWIPILAGFLMDLVYYFSCDYMYPV 258

Query: 425 YWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQIS 484
               +     +     ++P F +T      A   ++ TG+ KW          +G   I 
Sbjct: 259 LMVAINESTKSATNIASLPLFVTTVASPFFA-VLLRWTGRLKWY--------AIGGFAIW 309

Query: 485 LIEPNIAVWRQY-----------ILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSIS 533
           ++  ++ ++ +Y             +V+ G G +      L  M A  PH   A  T + 
Sbjct: 310 MV--SLGLFFRYRCGEGSHDGMVAAVVLLGLGRTFTQFPLLTTMQARAPHTKMATVTGLF 367

Query: 534 YAFRSTGCTLGVSIGGAIFR----KSLGSLLERNVMKLASDKHP 573
           + + S G  +G SI GA++     K L  +L  N +  A+   P
Sbjct: 368 HVWGSVGSVVGASISGAVWTQKMPKKLLKMLGSNGLATAAYASP 411

>KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively
          Length = 569

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHI-- 166
           D + +S+    N  +SP  I I+  +  +  F+   D   +S+ L  I ++ +       
Sbjct: 43  DEDDTSVMITFNQKISPF-ILILTFTASISGFMFGYDTGYISSALVSIGTDLDNKALTYG 101

Query: 167 -SWIATAYLLSSATFQPLYGKIS-DIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
              I TA     A    ++  IS DIFGRKP L+FSN++F +G  +   +   W +  GR
Sbjct: 102 DKEIITAATSLGALISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFWQMAVGR 161

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 61/127 (48%), Gaps = 11/127 (8%)

Query: 95  DSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIK------IIMGSMYLGIFLASLDNTI 148
           DS+KK+ ++     D + SSI + N+    P   K        +G+  L   L     T 
Sbjct: 38  DSVKKDQISIT---DDDVSSI-SNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQ 93

Query: 149 VSTLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALG 207
             + +  +A   N +    +W+  ++ L+S +F  + G+I DI+G K   I  N++F + 
Sbjct: 94  TLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIW 153

Query: 208 CLICGLS 214
            ++CG+S
Sbjct: 154 SILCGVS 160

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 110/519 (21%), Positives = 187/519 (36%), Gaps = 85/519 (16%)

Query: 121 TGLSPARIKII---MGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSS 177
           T +SP           S+ L +FLA+LD  IV T++  +A++FN      W+ T Y L +
Sbjct: 64  TAISPLTGLRFYVCFASLALSLFLAALDILIVGTIMETVAAKFNGYSMTGWLVTGYNLPN 123

Query: 178 ATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXX 237
           A    L+G+   + G K  ++ S V+F +G LI   +  +  L+ GR             
Sbjct: 124 ALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAATSMTMLIGGRVISGIGGSGIQTL 183

Query: 238 XXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAIS 297
                  +V  R R     I +  F             F+ H   WR  F I +P+  + 
Sbjct: 184 CFVITSTLVTDRTRGTAISILSCAFAVASVAGPFLGGAFATH-VTWRWCFYINLPIGGL- 241

Query: 298 CSLIVAYLELPKGCKGSGIQSDEDNQI-SEKLRRIDWXXXXXXX-XXXXXXXXXXXXXXK 355
                A+         +G  + E+ +I   +++RI +                       
Sbjct: 242 -----AFFFFLFSYNPNGENTFENFKILLGRIKRISYSQLLTVSFYRRLFRTLVFKFDFF 296

Query: 356 ELPFQSNGFYALCVAIVVGG----------------------ATFVY-------VETYVS 386
           E    S GF  + +A+  GG                      A+FVY       V+    
Sbjct: 297 EFALSSAGFTLVLLALTFGGNRYDWNSGTIIAYFVVGILLIIASFVYDFVVFDRVKPQTD 356

Query: 387 KDPILPV---AFLKNRTILGSSLANW-----FSMMGMMTTSYFLPVY----WAGVLNMKP 434
           + P LP+     +    +L  ++AN+     ++M  +    YF  V+    W   +++  
Sbjct: 357 RIPYLPLLSWNVISKPGVLIPNIANFCTCFCYNMQVVYIVQYFQLVWGDSAWKASIHL-- 414

Query: 435 TDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWR 494
                  I    ST +  L  G   +KTG  K LL+    +  V    ++L+ P  +   
Sbjct: 415 -------IAPVISTVITVLFCGIITRKTGHVKILLVVGGIVIPVASGILTLLGPKSSSSA 467

Query: 495 QYILLVIPGFGLSVLITVTLLAMIAAVPHEHQ------AATTSISYAFRSTGCTLGVSIG 548
           +  LL++PG     ++  +LL+    +   H        A T+ +   +  G   G  + 
Sbjct: 468 KIGLLILPGISFGSVMNGSLLSSQLQIQKNHPLFRFDFIAVTTFNAFVKMLGMAFGGIMS 527

Query: 549 GAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHS 587
             IF  S+                 R EL+KI     HS
Sbjct: 528 NMIFTTSV-----------------RNELSKIKPPLPHS 549

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 108/265 (40%), Gaps = 38/265 (14%)

Query: 382 ETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKR 440
           E   ++DPILP   +K+R +  S  ++     +  M   Y   V    V     +     
Sbjct: 341 EYRFARDPILPYKLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRIS 400

Query: 441 TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLIEPNI 490
           T+ SF ST      A   + +  + K  +M  C+L +V          G    S I   +
Sbjct: 401 TLSSFVSTVASPFFA-LLVTRCTRLKPFIMFGCSLWMVAMGLLYHFRGGSQSHSGIIGAL 459

Query: 491 AVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGA 550
            VW         G G ++      +++ +AV HE+ A  T+++Y     G  +G ++ GA
Sbjct: 460 GVW---------GVGTTLFTYPVTVSVQSAVSHENMATVTALNYTLYRIGSAVGSAVSGA 510

Query: 551 IFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEF---VRQALIESY 607
           I+ ++    L + ++K   D          + +AA+ S Y       +    R AL+ +Y
Sbjct: 511 IWTQT----LYKQILKRMGDVA--------LATAAYDSPYTFIETYTWGTPQRVALMNAY 558

Query: 608 HFACRNTYKFCLASIFCALLSCIAV 632
            +  R   +  +A +FC  L  +++
Sbjct: 559 KYVQR--LETIVALVFCVPLIALSL 581

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 46/112 (41%)

Query: 144 LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVM 203
           LD  I      +  S ++E   +S I     + SA  Q +Y ++SD+FGR  L I + ++
Sbjct: 90  LDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVIL 149

Query: 204 FALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQ 255
           + +G +I   +  +    AG                    D   L+ R LYQ
Sbjct: 150 YVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQ 201

>YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}
           ITR2Myo-inositol transporter with strong similarity to
           the major myo-inositol transporter Itr1p, member of the
           sugar transporter superfamily; expressed constitutively
          Length = 609

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%)

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
           G  +D+FGR+P L+FSN+MF +G ++   +   W + AGR
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGR 209

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 113/266 (42%), Gaps = 42/266 (15%)

Query: 378 FVYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTD 436
           F Y E   + +P++P   +K+R +  +  ++     +  M   Y   V    V     + 
Sbjct: 342 FSYWEARWATNPLVPYKLVKDRGVWAALGISFLIDFIFYMAVDYLYTVLIVAVHESVKSA 401

Query: 437 MGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLI 486
               ++ SF ST    + A   + +  + K +++  C+L ++          G+   S I
Sbjct: 402 TRISSLSSFVSTVASPIVA-LALTRVTRMKPVIIVGCSLWLLAMGLLYHFRGGRESHSGI 460

Query: 487 EPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVS 546
              + VW         G G ++      +++ AA  H++ A  T+++Y     G  +G +
Sbjct: 461 IGALCVW---------GLGTTLFTYPVTVSVQAATNHDNMATVTALNYTLYRIGSAVGAA 511

Query: 547 IGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDS-----APEFVRQ 601
           + GAI+ ++L   L + +           ELA    + A++S Y   +      PE  R+
Sbjct: 512 VSGAIWTQTLYKQLLKRI--------GNSELA----TKAYASPYTFITTYTWGTPE--RE 557

Query: 602 ALIESYHFACRNTYKFCLASIFCALL 627
           A++++Y +  R   +  +A +FCA L
Sbjct: 558 AMVQAYRYVQR--LETIVAVVFCAPL 581

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 54/126 (42%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           I++ S ++  +   LD  I      +  S ++E   +S I     + SA  Q +Y ++SD
Sbjct: 81  ILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSD 140

Query: 190 IFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLR 249
           I+GR  LL+ + V++A+G +I   +  +    AG                    D   LR
Sbjct: 141 IYGRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLLILSDFSSLR 200

Query: 250 NRALYQ 255
            R  YQ
Sbjct: 201 WRLFYQ 206

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%)

Query: 143 SLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNV 202
           SLD+ +      + AS + +   +S I     ++SAT Q +Y + SDIFGR  LL+ + +
Sbjct: 128 SLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRASDIFGRLSLLLVAII 187

Query: 203 MFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGI 257
            + +G +I   +  +    AG F                  D   L+ R  YQ I
Sbjct: 188 CYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLKWRFFYQAI 242

>Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W
           (REAL)
          Length = 609

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%)

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
           G  +D+FGR+P L+FSN+MF +G ++   +   W + AGR
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGR 209

>Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {ON}
           YOL103W (REAL)
          Length = 587

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%)

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
           G  +D+FGR+P L+FSN+MF +G ++   +   W + AGR
Sbjct: 178 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGR 217

>Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W
           (REAL)
          Length = 611

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%)

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
           G  +D+FGR+P L+FSN+MF +G ++   +   W + AGR
Sbjct: 172 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGR 211

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 56/126 (44%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           II+ S ++  +   LD ++     ++  S +++ P IS I     + SA  Q ++ ++SD
Sbjct: 56  IILFSAFICGYGYGLDGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAASQIVFARLSD 115

Query: 190 IFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLR 249
           +FGR  L I + + +A+G +I   +  +    AG                    D   LR
Sbjct: 116 VFGRLSLFITALLFYAVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLR 175

Query: 250 NRALYQ 255
            R +YQ
Sbjct: 176 WRLVYQ 181

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 90/198 (45%), Gaps = 24/198 (12%)

Query: 378 FVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDM 437
           F+  E+  +K P++P   +K+R + G+ L   F ++G +  +    +Y   ++ +  +  
Sbjct: 317 FMIWESKAAKYPVVPYGLIKDRAVWGA-LGCQF-LIGFIYNAVAGYIYTILIVAVNESVK 374

Query: 438 GKRTIPSF--FSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISL 485
               I S   F + + S     Y+ +  K K  ++  C + ++          G+   S 
Sbjct: 375 SATVISSLSSFVSTVASTFFSLYITRCTKLKGYIIGGCGIWMLAMGLFYHYRGGEFAHSG 434

Query: 486 IEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGV 545
           I   + +W         G G ++LI  T +++ +A  H++ A  T+++Y     G   G 
Sbjct: 435 IVGAMVIW---------GLGDTLLIYPTTISVQSATSHDNMATVTALNYTLYRIGLATGA 485

Query: 546 SIGGAIFRKSL-GSLLER 562
           ++ GAI+ ++L  +LL R
Sbjct: 486 AVSGAIWSQTLYKALLSR 503

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 111/265 (41%), Gaps = 38/265 (14%)

Query: 382 ETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKR 440
           E   ++DPILP   +K+R +  S  ++     +  M   Y   V    V     +     
Sbjct: 345 EYSYARDPILPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESIKSATRIS 404

Query: 441 TIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLIEPNI 490
           T+ SF S  + S   G  M +  + K  +M+ C+L ++          G    S I   +
Sbjct: 405 TLSSFVSV-VASPFFGLLMTRCTRLKPFIMSGCSLWMLAMGLLYRFRGGSESHSGIIGAL 463

Query: 491 AVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGA 550
            VW         G G ++      +++ +AV HE+ A  T+++Y     G  +G ++ GA
Sbjct: 464 CVW---------GVGTTLFTYPVTVSVQSAVSHENLATVTALNYTMYRIGSAVGSAVSGA 514

Query: 551 IFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEF---VRQALIESY 607
           I+ ++    L + ++K   D          + ++A+ S Y+      +    R AL+ +Y
Sbjct: 515 IWTQT----LYKQILKRMGDVA--------LAASAYDSPYVFIETYTWGTPQRVALMGAY 562

Query: 608 HFACRNTYKFCLASIFCALLSCIAV 632
            +  R   +  +A +FC  L  +++
Sbjct: 563 KYVQR--LETIVALVFCVPLIALSL 585

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 66/162 (40%), Gaps = 7/162 (4%)

Query: 94  YDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLL 153
           YD++++N     K    +T  I    N     A   I++ S ++  +   LD  I     
Sbjct: 51  YDALRQNRSLIIK----QTEIIGTAYNKWYLQA---ILLFSAFVCGYGYGLDGNIRYIYT 103

Query: 154 AHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGL 213
            +  S +++   +S I     + SA  Q +Y ++SD+FGR  L I + +++ +G +I   
Sbjct: 104 GYATSSYSKHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQ 163

Query: 214 SPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQ 255
           +  +    AG                    D   L+ R LYQ
Sbjct: 164 AYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQ 205

>TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {ON}
           Anc_3.84 YDR497C
          Length = 585

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 58/120 (48%), Gaps = 5/120 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEF--NEMPH- 165
           D + +S+    N G+SP  + + + +   G F+   D   +S+ L  I ++    E+ + 
Sbjct: 70  DEDDTSVMITFNQGVSPFILVLTLVASISG-FMFGYDTGYISSALISIKTDLGGEELTYG 128

Query: 166 -ISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
               I  A  L +     + G  +D++GRK  ++FSNVMF +G ++   +   W +  GR
Sbjct: 129 GKEIITAATSLGALITSLMAGTAADLYGRKACIMFSNVMFLVGAILQATAFSFWQMAVGR 188

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 62/134 (46%), Gaps = 21/134 (15%)

Query: 499 LVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGS 558
           L + G G +       +++ AAV HE  A  ++++Y F   G  +G ++ GAI+ +    
Sbjct: 452 LCVWGLGSTFFTYPVTVSVQAAVSHEQMATVSALNYTFYRIGSAVGAAVSGAIWTQK--- 508

Query: 559 LLERNVMKLASDKHPREELAKIIDSAAHSSDYIHD-----SAPEFVRQALIESYHFACRN 613
            L + ++ L  D          + +AA+ S Y          PE  R+A++E+Y +  R 
Sbjct: 509 -LYKKLLSLMGD--------ATLATAAYGSPYTFIVTYTWGTPE--REAMVEAYRYIQR- 556

Query: 614 TYKFCLASIFCALL 627
             +  +A +FC  L
Sbjct: 557 -LETVVALVFCVPL 569

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (41%)

Query: 144 LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVM 203
           LD+ I      +  S ++E   +S +     + SA  Q +Y ++SD FGR  L + + V+
Sbjct: 83  LDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIVYARLSDAFGRFRLFVVAIVL 142

Query: 204 FALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQ 255
           +++G +I   +  +    AG                    D+  LR R  YQ
Sbjct: 143 YSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILSDMSTLRWRLFYQ 194

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 94/268 (35%), Gaps = 26/268 (9%)

Query: 55  QPIRRELVLDPTS---DLPGFVAGXXXXXXXXXXXXQTNASGY----DSIKKNTVATAKT 107
           +PI +E+  DPT    DL    AG            +    G     DS K+      K 
Sbjct: 25  KPITKEIYEDPTQKKFDLDDDEAGKTSSLFNPDLNLEEEVRGLNELGDSFKRERSFWGKM 84

Query: 108 IDLETS-SIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHI 166
             LE     E K N  L         G       L+ +D +I+S   A I    N+M H+
Sbjct: 85  KALEFEVDFENKKNMVLMLGTFAAFAG------ILSGIDQSIISG--ASIG--MNKMLHL 134

Query: 167 SWIATAYLLSSATFQPLYGKI-----SDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLV 221
           S    + + S      + G I     S+ FGRK  L  S V + +G ++C  +     + 
Sbjct: 135 STHEASLVSSLMPLGAVAGSILLTPFSEYFGRKKSLAISCVFYTVGAIVCAAASNHHEMY 194

Query: 222 AGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGG 281
           AGRF                  + VP   R     +  F               F +  G
Sbjct: 195 AGRFLIGIGVGLEGGGIGVYIAESVPSSVRGSLVSLYQFNIALGELFGYIVGVIFFDVKG 254

Query: 282 GWRVAFLIQIPLCAISCSLIVAYLELPK 309
           GWR  +++   L   S +L +  L LP+
Sbjct: 255 GWR--YMVGSSLV-FSTTLFIGLLFLPE 279

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISW 168
           D   ++IE       SP    ++  S++L  +   LD ++  T  A   S +++   +S 
Sbjct: 55  DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLST 114

Query: 169 IATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
           +     + +A  Q  Y + SDIFGR  +LI   V +A+G +I
Sbjct: 115 VNAITTVIAAAGQICYARASDIFGRMTILIIGLVFYAVGTII 156

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {ON}
           Anc_8.272 YDR119W
          Length = 589

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 88/218 (40%), Gaps = 33/218 (15%)

Query: 406 LANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKY 465
           L N FSM+ ++ T  +LPVY   V N     +  R +P + S     L    Y KK   Y
Sbjct: 370 LPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQARYAKK---Y 426

Query: 466 KWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEH 525
              L+    + ++G  Q+  ++ +   W  ++   IP  G++ +I      M        
Sbjct: 427 NTSLLG-SLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVIMANTKNM-------- 477

Query: 526 QAATTSISYAFRSTGCTLGVSIGGA--------IFRKSLGSLLERNVMKLASDKHPREEL 577
                            +G+ +GG+        +F ++L   L  N++KL S+   ++EL
Sbjct: 478 -------------RDFAVGILVGGSATIILCQGLFTRTLHDTLRDNLLKLQSEGLKKKEL 524

Query: 578 AKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTY 615
            KI++    +  +    AP   R A+  S+  A    +
Sbjct: 525 LKILEKTIKNPQWALIDAPAITRGAITNSFALAIHQIF 562

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 8/64 (12%)

Query: 15 LQAFVKLKERQRQLLND--------EPKVVIQQNPAHSIEPTETTPFLQPIRRELVLDPT 66
          L+ F KLKE+QR L N           K   + N    +EP E+TP L+    E      
Sbjct: 11 LREFAKLKEKQRLLENKIHHATPNGTQKPTSELNTVQQLEPEESTPLLKTSNHETSTPAE 70

Query: 67 SDLP 70
           ++P
Sbjct: 71 KEMP 74

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 45/87 (51%)

Query: 124 SPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPL 183
           +P R+ I+  S++L  +  +L   +  T      S +++   ++ +     + SA  Q  
Sbjct: 51  TPLRVTILYFSLFLLAYAYNLHKDVRGTYQTLATSSYSKHSLLATVQCINQVISAAGQIW 110

Query: 184 YGKISDIFGRKPLLIFSNVMFALGCLI 210
           Y + SDIFGR P+LI S + + +G LI
Sbjct: 111 YARASDIFGRTPILILSILFYFIGTLI 137

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
            +SW A+AY L+  TF  + G++ DIFG K   +     +AL  L+ G S
Sbjct: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 78/191 (40%), Gaps = 10/191 (5%)

Query: 365 YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRT--ILGSSLANWFSM-MGMMTTSYF 421
           YAL +   V    F ++E+  +  P+LP A L + T  +L    A W S  + +  T  F
Sbjct: 276 YALLIVGTVFLIIFAFIESRAAF-PLLPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQF 334

Query: 422 LPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQL 481
           +           P     +  P   S    +L  G+ +  T     +  A  A   VG +
Sbjct: 335 M----EDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAF-TVGTI 389

Query: 482 QISLIEPNIAVWRQ-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTG 540
            I+    +   W Q ++ +++  +G+ +      + +  ++PHEHQ    S+     +  
Sbjct: 390 LIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYS 449

Query: 541 CTLGVSIGGAI 551
            ++G+ I G I
Sbjct: 450 ISIGLGIAGTI 460

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
            +SW A+AY L+  TF  + G++ DIFG K   +     +AL  L+ G S
Sbjct: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 130

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 78/191 (40%), Gaps = 10/191 (5%)

Query: 365 YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRT--ILGSSLANWFSM-MGMMTTSYF 421
           YAL +        F Y+E+  +  P+LP A L + T  +L    A W S  + +  T  F
Sbjct: 275 YALLIVGTFFLVIFAYIESRAAF-PLLPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQF 333

Query: 422 LPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQL 481
           +           P     +  P   S    ++  G+ +  T     +L A  A   VG +
Sbjct: 334 ME----DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAF-TVGTI 388

Query: 482 QISLIEPNIAVWRQ-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTG 540
            I+    +   W Q ++ +++  +G+ +      + +  ++PHEHQ    S+     +  
Sbjct: 389 LIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYS 448

Query: 541 CTLGVSIGGAI 551
            ++G+ I G I
Sbjct: 449 ISIGLGIAGTI 459

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
            +SW A+AY L+  TF  + G++ DIFG K   +     +AL  L+ G S
Sbjct: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 79/191 (41%), Gaps = 10/191 (5%)

Query: 365 YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRT--ILGSSLANWFSM-MGMMTTSYF 421
           Y L +   V  A F ++E+  +  P+LP A L + T  +L    A W S  + +  T  F
Sbjct: 276 YILLIVGTVFLAIFAFIESRAAF-PLLPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQF 334

Query: 422 LPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQL 481
           +           P     +  P   S    +L  GY + +T     +L A  A    G +
Sbjct: 335 M----EDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAF-TAGTI 389

Query: 482 QISLIEPNIAVWRQ-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTG 540
            I+    +   W Q ++ +++  +G+ +      + +  ++PHEHQ    S+     +  
Sbjct: 390 LIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYS 449

Query: 541 CTLGVSIGGAI 551
            ++G+ I G I
Sbjct: 450 ISIGLGIAGTI 460

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           SW+  ++ L S +F  + G++ DIFG K +L+   VM  +  LICGL+
Sbjct: 119 SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 51/124 (41%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           +++L  +   L   I  ++  + A+ F + P I  I T   + +A     Y ++SD FGR
Sbjct: 67  ALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARLSDRFGR 126

Query: 194 KPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRAL 253
               IF+ V++ +G +I   +P    L AG                    DI  LR+R  
Sbjct: 127 IECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISGLRDRTF 186

Query: 254 YQGI 257
              I
Sbjct: 187 AMNI 190

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 52/129 (40%), Gaps = 11/129 (8%)

Query: 519 AAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNV---MKLASDKHPRE 575
           A+  HE  A  T +  +    G  +G SI GAI+ + L   L + +   + LA    P  
Sbjct: 466 ASTSHEEMAVATGLLMSVYQIGNAVGASIAGAIWTQRLAKELIKRLGSKVGLAVYNSPLS 525

Query: 576 ELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEY 635
            L K     +   + I +S  E  R  +I S  FA  N       ++ C  L    V E 
Sbjct: 526 YLTK-YPLGSEVRNEILESYSEIQRLLIIVSISFAALN-------AVLCFFLPGYTVSEK 577

Query: 636 KLHTSMDRQ 644
           +  T  +R+
Sbjct: 578 QSFTQEERE 586

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 105/257 (40%), Gaps = 32/257 (12%)

Query: 378 FVYVETYVSKDPILPVAFLKNRTILGSSLANWF-SMMGMMTTSYFLPVYWAGVLNMKPTD 436
           F+  E   ++DPI+P   +K+R +  S  + +    + MM   Y   +   GV N     
Sbjct: 320 FLIWEKKWARDPIIPYDLIKDRAVWASLNSQFLIGFIYMMAAGYIYNILIVGV-NESIKS 378

Query: 437 MGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLI 486
               TI S F     S     ++ +  + K  ++A C L ++          G+     I
Sbjct: 379 ATTITILSSFVATAASPPFCLWITRCTRMKGYIVAGCGLWMLAMGLFYHYRGGEFAHGGI 438

Query: 487 EPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVS 546
              + VW         G G  +LI    +++ +A  H++ A  T+++Y     G + G +
Sbjct: 439 VAAMVVW---------GLGDVLLIYPITVSVQSATSHDNMAMVTALNYTTYRIGLSTGSA 489

Query: 547 IGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIES 606
           I GAI+ ++L   L + +           +  K I +    +       PE  R+A++++
Sbjct: 490 ISGAIWTQTLYKELFKRLGDATLAVSAYSDPFKFITTYTWGT-------PE--REAVVQA 540

Query: 607 YHFACRNTYKFCLASIF 623
           Y    R  Y+  +A +F
Sbjct: 541 YRHVQR--YETIVALVF 555

>Suva_4.54 Chr4 (99974..102646) [2673 bp, 890 aa] {ON} YDL194W
           (REAL)
          Length = 890

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 62/134 (46%), Gaps = 24/134 (17%)

Query: 112 TSSIEAKNNTGL---SPARIKIIMGSMYLGIFLA----------SLDNTIVST--LLAHI 156
           T  I   +N  L    P + + +M S+Y+G+F+A           L N+I S   + +H+
Sbjct: 72  TDDISTIDNNSLLFSEPPQRQSMMMSIYVGVFVAVGGFLFGYDTGLINSITSMNYVKSHL 131

Query: 157 ASEFNEMPHISWIATAYLLSSATFQPLYGK-----ISDIFGRKPLLIFSN-VMFALGCLI 210
           A   +             LS  TF   +G      ISD +GRKP +IFS  V+F++G  +
Sbjct: 132 APNHDSFTAKQMSILVSFLSLGTF---FGALTAPFISDTYGRKPTIIFSTIVIFSIGNSL 188

Query: 211 CGLSPGLWCLVAGR 224
              + GL  L+ GR
Sbjct: 189 QVGAGGLTLLIVGR 202

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 66/134 (49%), Gaps = 9/134 (6%)

Query: 88  QTNASGYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIK------IIMGSMYLGIFL 141
           QTN S  + +  +  + +   D+ + +++++N   LSP   K      + + S  +  F+
Sbjct: 54  QTNTS-MNEVIGSISSVSNDSDINSENLQSENKV-LSPKYFKNRTHEYLFIISCMVSQFM 111

Query: 142 ASLDNTIVSTLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFS 200
           +    T   +++  +A E N E    +W+  ++ LS  +F  + G++ DI+G K +L+  
Sbjct: 112 SQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGG 171

Query: 201 NVMFALGCLICGLS 214
             +  +  LICG S
Sbjct: 172 YAILTIWSLICGFS 185

>SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {ON}
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1
          Length = 578

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 11/123 (8%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASE-------FN 161
           D + +S+    N  +SP  I +   +   G F+   D   +S+ L  I ++       + 
Sbjct: 50  DEDDTSVMITFNQKVSPFIIILTFVASISG-FMFGYDTGYISSALVSIGTDLDNKTLTYG 108

Query: 162 EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLV 221
           E   I+   +   L +A F    G  +D+FGRKP ++FSN++F +G ++   +   W + 
Sbjct: 109 EKEIITAATSLGALITAVFA---GVSADLFGRKPCIMFSNLLFVIGAILQVSAHTFWQMA 165

Query: 222 AGR 224
            GR
Sbjct: 166 IGR 168

>KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1 Myo-inositol transporter with strong
           similarity to the minor myo-inositol transporter Itr2p,
           member of the sugar transporter superfamily; expression
           is repressed by inositol and choline via Opi1p and
           derepressed via Ino2p and Ino4p
          Length = 608

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 5/121 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMP---- 164
           D + +S+    N  +SP  I +   +   G F+   D   +S+ L  I ++ +       
Sbjct: 82  DEDDTSVMITFNQKVSPFIIVLTFVASISG-FMFGYDTGYISSALVSIGTDLDHRALTYG 140

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
               I  A  L +       G  +DI+GRKP L+FSN++F +G ++   +   W +  GR
Sbjct: 141 DKEIITAATSLGALISSIFAGTSADIWGRKPCLMFSNLLFTVGAVLQISARSFWQMAVGR 200

Query: 225 F 225
            
Sbjct: 201 L 201

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 138 GIFLASLDNTIVSTLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPL 196
           G+ LAS+   IV  L+  I + FN       W  T+Y+++ A F   +G++ DI G   +
Sbjct: 33  GLDLASVGAMIV--LVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIM 90

Query: 197 LIFSNVMFALGCLICGLSPGLWCLVAGR 224
           +   +V+F +  L+C + P        R
Sbjct: 91  MCVFSVIFGIFSLLCAVVPNFIAFTVFR 118

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (45%), Gaps = 1/111 (0%)

Query: 106 KTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFN-EMP 164
           K   L  +  E +N    S  ++ + +G ++LG     L+   + +L+  +A  +N    
Sbjct: 5   KIAKLSNALEEIRNKCQKSRYQLNVNVGLIFLGCTFDLLNVASMISLIDDLAKTYNISYT 64

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSP 215
             SW  T+Y ++ A F    G++ DI G   L   S   FA+  L+C + P
Sbjct: 65  TASWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLCAVMP 115

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 140 FLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLY-----GKISDIFGRK 194
           FL   D   +S+ L  + ++      +++    Y+ S+ +   L      G  +D+FGR+
Sbjct: 78  FLFGYDTGYISSALQSVGTDLGH--QLTYRDKEYITSATSLGALIAALGAGICADLFGRR 135

Query: 195 PLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
             ++FSN++F +G ++   +   W +V GR
Sbjct: 136 KCIMFSNILFVVGTVLQVAAFNFWQMVVGR 165

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 59/122 (48%), Gaps = 2/122 (1%)

Query: 89  TNASGYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTI 148
           ++ S  D I  ++ A +    +    I AK  +  +P +  +I  S++   +   LDN++
Sbjct: 23  SSTSESDHISSHSDAESDKFGVHNVEIYAKYYS--TPVKRFLIFFSLFTIAYAYGLDNSV 80

Query: 149 VSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGC 208
             T      S +N+   +S ++    + SA  Q  + + +D+FGR  +L+ S V + +G 
Sbjct: 81  RGTYQTLATSSYNQHSLLSTVSCIKAVISAAAQIWFARSADMFGRTTILMISIVFYVVGT 140

Query: 209 LI 210
           ++
Sbjct: 141 VV 142

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 108/290 (37%), Gaps = 53/290 (18%)

Query: 378 FVYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTD 436
           F+  E   ++ P+ P   LKNR I+ +  L  +      M ++Y   V    V   K + 
Sbjct: 321 FLVWEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSA 380

Query: 437 MGKRTIPSFFSTALGSLGAGYYMKKTGKYK---------WLLMAFCALAVVGQLQISLIE 487
                + SF S   G L +G+ + K  + K         W +     +   G L   +  
Sbjct: 381 TRINKLFSFVSVITGFL-SGFVVAKVRRTKEFIFFGIGVWFISFGLMIRYTGGLDSHV-- 437

Query: 488 PNIAVWRQYILLVIPGFGLSVLITVTLLAMIA-AVPHEHQAATTSISYAFRSTGCTLGVS 546
             I V R      I GFG   L      ++ A A  HE  A  TS+  A  S G   G +
Sbjct: 438 -GIIVAR-----CILGFGNGFLKFPARASIQASAYSHEMMAVMTSLFLAVSSIGSAFGDA 491

Query: 547 IGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFV------- 599
           + G+I+   L   +   +          E LA          DY + S  +F+       
Sbjct: 492 VAGSIWTNVLPGKISEGI--------TNETLA----------DYAYGSPTKFILKYKWDT 533

Query: 600 --RQALIESYHFACR--NTYKFCLASIFCALLSCIAVKEYKLH--TSMDR 643
             RQA++E+Y    R  N    CL  +   L+S   +K  +L    S D+
Sbjct: 534 PERQAVVEAYKVIGRLLNIVGICL--LVPLLISAFFLKNRRLEDVVSFDK 581

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 115/291 (39%), Gaps = 37/291 (12%)

Query: 371 IVVGGA---TFVYVETYVSKDPILPVAFLKNRTILGSSLANWFS-MMGMMTTSYFLPVYW 426
           +V+G A    F++ E   +K+  LP   LK+R +  S +A +   M+  M + Y  PV  
Sbjct: 315 LVIGIALLLVFLFWEAKFAKNAALPFNLLKDRGVWASIVAAFLEKMIYAMISDYLYPVLL 374

Query: 427 AGVLNMKPTDMGKRTIPSFF----STALGSLGAGYYMKKT----GKYKWLLMAFCALAVV 478
             V     +      +P+F     S   G L       K     G + W++    ++ + 
Sbjct: 375 VSVNETNKSATRIVWLPTFMACLCSVFFGLLVVSVQRLKVFTICGTFLWII----SIGLF 430

Query: 479 GQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRS 538
            Q +      +  +    +L    GFG ++     ++ + A   H++ A+ T + + F  
Sbjct: 431 YQFRGGESSHSGIIGASIVL----GFGSAIFTQSIIVTLQAMASHDNMASITGLYFMFAQ 486

Query: 539 TGCTLGVSIGGAIFR----KSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDS 594
            G   G SI GAI+     K L   L+ + + +A    P E +A    S A  +      
Sbjct: 487 VGAATGASISGAIWTQTMYKQLLKQLKDSDLTMAVFASPYEFIA----SYAWGTKE---- 538

Query: 595 APEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSMDRQA 645
                R  +I++Y    + T    L      L+S +  K+ KL  S+   A
Sbjct: 539 -----RDLVIQAYRHVQKVTMLVSLILTVPLLVSVLFTKDRKLSDSVSSDA 584

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 53/135 (39%), Gaps = 1/135 (0%)

Query: 126 ARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYG 185
           AR+  ++ S +L  F   LD    S    + A+ + +   +S I     +     Q  + 
Sbjct: 62  ARV-FLLASAFLCGFAYYLDMVTRSVYTTYAANSYEKHSLLSTIQVINSVVGVGAQISFA 120

Query: 186 KISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDI 245
           ++SD+FGR  + +   +++ +G +I   +  +     G                    D+
Sbjct: 121 RLSDVFGRLQMFVVGTILYVVGTIIQSQAHDVKVYAVGAIFYNTGFVGVSLLLILVLSDM 180

Query: 246 VPLRNRALYQGICNF 260
            PLR R  YQ   +F
Sbjct: 181 SPLRWRLFYQFTASF 195

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
            +SW A++Y L+  TF  + G++ DIFG +   I     +AL  L+ G S
Sbjct: 82  QLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFS 131

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 79/190 (41%), Gaps = 8/190 (4%)

Query: 365 YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRT--ILGSSLANWFSMMGMMTTSYFL 422
           Y L +   V    FV++E+  +  P+LP A L +    +LG   A W S  G+    ++ 
Sbjct: 276 YVLLIVGTVFLGVFVFIESRAAY-PLLPFAALSSDAAFVLGCIAAGW-SSFGIWI--FYT 331

Query: 423 PVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQ 482
             +        P     +  P   S    ++  G+ +  T     +L A  A   VG + 
Sbjct: 332 WQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAF-TVGIIL 390

Query: 483 ISLIEPNIAVWRQ-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGC 541
           I+    +   W Q ++ +++  +G+ +      + +  ++PHEHQ    S+     +   
Sbjct: 391 IATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSI 450

Query: 542 TLGVSIGGAI 551
           ++G+ I G I
Sbjct: 451 SIGLGIAGTI 460

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 46/81 (56%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           +++ S++L  +   LD ++ S    +  + ++    +S I+   L+  A+ Q  + ++SD
Sbjct: 69  VLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISIINLVIGASAQVFFARLSD 128

Query: 190 IFGRKPLLIFSNVMFALGCLI 210
           +FGR  LLI + V +++G +I
Sbjct: 129 VFGRLTLLIVATVFYSVGTII 149

>Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)
          Length = 881

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 62/120 (51%), Gaps = 25/120 (20%)

Query: 125 PARIKIIMGSMYLGIFLA----------SLDNTIVST--LLAHIASEFNEMPHISWIAT- 171
           P++ + +M S+Y+G+F+A           L N+I S   + +H+A       H S+ A  
Sbjct: 88  PSQKQSMMMSIYVGVFVAVGGFLFGYDTGLINSITSMNYVKSHVAPN-----HDSFTAQQ 142

Query: 172 -AYLLSSATFQPLYGK-----ISDIFGRKPLLIFSN-VMFALGCLICGLSPGLWCLVAGR 224
            + L+S  +    +G      ISD +GRKP +IFS  V+F++G  +   + G+  L+ GR
Sbjct: 143 MSILVSFLSLGTFFGALTAPFISDSYGRKPTIIFSTLVIFSIGNSLQVGAGGITLLIVGR 202

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 72/182 (39%), Gaps = 10/182 (5%)

Query: 135 MYLGIF--LASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKI----- 187
           + LG+F   A + + I  ++++  + E N+M H+S    + + S      + G I     
Sbjct: 95  LMLGVFASFAGILSGIDQSIISGASIEMNKMLHLSSHEASLVSSLMPLGAVAGSILLTPF 154

Query: 188 SDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVP 247
           S++ GRK  L+ S   + +G +IC  +  +  + AGRF                  + VP
Sbjct: 155 SEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFFIGVGVGLEGGGIGVYIAECVP 214

Query: 248 LRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWRVAFLIQIPLCAISCSLIVAYLEL 307
              R     +  F               F E  GGWR  F++   L   S  L +  L L
Sbjct: 215 STVRGRLVSLYQFNIALGELFGYIVGVIFFEVHGGWR--FMVGSSLI-FSTLLFIGLLFL 271

Query: 308 PK 309
           P+
Sbjct: 272 PE 273

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%), Gaps = 15/125 (12%)

Query: 105 AKTIDLETSSIEAKNNTGLSPARIK--------IIMGSMYLGIF-------LASLDNTIV 149
           A+   LE   +E KN  G S   ++        ++  ++++GI         A L  +I 
Sbjct: 3   AELESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIA 62

Query: 150 STLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCL 209
              +   +   +    +SW + AY L+  TF  + G++ D+FG K L +   + ++L  L
Sbjct: 63  PVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSL 122

Query: 210 ICGLS 214
           + G S
Sbjct: 123 LAGFS 127

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 78/190 (41%), Gaps = 8/190 (4%)

Query: 365 YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRT--ILGSSLANWFSMMGMMTTSYFL 422
           YAL +   V    F  +E+  ++ P+LP A L      +LG   A W S  G+    ++ 
Sbjct: 271 YALLIVGFVFLLVFSLIESR-ARFPLLPFAALSTDLAYVLGCIAAGW-SSFGIWI--FYF 326

Query: 423 PVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQ 482
             +     +  P     + +P   S    +L  GY +        +L+A  A  V G L 
Sbjct: 327 WQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVL- 385

Query: 483 ISLIEPNIAVWRQ-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGC 541
           ++    N   W Q ++ L+I  +G+ +      + +  A+PHEHQ    S+     +   
Sbjct: 386 VATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSI 445

Query: 542 TLGVSIGGAI 551
           +L +   G I
Sbjct: 446 SLALGFAGTI 455

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 5/121 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNE----MP 164
           D + +S+    N  LSP  I +   +   G F+   D   +S+ L  I ++ +       
Sbjct: 68  DEDDTSVMITFNQSLSPFIIILTFVASISG-FMFGYDTGYISSALISIGTDLDNKVLTYR 126

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
               +  A  L +       G  +D+FGRK  L+ SN+MF +G ++   +   W + AGR
Sbjct: 127 EKEIVTAATSLGALITSIFAGTAADVFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAAGR 186

Query: 225 F 225
            
Sbjct: 187 L 187

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
            +SW A AY L+  TF  + G++ D++G K   I     +AL  L+ G S
Sbjct: 84  QLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFS 133

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 81/190 (42%), Gaps = 8/190 (4%)

Query: 365 YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRT--ILGSSLANWFSMMGMMTTSYFL 422
           Y+L +   V    F ++E+  +  P+LP++ L +    +LG   A W S  G+    Y+ 
Sbjct: 277 YSLLIVSAVFLCVFAFIESR-APHPLLPLSALSSDAAFVLGCVGAGW-SSFGIWI--YYF 332

Query: 423 PVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQ 482
            ++   +    P     +  P   S    +L  G+ + +      +L A  A   VG + 
Sbjct: 333 WLFLEELRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAF-TVGGIL 391

Query: 483 ISLIEPNIAVWRQ-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGC 541
           I+        W Q ++ +++  +G+ +      + +  ++PHEHQ    S+     +   
Sbjct: 392 IATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSI 451

Query: 542 TLGVSIGGAI 551
           ++G+ + G +
Sbjct: 452 SIGLGLAGTV 461

>ZYRO0D01672g Chr4 (134493..135791) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47159 Saccharomyces cerevisiae YJR124C
           Hypothetical ORF
          Length = 432

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 51/103 (49%), Gaps = 4/103 (3%)

Query: 124 SPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPL 183
           SP  IK++ GS++L +    + N I++  L  I  + +E   I W  +  L+       +
Sbjct: 10  SPRDIKLLWGSVFLRLLSYGITNQILTLFLNAI--QMSE-SQIGWFMSLTLVGDVVCSYV 66

Query: 184 YGKISDIFGRKPLLIFSNVMFAL-GCLICGLSPGLWCLVAGRF 225
               +DI+GR+ +L++ +VM  L G + C  +   W L+   F
Sbjct: 67  LTWYADIWGRRTVLVYGSVMMVLSGLVFCFSTNFYWLLIFAIF 109

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 43/81 (53%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           +I+ + +L  F  SLD T+ ST   +  + + E   +S I     + S   Q ++ ++SD
Sbjct: 59  LILSTAFLCGFGFSLDATLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSD 118

Query: 190 IFGRKPLLIFSNVMFALGCLI 210
            FGR  L   +++++ +G ++
Sbjct: 119 YFGRLELFTVASILYIIGTIV 139

>YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}
           ITR1Myo-inositol transporter with strong similarity to
           the minor myo-inositol transporter Itr2p, member of the
           sugar transporter superfamily; expression is repressed
           by inositol and choline via Opi1p and derepressed via
           Ino2p and Ino4p
          Length = 584

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 52/121 (42%), Gaps = 5/121 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNE----MP 164
           D + +S+    N  LSP  I +   +   G F+   D   +S+ L  I ++ +       
Sbjct: 68  DEDDTSVMITFNQSLSPFIITLTFVASISG-FMFGYDTGYISSALISIGTDLDHKVLTYG 126

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
               +  A  L +       G  +DIFGRK  L+ SN+MF +G ++   +   W +  GR
Sbjct: 127 EKEIVTAATSLGALITSIFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGR 186

Query: 225 F 225
            
Sbjct: 187 L 187

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           SW+  ++ L S +F  + G++ DI+G K +L+   +   +  LICGLS
Sbjct: 103 SWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLS 150

>Skud_4.64 Chr4 (108965..111619) [2655 bp, 884 aa] {ON} YDL194W
           (REAL)
          Length = 884

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 21/118 (17%)

Query: 125 PARIKIIMGSMYLGIFLA----------SLDNTIVST--LLAHIASEFNEMPHISWIATA 172
           P + + +M S+Y+G+F+A           L N+I S   + +H+A   +           
Sbjct: 87  PPQKQSMMMSIYVGVFVAVGGFLFGYDTGLINSITSMKYVKSHVAPNHDSFTAKEMSILV 146

Query: 173 YLLSSATFQPLYGK-----ISDIFGRKPLLIFSN-VMFALGCLICGLSPGLWCLVAGR 224
             LS  TF   +G      ISD +GRKP +IFS  V+F++G  +   + G+  L+ GR
Sbjct: 147 SFLSLGTF---FGALTAPFISDSYGRKPTIIFSTLVIFSIGNSLQVGAGGITLLIVGR 201

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S++L  +   LD  I  T  A+  S +++   +S +     + +A  Q  + ++SDIFGR
Sbjct: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135

Query: 194 KPLLIFSNVMFALGCLI 210
             ++I S + +++G +I
Sbjct: 136 FSIMIVSIIFYSMGTII 152

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 81/190 (42%), Gaps = 21/190 (11%)

Query: 378 FVYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTD 436
           F+  E+  +++PI P   L++R I  +  +A   + +  M   Y   +    V N   T 
Sbjct: 343 FIAWESKWAREPIAPFKLLRDRGIWAALCIAFLINFIFTMAAGYLYTILMVAV-NESVTS 401

Query: 437 MGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVV----------GQLQISLI 486
             + +  S F++ + S     ++ +  + K  ++A C+L +V          GQ     I
Sbjct: 402 ATRISSVSTFTSTVFSPFFALFITRFTRLKPFIIAGCSLWMVAMGILFHFRSGQNSDKGI 461

Query: 487 EPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVS 546
              + VW         G G ++      +++ +   HE+ A  T++SY     G  +G +
Sbjct: 462 IGALVVW---------GLGTTMFTYPVTVSLQSVTSHENMATVTALSYTMYRIGSAVGSA 512

Query: 547 IGGAIFRKSL 556
           + GAI+ + L
Sbjct: 513 VSGAIWTQLL 522

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 88/212 (41%), Gaps = 25/212 (11%)

Query: 106 KTIDLETSSIEAKNNTGLSPARIKIIMGSM--YLGIFLASLDNTIVSTLLAHIASEFNEM 163
           K+++ E    E KN       R+ I++G+   + GI L+ +D +I+S   A I    N+M
Sbjct: 85  KSVEFEVD-FENKN-------RMVIMLGAFAAFAGI-LSGIDQSIISG--ASIG--MNKM 131

Query: 164 PHISWIATAYLLSSATFQPLYGK------ISDIFGRKPLLIFSNVMFALGCLICGLSPGL 217
            H++    A L+SS     L G       +S+ FGRK  L+ S + + +G ++C  +   
Sbjct: 132 LHLT-KHQASLVSSLMPWVLVGGSILLTPLSETFGRKKALVMSCIFYTVGAIVCAAAGNH 190

Query: 218 WCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGICNFFFXXXXXXXXXXXXWFS 277
             + AGRF                  + VP   R     +  F               F 
Sbjct: 191 HEMYAGRFLIGVGVGIEGGGIGVYIAESVPSSVRGSLVSLYQFNIALGELFGYIVGVIFF 250

Query: 278 EHGGGWRVAFLIQIPLCAISCSLIVAYLELPK 309
           +  GGWR  +++   L   S  L++  L LP+
Sbjct: 251 DVKGGWR--YMVGSSLV-FSTILLIGLLFLPE 279

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 151 TLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCL 209
           T++  ++  FN E    +W+  ++ L + +F  + G++ DI+G K +L+   V   +  L
Sbjct: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151

Query: 210 ICGLS 214
           ICGLS
Sbjct: 152 ICGLS 156

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           L+  +SD++GRK    FS  ++ +  + C L+P L CL+A RF
Sbjct: 233 LWSPVSDLYGRKVAYFFSMGLYTIFNIPCALAPNLGCLLACRF 275

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 10/126 (7%)

Query: 95  DSIKKNTVATAKTI----------DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASL 144
           DSIKK TV+               D   ++IE       +P    ++  S++L  +   L
Sbjct: 23  DSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGL 82

Query: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204
           D  I  T  A   S ++E   +S +     + +A  Q  + + SDIFGR  +L  S + +
Sbjct: 83  DGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFY 142

Query: 205 ALGCLI 210
            +G +I
Sbjct: 143 IIGTVI 148

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S +L  F   LD  I    + +  + ++    IS +    ++ SA  Q +Y  +SD+FGR
Sbjct: 76  SAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGVISMVISAVAQVIYAGLSDVFGR 135

Query: 194 KPLLIFSNVMFALGCLI 210
             L I S V + +G +I
Sbjct: 136 LSLFIVSIVFYVVGTII 152

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 112/260 (43%), Gaps = 30/260 (11%)

Query: 376 ATFVYVETYVSKDPILPVAFLKNRTILGSSLANWF-SMMGMMTTSYFLPVYWAGVLNMKP 434
           A F+Y E+ ++  PI P   LK+R I       +  + +  M   Y   +    V     
Sbjct: 331 AIFIYWESKLALAPIAPFKMLKDRGIWAPLWIMFLIAFVYQMAAGYLYTILMVAV---DE 387

Query: 435 TDMGKRTIPSFFS--TALGSLGAGYYMKKTGKYKWLLMAFCALAVV--GQLQISLIEPNI 490
           TD+    I S +S  +A+ +   G+ + ++ + K  ++  C+L  V  G      +  + 
Sbjct: 388 TDLSATRITSLYSFVSAIFAPVLGFIVARSSRLKPYMVLGCSLYFVTMGLFYRYRVGKDA 447

Query: 491 AVWRQYILLVIPGFGL-SVLITVTLLAMIAAV-PHEHQAATTSISYAFRSTGCTLGVSIG 548
               Q ++  +  +G+ S L    +   I +V  HE+ A  T++SY   S G  +  S+ 
Sbjct: 448 ---HQGVIGAMVVWGICSCLFDYPVTVSIQSVTSHENMATVTALSYTIFSIGGAVAASVS 504

Query: 549 GAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSD---YIHDSAPEFVRQALIE 605
           GAI+ +    LL   +++   D    E        AA+SS    Y+       +R A++E
Sbjct: 505 GAIWTQ----LLYPKLLEYIGDADLAE--------AAYSSPLTFYLDYPWGTPIRDAMVE 552

Query: 606 SYHFACRNTYKFCLASIFCA 625
           +Y    +  Y+  +A +F A
Sbjct: 553 AYKHVQK--YEVLIALVFTA 570

>ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {ON}
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively and similar to YDR497C uniprot|P30605
           Saccharomyces cerevisiae YDR497C ITR1 Myo-inositol
           transporter with strong similarity to the minor myo-
           inositol transporter Itr2p, member of the sugar
           transporter superfamily; expression is repressed by
           inositol and choline via Opi1p and derepressed via Ino2p
           and Ino4p
          Length = 593

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
           G ++DI GRKP ++ SNVMF +G ++   +   W + AGR
Sbjct: 155 GIVADIIGRKPSIMASNVMFLVGIVLQVCAHKYWQMAAGR 194

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 102/259 (39%), Gaps = 39/259 (15%)

Query: 371 IVVGGA---TFVYVETYVSKDPILPVAFLKNRTI---LGSSLANWFSMMGMMTTSYFLPV 424
           +V GG     F++ E   + +P+LP   LK+R I   LG +  N+F+    +   +  PV
Sbjct: 177 LVSGGVLFLIFMFWEASYAHNPLLPFKLLKDRGIWAPLGVAFFNYFTFY--IACDFLYPV 234

Query: 425 YWAGVLNMKPTDMGK-RTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQI 483
                +N   T   +   +P F    + S  + +Y     K K L ++         L +
Sbjct: 235 LLVS-MNESSTSAARILNLPDF----VASTASPFYSLLIAKSKRLKISVIVGCATWMLSM 289

Query: 484 SLIE-------PNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAF 536
            L          +  V    +++   G   S  + V L AM     H   A  T I Y F
Sbjct: 290 GLFYRFRGGYGSHGGVISASVIMGFSGLLCSNSVIVLLQAMTT---HSRMAVMTGIHYTF 346

Query: 537 RSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDY-IHDSA 595
              G  +G S+ G ++ +++ S L +    L +D    E         A+ S Y   DS 
Sbjct: 347 SRIGAAVGASVSGGVWTQTMPSRLYK---LLGNDTLAAE---------AYESPYSFIDSY 394

Query: 596 P--EFVRQALIESYHFACR 612
           P     R A++E+Y +  R
Sbjct: 395 PWGTVERYAVVEAYKYVQR 413

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S++L  +   LD  I  T  A+  S +++   +S +     + +A  Q  + ++SDIFGR
Sbjct: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135

Query: 194 KPLLIFSNVMFALGCLI 210
             ++I S + +++G +I
Sbjct: 136 FSIMIVSVIFYSVGTII 152

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 53/128 (41%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           +++ +++L  +   L   I  ++  + A+ F +   +  I T   + S+     Y ++SD
Sbjct: 60  VLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARMSD 119

Query: 190 IFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLR 249
            FGR    IF+ V++ +G +I   +P    L AG                    D+  LR
Sbjct: 120 RFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSGLR 179

Query: 250 NRALYQGI 257
           +R     I
Sbjct: 180 DRTFAMNI 187

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 38.1 bits (87), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 51/108 (47%)

Query: 103 ATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNE 162
           + +K  D    +IE   +   SP     +  S++L  +   LD  I  T  A+  S +++
Sbjct: 26  SDSKGKDAGVHNIEIYADQYKSPYYRVALFFSIFLVAYAYGLDGNIRYTFQAYATSSYSQ 85

Query: 163 MPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
              IS +     + +A  Q  + + SD+FGR  +LI + + + +G +I
Sbjct: 86  HSLISTVNCIKTVIAAAGQICFARASDVFGRLSILIIAVLFYVVGTVI 133

>Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 5/121 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNE----MP 164
           D + +S+    N  LSP  I +   +   G F+   D   +S+ L  I ++ +       
Sbjct: 68  DEDDTSVMITFNQSLSPFIITLTFVASISG-FMFGYDTGYISSALISIGTDLDNKVLTYG 126

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
               +  A  L +       G  +D+FGRK  L+ SN+MF +G ++   +   W +  GR
Sbjct: 127 EKEIVTAATSLGALITSIFAGTAADLFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGR 186

Query: 225 F 225
            
Sbjct: 187 L 187

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 70/167 (41%), Gaps = 4/167 (2%)

Query: 95  DSIKKNTVATAKTIDLET---SSIEAKNNTGLSPARIKI-IMGSMYLGIFLASLDNTIVS 150
            +++K+T +  + ID      S   +    G++ + +K  ++ +++L  +   L   I  
Sbjct: 26  SNVEKSTTSGLRRIDAVNKVLSDYSSFTAFGVTFSSLKTALLVALFLQGYCTGLGGQISQ 85

Query: 151 TLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
           ++  + A+ F +   +  I T   + ++     Y +ISD FGR    IF+ V++ +G +I
Sbjct: 86  SIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARISDRFGRIECWIFALVLYTIGEII 145

Query: 211 CGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIVPLRNRALYQGI 257
              +P    L AG                    D+  LR+R     I
Sbjct: 146 SAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDRTFAMNI 192

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S++L  +   LD  I  T  A+  S +++   +S +     + +A  Q  + ++SDIFGR
Sbjct: 76  SIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135

Query: 194 KPLLIFSNVMFALGCLI 210
             +L+ S + +++G +I
Sbjct: 136 FSILVISVIFYSVGTII 152

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 124 SPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFN-EMPHISWIATAYLLSSATFQP 182
           S  ++ I M  ++LG     L+   V +++  +   +  E    SW  T+Y ++ A    
Sbjct: 26  SKYQLIINMALIFLGCTFDLLNVAGVISVIEDLGETYGLEYTTASWALTSYAITFAGLIA 85

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGL 213
             G++ DI G   L   S   F+L CL+C +
Sbjct: 86  FMGRLGDIIGNSVLFTISGFFFSLFCLLCAV 116

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S++L  +   LD  + S+L A+  S +     ++ I     + +A  Q  + + SDIFGR
Sbjct: 69  SLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLATINCVKAVIAAAGQICFARASDIFGR 128

Query: 194 KPLLIFSNVMFALGCLI 210
             +L  + V++A+G +I
Sbjct: 129 MTILALAVVLYAVGTII 145

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S++L  +   LD  I  T  A+  S +++   +S +     + +A  Q  + ++SDIFGR
Sbjct: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135

Query: 194 KPLLIFSNVMFALGCLI 210
             +L+ S + + +G +I
Sbjct: 136 FSILVISVIFYIMGTVI 152

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 113/285 (39%), Gaps = 31/285 (10%)

Query: 369 VAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWF-SMMGMMTTSYFLPVYWA 427
           +  VV    ++  E   S+ P+ P   +K+R I  + L  +F +    M   Y   V   
Sbjct: 323 IGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAFFINFNWYMQGDYMYTVLIV 382

Query: 428 GVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYK-WLLMAFCALAVVGQLQISLI 486
            V     +     ++ SF S  +G++  G+ + K  + K ++L       V   L +   
Sbjct: 383 AVHESIKSATRITSLYSFVSVIVGTI-LGFILIKVRRTKPFILFGISCWIVSFGLLVHYR 441

Query: 487 EPNIAVWRQYILLVIPGFGLSVLITVTLLAMIA-AVPHEHQAATTSISYAFRSTGCTLGV 545
             + A       L + GFG      VT  ++ A A  H   A  TS+  A  + G   G 
Sbjct: 442 GDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIGSAFGS 501

Query: 546 SIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHD-----SAPEFVR 600
           S+ GA++     ++L R + K  SD          + + A+ S +          PE  R
Sbjct: 502 SVSGAVWT----NILPREISKRISD--------PTLAAQAYGSPFTFIITYTWGTPE--R 547

Query: 601 QALIESYHFA----CRNTYKFCLASIFCALLSCIAVKEYKLHTSM 641
            AL+ SY +     C     FC   + CAL+    ++ +KL  S+
Sbjct: 548 IALVMSYRYVQKILCIIGLVFCFPLLGCALM----LRNHKLTDSI 588

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 147 TIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFAL 206
           +I++ L     SE N     SW+  ++ L S +F  + G++ DI+G K +L+   V+  +
Sbjct: 91  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147

Query: 207 GCLICGLS 214
             LICG++
Sbjct: 148 WSLICGIT 155

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 147 TIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFAL 206
           +I++ L     SE N     SW+  ++ L S +F  + G++ DI+G K +L+   V+  +
Sbjct: 94  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150

Query: 207 GCLICGLS 214
             LICG++
Sbjct: 151 WSLICGIT 158

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 146 NTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFA 205
           N +   L   + ++ ++ P   W+  ++ L S +F  + GK+ DI+G K  L+   V+  
Sbjct: 72  NPLFDVLSKDLNAKVSQQP---WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVV 128

Query: 206 LGCLICGLS 214
           +  LICGLS
Sbjct: 129 IWSLICGLS 137

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
            +SW A+A+ L+  TF  + G++ D FG K   +   + +AL  ++ G S
Sbjct: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFS 117

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 86/195 (44%), Gaps = 18/195 (9%)

Query: 365 YALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTI--LGSSLANWFSMMGMMTTSYFL 422
           YAL +      A F ++E+  +K P+LPV  L + TI  +G   A W        +S+ +
Sbjct: 261 YALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIFVMGCIAAGW--------SSFGI 311

Query: 423 PVY--WAGVLNMK---PTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAV 477
            VY  W  + N++   P     + +P   S    ++   + + +T     +++A  A   
Sbjct: 312 WVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAF-T 370

Query: 478 VGQLQISLIEPNIAVWRQ-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAF 536
           VG + ++ +  +   W Q ++ +++  +G+ +      + +  A+P  HQ    S+    
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 537 RSTGCTLGVSIGGAI 551
            +   ++G+   G I
Sbjct: 431 INYSISIGLGFAGTI 445

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 47/103 (45%)

Query: 108 IDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHIS 167
           +D    +IE       SP     +  S++L  +   LD  +  T  ++  S + +   +S
Sbjct: 50  VDAGVHNIEVYAEQYSSPIHRFALFFSIFLVAYAYGLDGQVRYTYQSYATSSYAQHSLLS 109

Query: 168 WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
            +     + +A  Q  Y + SDIFGR  +L+   + +++G +I
Sbjct: 110 TVNCITTVIAAAGQICYARASDIFGRMTILVIGVIFYSMGTII 152

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 51/100 (51%), Gaps = 3/100 (3%)

Query: 111 ETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIA 170
           +T  + ++ NT  S     + +   +L  +  SLD++I    + +  + +N    +S I+
Sbjct: 59  KTEIMASQYNTWYSQV---LFLSCAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTIS 115

Query: 171 TAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
              ++ SA  Q  +  +SD+FGR  L+I + + + +G +I
Sbjct: 116 IINMMISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVI 155

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 54/251 (21%), Positives = 98/251 (39%), Gaps = 18/251 (7%)

Query: 379 VYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDM 437
           +Y E+  +K P  P   LK+R I    S+      +  M   Y   +    +++M  T++
Sbjct: 337 IYWESNWAKVPFAPFLLLKDRGIWAPMSIMFLVCFIYQMAAGYLYTIL---LVSMNQTEL 393

Query: 438 GKRTIPSFFSTALGSLGA--GYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQ 495
               I + +S   G      G+ + +TG+ K  ++  C L  +           +     
Sbjct: 394 SATRIMNLYSFVAGIYSPIFGFVVARTGRLKSFMLVGCCLYFLVMGLFYRYRGGLGAESG 453

Query: 496 YI-LLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRK 554
            I  +V+ G    +       +  +   HE+ A  T++       G  +G S+ GAI+  
Sbjct: 454 IIGAMVVWGIASCMYTYPVTTSAQSVTSHENMATVTAMLLTIFRIGGAVGASVSGAIWTN 513

Query: 555 SLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNT 614
            L   L +N+  +        ELA    +A  +    H    E VR A+I++Y    +  
Sbjct: 514 LLYPKLLQNLGDV--------ELASAAYTAPLTFIVSHPWNTE-VRTAMIDAYRHVQK-- 562

Query: 615 YKFCLASIFCA 625
           Y+  +  IF A
Sbjct: 563 YEVLVGLIFVA 573

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           L+  +SD++GR+    FS  ++ +  + C L+P L CL+A RF
Sbjct: 231 LWSPVSDLYGRRVAYFFSMGLYVIFNIPCALAPNLGCLLACRF 273

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 57/131 (43%), Gaps = 6/131 (4%)

Query: 438 GKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYI 497
           G   IP   +  + ++ +G   KK G  K LL+    L V+G   ++L+        Q  
Sbjct: 249 GLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTSTKSTQIG 308

Query: 498 LLVIPGFGLSVLITVTLLAMIAAVPHEHQAA------TTSISYAFRSTGCTLGVSIGGAI 551
           +L++PGF L   +  +L++    +  +   A       T+ +   +S G TLG  +   +
Sbjct: 309 VLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLGTTLGGVLSTTV 368

Query: 552 FRKSLGSLLER 562
           F  S  + + R
Sbjct: 369 FSASFHNKVSR 379

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 52/120 (43%), Gaps = 5/120 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNE----MP 164
           D + +S+    N  +SP  I +   +   G FL   D   +S+ L  I ++ +       
Sbjct: 52  DEDDTSVMITFNQKVSPFIIILTFVASISG-FLFGYDTGYISSALISIGTDLDNRVLTYG 110

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
               I  A  L +       G  +DI+GRKP L+ SN+ F +G ++   +   W +  GR
Sbjct: 111 DKEIITAATSLGALISAVAAGTCADIWGRKPCLMISNLFFVIGAVLQVSASTFWQMAVGR 170

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 162 EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGL 213
           E    SW  TAY ++ A F    G++ DI G   L + S  +F++  LIC +
Sbjct: 58  EFTTASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAV 109

>Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {ON}
           YDR497C (REAL)
          Length = 579

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 51/121 (42%), Gaps = 5/121 (4%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNE----MP 164
           D + +S+    N  +SP  I +   +   G FL   D   +S+ L  I ++ +       
Sbjct: 64  DEDDTSVMITFNQSISPFIIILTFVASISG-FLFGYDTGYISSALISIGTDLDNKVLTYG 122

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
               I  A  L +       G  +DI+GRK  L+ SN MF +G ++   +   W +  GR
Sbjct: 123 EKEIITAATSLGALITSIFAGTAADIYGRKRCLMGSNFMFVIGAILQVSAHTFWQMAVGR 182

Query: 225 F 225
            
Sbjct: 183 L 183

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 118 KNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFN-EMPHISWIATAYLLS 176
           +N    S  ++ + +  ++LG     L+   + +L+  +A +++      SW  T+Y ++
Sbjct: 17  RNRCQKSTYQLNVNVALIFLGCTFDLLNVASMISLIDDLAQKYDISYTTASWSLTSYAVT 76

Query: 177 SATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSP 215
            A F    G++ DI G   L   S   FA+  L+C + P
Sbjct: 77  FAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVMP 115

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+  ++ L S +F  + G++ DI+G K +L    V+  +  LICGL+
Sbjct: 109 TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLT 156

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 77/188 (40%), Gaps = 6/188 (3%)

Query: 367 LCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSM--MGMMTTSYFLPV 424
           L V  VV    F+  E   +K P+LP A LK+R ++   LA +F     G+ T  YF   
Sbjct: 301 LLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQ-- 358

Query: 425 YWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQIS 484
           +   + +      G           + +L  G Y+KK     +L ++  A   +G +  S
Sbjct: 359 FQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFN-IGSIMAS 417

Query: 485 LIEPNIAVWR-QYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTL 543
           +   +   +R Q   ++I  FG+      + +     +P E+Q    S+     +   +L
Sbjct: 418 VTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSL 477

Query: 544 GVSIGGAI 551
            + +G  +
Sbjct: 478 CLGMGATV 485

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           L+  +SD++GR+    FS  ++ +  + C ++P L CL+A RF
Sbjct: 245 LWSPVSDLYGRRVAYFFSMGLYVIFNIPCAIAPNLGCLLACRF 287

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 140 FLASLDNTIVSTLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLI 198
           F +SL + I    L  +  EFN +   ++     YLL       + G ++D+FGR+P+++
Sbjct: 112 FWSSLGSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIIL 171

Query: 199 FSNVMFALGC--LICGLSPGLWCLV 221
              V++ +    L C  S G+ C +
Sbjct: 172 GGMVIYVVASIGLACAPSYGVICFL 196

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 47/102 (46%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISW 168
           D    +IE        P    ++  S++L  +   LD  I  T  A+  S +++   +S 
Sbjct: 38  DAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRYTYQAYATSSYSQHSLLST 97

Query: 169 IATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
           +     + +A  Q  + + SDIFGR  +LI + + + +G +I
Sbjct: 98  VNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTII 139

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 54/111 (48%), Gaps = 1/111 (0%)

Query: 106 KTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFN-EMP 164
           K   L  + ++ +     S   + + +  ++LG  +  ++ + + +L+  ++++++    
Sbjct: 5   KDKKLPQAILKLRTKCQTSTVNLNVNVALIFLGCSIDLINVSSMISLIDELSTKYSISYT 64

Query: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSP 215
             SW  T+Y ++ A F    G++ DI G   L   S   FA+  L+CGL P
Sbjct: 65  TASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCGLMP 115

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+  ++ L S +F  + GKI DI+G K  L+   V+  +  LICGL+
Sbjct: 93  TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 51/111 (45%), Gaps = 2/111 (1%)

Query: 100 NTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASE 159
           + +   K+I +  S + AK         + ++  + ++  F   LD+ I    + +   +
Sbjct: 43  DKLQVTKSIIIRKSELMAKQYDSWFSKSVFLL--AAFICSFAYGLDSIIRDIYMTYAMDD 100

Query: 160 FNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
           + E   +S +    L+ SA  Q  +  +SD+FGR  L + + + + +G +I
Sbjct: 101 YAEHSLLSTVNVVSLMISAVGQIFFAGLSDVFGRLSLFVVAIIFYVVGTII 151

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 137 LGIFLASLDNTIVSTLLAHIASEF-NEMPHISWIATAYLLSSATFQPLYGKISDIFGRKP 195
           +G  L     T   +++  IA +F +E    +W+  ++ L S +F  + G+  DI+G K 
Sbjct: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145

Query: 196 LLIFSNVMFALGCLICGLS 214
           +L+    +  +  +ICGL+
Sbjct: 146 MLLLGYAILTIWSIICGLT 164

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 13/127 (10%)

Query: 111 ETSSIEAKNNTGLSPARIKIIMGSMYLGIF---LASLDNTIVSTLLAHIASEFNEMPHIS 167
           E+ S+E KN++  +P          Y  IF   L+ L N   +T    I +      H S
Sbjct: 31  ESPSMELKNSSLRNPDYFNSTTQE-YAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSS 89

Query: 168 -----WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS----PGLW 218
                W+  ++ L S +F  + G++ DI+G K +LI   V+  +  LI GLS     G++
Sbjct: 90  DSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIF 149

Query: 219 CLVAGRF 225
            ++A  F
Sbjct: 150 FIIARAF 156

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           ++  +SD++GR+    FS  ++ +  + C L+P L CL+A RF
Sbjct: 237 IWSPVSDLYGRQVAYFFSMGLYVIFNIPCALAPNLGCLLACRF 279

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 53/129 (41%), Gaps = 17/129 (13%)

Query: 99  KNTVAT---AKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASL----------- 144
           KN V     +K  D+E  S +    T     R   +M   Y   FL SL           
Sbjct: 23  KNIVVEKLFSKNADMEQESPDTFEVTESIVIRKAELMAKQYDSWFLKSLFLFTVFICSFA 82

Query: 145 ---DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSN 201
              D+ I    + +  + +     +S +    ++ SA  Q  + ++SD+FGR  L I S 
Sbjct: 83  YGLDSIIRDIYMTYAMNAYETHSLLSTVNVISMVISAVGQIFFARLSDVFGRLSLFIVSI 142

Query: 202 VMFALGCLI 210
           V++ +G +I
Sbjct: 143 VLYVVGTVI 151

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 58/137 (42%), Gaps = 1/137 (0%)

Query: 122 GLSPARIKI-IMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATF 180
           G++   +KI ++ +++L  +   L   I  ++  + A+ F +   +  I T   + ++  
Sbjct: 55  GITFNSLKITLLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVV 114

Query: 181 QPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXX 240
              Y ++SD FGR    +F+ V++ +G +I   +P    L AG                 
Sbjct: 115 AVPYARMSDRFGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATA 174

Query: 241 XXXDIVPLRNRALYQGI 257
              D+  LR+R     I
Sbjct: 175 LTGDLSGLRDRTFAMNI 191

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 60/143 (41%), Gaps = 12/143 (8%)

Query: 501 IPGFGLSVLITVTLLAMIAAVPHEHQ--AATTSISYAFRSTGCTLGVSIGGAIFRKSLGS 558
           + GFG    I   L A + A  + HQ  A  T++  A  + G   G ++ GAI+   L  
Sbjct: 460 LSGFGYG-FIKSPLKASLQASSNSHQNLAIVTALFLAIGNIGTAFGAAVAGAIWSNLLPH 518

Query: 559 LLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFC 618
            LE+++  +       +   K I        Y   +A   VRQ L+ SY    R     C
Sbjct: 519 RLEKSIGNVTLADSAFDSPIKFI------KQYKWHTA---VRQHLVSSYGSVWRILNIVC 569

Query: 619 LASIFCALLSCIAVKEYKLHTSM 641
           L  +   L+S   +++ KL  S+
Sbjct: 570 LVLVIPMLVSSFLLRDRKLSNSV 592

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+  A+ L S +F  + G+I DI+G K  L+   +   +  LICGL+
Sbjct: 102 AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 85/215 (39%), Gaps = 14/215 (6%)

Query: 378 FVYVETYVSKDPILPVAFLKNRTILGSSLANWF-SMMGMMTTSYFLPVYWAGVLNMKPTD 436
           F+  E  ++K P+L + +LK+R +     A++F S   ++ T Y   V   G    +   
Sbjct: 340 FLLWEGKIAKRPVLALTYLKDRGVWAPLAASFFMSNAYLIATDYLYAVLLVGFNQSESAS 399

Query: 437 MGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVG-QLQISLIEPNIAVWRQ 495
                +PSF    +     G  + +    K L +  C    +   L       +  V   
Sbjct: 400 QRITWLPSFAGVVITPF-TGLLITRWKHLKVLTITGCIFYYIAFGLFYRYRGGSTNVAGI 458

Query: 496 YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKS 555
            +  +  GFG  +     ++++ A   H   A  T++ Y F   G  +G SI GAI+ + 
Sbjct: 459 IVGTIFMGFGSGISTYPLMVSLQAVSSHTKIAIVTALFYTFEQVGRAVGSSISGAIWTQV 518

Query: 556 LGSLLERNVMKLASDKHPREELAKIIDSAAHSSDY 590
           +         K  S + P E    +   AA++S Y
Sbjct: 519 M--------FKEISKRLPEEPEVAL---AAYASPY 542

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+  ++ L S +F  + GK+ DI+G K  L+    +  +  LICGLS
Sbjct: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 85/188 (45%), Gaps = 22/188 (11%)

Query: 378 FVYVETYVSKDPILPVAFLKNRT---ILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMK- 433
           F+  E   +K+P+LP A L NR    IL S    W S  G+ T  Y      A VLN++ 
Sbjct: 292 FIIFEARFAKEPLLPRAVLFNRKLMMILASLFLGWGS-FGIWTYYYM-----AFVLNLRH 345

Query: 434 --PTDMGKRTIPSFFSTAL-GSLGA---GYYMKKTGKYKWLLMAFCALAVVGQLQISLIE 487
             P   G     S+F  A+ G++ A   G+ + KTG    LL +  A   VG + +S+  
Sbjct: 346 YTPLWAGG----SYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFD-VGCIMLSVTP 400

Query: 488 PNIAVWRQYI-LLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVS 546
            +   +R  +  +VI  FG+ +    + + +   +P ++Q    S+     +   +L + 
Sbjct: 401 VDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLG 460

Query: 547 IGGAIFRK 554
           + G   R+
Sbjct: 461 VSGTAERQ 468

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%)

Query: 144 LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVM 203
           LD    S    +  S +NE   +S I     + S   Q ++ ++SDIFGR  L +   V+
Sbjct: 93  LDYITRSVYTGYATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFLVGTVL 152

Query: 204 FALGCLI 210
           + +G +I
Sbjct: 153 YIVGTII 159

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 85/206 (41%), Gaps = 26/206 (12%)

Query: 366 ALCVAIVVGGATFVYV---ETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTS-YF 421
            +   IVVG  +F++    +   +K+ +LP   LK+R +  S  A     +   T S Y 
Sbjct: 324 GIIATIVVGFVSFMFFLAWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATISDYL 383

Query: 422 LPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQL 481
            PV    V     +      +P+F +   GS+  G  + +T + K         +++G  
Sbjct: 384 YPVLLVSVNESSKSATRILWLPTFVACT-GSIFFGLLVVRTKRLK-------IYSIIG-- 433

Query: 482 QISLIEPNIAVWRQYI-----------LLVIPGFGLSVLITVTLLAMIAAVPHEHQAATT 530
            + L   +I ++  Y              V+ G G ++     ++ +     H++ A+ T
Sbjct: 434 -VCLWILSIGLFYHYRGGASSHSGIIGASVVLGTGSAIFTQSLIVNLQTMTSHKNMASIT 492

Query: 531 SISYAFRSTGCTLGVSIGGAIFRKSL 556
            + + F   G   G SI GAI+ +++
Sbjct: 493 GLYFMFAQIGSASGASISGAIWTQTM 518

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 57/131 (43%), Gaps = 10/131 (7%)

Query: 93  GYDSIKKNTVATAKTIDLETSSIEAKNN---TGLSPARIKIIMGSMYLGIFLASLDNTIV 149
           G DS K   +       +E +   ++N    T LS  +   ++  + +  F +SL + I 
Sbjct: 24  GDDSTKHGDMVMTNDKPIENNGTISRNEAPYTLLSYGQKWGMVALLTMCTFWSSLGSPIY 83

Query: 150 STLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGC 208
              L  +  EFN +   ++     YLL         G ++DI+GR+P+++   +++    
Sbjct: 84  YPALRQLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYV--- 140

Query: 209 LICGLSPGLWC 219
               +S GL C
Sbjct: 141 ---AVSVGLAC 148

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%)

Query: 135 MYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRK 194
           ++L  +   LD  + +T      S + +   +S +     + SA  Q  + +  DIFGR 
Sbjct: 73  LFLVAYAYGLDTRVRTTFATDATSSYKKHTLMSTVTCIKTIISAAGQIGFARSCDIFGRT 132

Query: 195 PLLIFSNVMFALGCLI 210
            + +FS +++A+G ++
Sbjct: 133 SIFVFSIILYAVGTIV 148

>NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON} 
          Length = 163

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 52/112 (46%), Gaps = 16/112 (14%)

Query: 519 AAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELA 578
           AA  HEH A  T+++Y     G  +G +I G I+ + L   + + +    S         
Sbjct: 12  AATSHEHMATVTALTYTVYRIGSAVGSAISGCIWTQKLYPEILKRLGGNVS--------- 62

Query: 579 KIIDSAAHSSDYIHDSAPEF---VRQALIESYHFACRNTYKFCLASIFCALL 627
             + +AA++S Y   +   +    R+A++E+Y +      +  +A +FCA L
Sbjct: 63  --MATAAYASPYTFITTYTWGTSEREAVVEAYKYV--QKLETVVALVFCAPL 110

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 68/141 (48%), Gaps = 23/141 (16%)

Query: 90  NASGYDSIKK--NTVATAKTIDLETSSIEAKNN--------------TGLSPARIKIIMG 133
           N +G D I K   T++  +T ++E S +E+ ++              T  S ++  I++G
Sbjct: 48  NGNG-DGIYKVDGTLSRTQTREVEESDLESADDVKTIKDSQEYVAPYTLFSYSQKWIMVG 106

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFG 192
            + +  F +SL + I    L  +  +F+ +   ++     YLL       + G ++DI+G
Sbjct: 107 LLTMCGFWSSLGSPIYYPALRQLEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYG 166

Query: 193 RKPLLIFSNVMF-----ALGC 208
           R+P+++F  +++     AL C
Sbjct: 167 RRPVILFGMLVYIVASIALAC 187

>YDL138W Chr4 (213351..215642) [2292 bp, 763 aa] {ON}  RGT2Plasma
           membrane high glucose sensor that regulates glucose
           transport; contains 12 predicted transmembrane segments
           and a long C-terminal tail required for induction of
           hexose transporters; highly similar to Snf3p
          Length = 763

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 62/125 (49%), Gaps = 10/125 (8%)

Query: 110 LETSSIEAKNNTGLSPARIKIIMGS-MYLGIFLASLDNTIVSTLLAHIASEFNEMPHISW 168
           +ET+SI       L    + +++G  + +G FL   D  +++++      +    P+ S+
Sbjct: 80  IETTSILLSQPLPLRSNVMSVLVGIFVAVGGFLFGYDTGLINSITDMPYVKTYIAPNHSY 139

Query: 169 IAT---AYLLSSATFQPLYGK-----ISDIFGRKPLLIFSN-VMFALGCLICGLSPGLWC 219
             T   A L+S  +    +G      ISD +GRKP ++FS  V+F++G  +   S GL  
Sbjct: 140 FTTSQIAILVSFLSLGTFFGALIAPYISDSYGRKPTIMFSTAVIFSIGNSLQVASGGLVL 199

Query: 220 LVAGR 224
           L+ GR
Sbjct: 200 LIVGR 204

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 156 IASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           ++  FN E  + +W+  ++ L++ +F  + G++ DI+G K +LI   V+  +  +I GLS
Sbjct: 97  LSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLS 156

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 186 KISDIFGRKPLLIFSNVMFALGCLIC 211
           KI DI+GRK  +IF NV++ +G LIC
Sbjct: 210 KIGDIYGRKIGIIFMNVIYIIGQLIC 235

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%)

Query: 125 PARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLY 184
           P +  +I  S++L  +   LD    +T +    S + E   +S +     + SA  Q  +
Sbjct: 62  PYQRIMIFFSLFLICYAYGLDKKTRTTYVTLATSSYKEHSLMSTVTCITKVISAAGQIWF 121

Query: 185 GKISDIFGRKPLLIFSNVMFALGCLI 210
            + SDIFGRK +   S + + +G +I
Sbjct: 122 ARASDIFGRKLIFGLSVIFYVIGTVI 147

>Smik_4.97 Chr4 (189933..192236) [2304 bp, 767 aa] {ON} YDL138W
           (REAL)
          Length = 767

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 187 ISDIFGRKPLLIFSN-VMFALGCLICGLSPGLWCLVAGR 224
           ISD +GRKP ++FS  V+F++G  +   S GL  L+ GR
Sbjct: 168 ISDSYGRKPTIMFSTAVIFSIGNSLQVASNGLVLLIVGR 206

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 499 LVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGS 558
           +V+ G G +++   T+++  +   HE+ A  T+I  A    G  +G ++ GAI+ ++L +
Sbjct: 466 MVLWGLGSTMITRTTVISSQSITAHENMATITAIMLAISRIGGGIGSAVSGAIWTQTLYA 525

Query: 559 LLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACR 612
            L   +           E+AK +  +  S+  ++       R A++E+Y    R
Sbjct: 526 KLVETI--------GDPEIAKKVYQSPLSAIRVYAWGTP-TRDAIVEAYRHVQR 570

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 55/121 (45%), Gaps = 8/121 (6%)

Query: 96  SIKKNTVATAKTIDLETSS------IEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIV 149
           SI  N++   K   LE S+      + AK  +  SP R  I+   ++   +   LDN + 
Sbjct: 28  SITTNSLNGEKEPHLEESAGVYNSEVYAKYYS--SPTRRSIVFLCLFFICYAYGLDNKLR 85

Query: 150 STLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCL 209
           S       S + +   +S +     + SA  Q  + + SD+FGR  +LI + + + +G +
Sbjct: 86  SPYQTLATSSYKQHSLLSTVNAIKSVISAAGQIWFARASDLFGRGTILIVAVMFYVVGTI 145

Query: 210 I 210
           +
Sbjct: 146 V 146

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 83/202 (41%), Gaps = 16/202 (7%)

Query: 372 VVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVL- 430
           VV    F+  E   +K P+ P   +K+R +  + +   F    + T  Y    Y   +L 
Sbjct: 319 VVAFPAFLTWEIKFAKYPLTPWKTVKDRGVFSALIIAIF----LQTAFYMQKTYMYTILL 374

Query: 431 -NMKPTDMGKRTIPSFFS--TALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIE 487
             +  T      I S F+  TAL     G  + K  + K  +  F  +AV   L   L+E
Sbjct: 375 VAVNQTKKSATRINSLFTFVTALSGTLLGLVIVKVRRTKEFI--FFGIAV-WFLSFGLLE 431

Query: 488 PNIAVWRQYI----LLVIPGFGLSVLITVTLLAMIA-AVPHEHQAATTSISYAFRSTGCT 542
                   Y      L + GFG   +   T  +M A A+ HE  A  TS+  A  + G +
Sbjct: 432 RYTGGTNAYAGIIAALCLLGFGNGFIKYPTKASMQASALTHEMMAIITSLFMAISTIGTS 491

Query: 543 LGVSIGGAIFRKSLGSLLERNV 564
           +G S+ GAI+   L   +E+ +
Sbjct: 492 VGSSVAGAIWTNVLPDKIEKGL 513

>YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma
           membrane low glucose sensor that regulates glucose
           transport; contains 12 predicted transmembrane segments
           and a long C-terminal tail required for induction of
           hexose transporters; also senses fructose and mannose;
           similar to Rgt2p
          Length = 884

 Score = 34.7 bits (78), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 25/120 (20%)

Query: 125 PARIKIIMGSMYLGIFLA----------SLDNTIVST--LLAHIASEFNEMPHISWIAT- 171
           P + + +M S+ +G+F+A           L N+I S   + +H+A       H S+ A  
Sbjct: 88  PPQKQSMMMSICVGVFVAVGGFLFGYDTGLINSITSMNYVKSHVAPN-----HDSFTAQQ 142

Query: 172 -AYLLSSATFQPLYGK-----ISDIFGRKPLLIFSNV-MFALGCLICGLSPGLWCLVAGR 224
            + L+S  +    +G      ISD +GRKP +IFS + +F++G  +   + G+  L+ GR
Sbjct: 143 MSILVSFLSLGTFFGALTAPFISDSYGRKPTIIFSTIFIFSIGNSLQVGAGGITLLIVGR 202

>Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON}
           YDL199C (REAL)
          Length = 687

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           +Y  + + + RK LL    ++++LG LI   +   WCL+ GRF
Sbjct: 180 VYSGVLETYSRKKLLQIGTMIYSLGALIQVSALNQWCLLLGRF 222

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 44/102 (43%)

Query: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISW 168
           D    +IE  +    +  R  +   S++L  +  +LD  + ST      S +     +S 
Sbjct: 39  DTGVINIEVYSEYYSTTQRRLLFFFSIFLTTYCYTLDKRVRSTFQTEATSSYKNHSLMST 98

Query: 169 IATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLI 210
           +     + SA  Q  Y + +DIFGR  L+  +   + +G ++
Sbjct: 99  VTCITTVISAAGQIAYARAADIFGRTSLVFTAIFFYVIGTVV 140

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 107/264 (40%), Gaps = 25/264 (9%)

Query: 371 IVVGGA---TFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLP---V 424
           IV+G      F+Y E+ ++  P+ P   LK+R I    L     +M ++   Y +P   +
Sbjct: 324 IVLGSVLVLVFIYWESKLALVPLAPFKMLKDRGIWAPLL-----LMFLVCFVYVMPADYL 378

Query: 425 YWAGVLNMKPTDMGKRTIPSFFS--TALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQ 482
           Y   ++    + +    I S +S  TA+ S  AG  + +  + K      CAL  V    
Sbjct: 379 YTILLVAGNESSLSATRITSLYSFVTAVLSAAAGILVTRFPRLKPFAFFGCALYFVTMAL 438

Query: 483 ISLIEPNIAVWRQYI-LLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGC 541
                      +  I  +V+ G           ++M     HE+ A  T++  A    G 
Sbjct: 439 FYCFRGGEDTGKGVIGAMVVWGVASCFFDYPINISMQTVTSHENMATVTALGLAIFRIGG 498

Query: 542 TLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQ 601
            +G ++ GAI+ ++L   L    +K   D     E   +  S     ++     P  VR+
Sbjct: 499 AVGAAVSGAIWTQTLYPRL----LKTLGDPDMAIEAYDMPLSFMLEHEW---GTP--VRE 549

Query: 602 ALIESYHFACRNTYKFCLASIFCA 625
           A+++SY +  +  Y+  +  +F A
Sbjct: 550 AMVDSYRYVQK--YEVLVGLVFVA 571

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 156 IASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           I S FN +    +W+  ++ L S +F  + G+I DI+G K  +I   ++  +  LICG +
Sbjct: 109 IGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFA 168

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 72/164 (43%), Gaps = 19/164 (11%)

Query: 378 FVYVETYVSKDPILPVAFLKNRT---ILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMK- 433
           F+Y E   +K P+LP A   N     IL +    W S  G+ T  Y+     A +LN++ 
Sbjct: 325 FIY-EIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGS-FGIWTFYYY-----AFLLNLRG 377

Query: 434 --PTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALA--VVGQLQISLIEPN 489
             P + G           + +    + +K+ G     ++ FC++    VG + +S+   +
Sbjct: 378 YTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPS---VLLFCSMVAFTVGSIMLSITPVH 434

Query: 490 IAVWRQ-YILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSI 532
              W+  + + +I  FG+ +    + + +  A+P E+Q    S+
Sbjct: 435 QTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSL 478

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+  ++ L S +F  + G++ DI+G K  L+  N+ F +  LI G +
Sbjct: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFT 155

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 36/98 (36%)

Query: 187 ISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXXXDIV 246
           +S+ FGRK  L+ S + + +G ++C  +  +  + AGRF                  + V
Sbjct: 152 LSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMYAGRFLIGVGVGIEGGGVGVYIAESV 211

Query: 247 PLRNRALYQGICNFFFXXXXXXXXXXXXWFSEHGGGWR 284
           P   R     +  F               F +  GGWR
Sbjct: 212 PSTVRGSLVSLYQFNIALGELVGYVIGVIFFDVKGGWR 249

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 519 AAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELA 578
           +A  HE+ A  T+++Y     G  +G ++ GAI+ ++L   L + +              
Sbjct: 467 SATSHENLATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDADLAAAAYASPY 526

Query: 579 KIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAV 632
             I S A  +       P+  R+A++ +Y    R  Y+  +A +FCA L   A+
Sbjct: 527 TFIVSYAWGT-------PQ--REAVVGAYRHVQR--YETIVALVFCAPLVIFAM 569

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%)

Query: 144 LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVM 203
           LD  I      +  + ++E   +S I     +  A  Q +Y +++D FGR  L I + V 
Sbjct: 78  LDGNIRYIYTGYATNAYSEHSLLSTIGVVNNVIGAASQLVYARLADTFGRLSLFITAIVF 137

Query: 204 FALGCLI 210
           +A+G +I
Sbjct: 138 YAVGTII 144

>Smik_4.41 Chr4 complement(79517..81580) [2064 bp, 687 aa] {ON}
           YDL199C (REAL)
          Length = 687

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           +Y  I + + RK +L  S +++  G +I  L+   WCL+ GRF
Sbjct: 180 VYSGILETYSRKKMLQISTMIYFWGAIIQVLALNQWCLLLGRF 222

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 55/281 (19%), Positives = 108/281 (38%), Gaps = 31/281 (11%)

Query: 369 VAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGS-SLANWFSMMGMMTTSYFLPVYWA 427
           +  VV    ++  E+  ++ P+ P   +K+R I  +  +A   + +  M   Y   V   
Sbjct: 304 IGWVVALPLYMIWESKYARHPLTPWKLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRV 363

Query: 428 GVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIE 487
            V     +     ++ SF S   G+L     +K     K++L       +   L +    
Sbjct: 364 AVNESNSSAQRITSLYSFVSVITGTLLGLVIVKVRRTKKFILFGIVCWFISFGLLVHFRG 423

Query: 488 PNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPH-EHQAATTSISYAFRSTGCTLGVS 546
            + +       L + GFG       T  ++ A+  H E+ A  TS+  A  + G  +G +
Sbjct: 424 DSSSHSGIIGSLCLMGFGAGFFTYTTQASIQASTKHHENLAVITSLYLATYNIGSAVGAA 483

Query: 547 IGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHD-------SAPEFV 599
           + GAI+   L                P+E   ++ D+      Y+         +     
Sbjct: 484 VSGAIWTNVL----------------PKEIGKRLNDATLTQQAYLEPLTFILTYTWETIE 527

Query: 600 RQALIESYHFACRNTYKFCLASI-FCA--LLSCIAVKEYKL 637
           RQA++ +Y +  +     C+  + FCA  L S   +++++L
Sbjct: 528 RQAVVLAYRYTQK---VLCIVGLCFCAPLLFSAFLLRDHRL 565

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 135 MYLGIFLAS----LDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDI 190
           ++  IFL S    LD  I  TL  +  + +++   ++ +     + +A  Q  + + +DI
Sbjct: 54  LFFSIFLISYAYGLDQNIRYTLQTYATNSYSQHSLLATVNCIIAVIAAPGQVCFARAADI 113

Query: 191 FGRKPLLIFSNVMFALGCLI 210
           FGR  +LI + + + +G +I
Sbjct: 114 FGRFTVLIVAVIFYVMGTII 133

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+  ++ L + +F  + G+I DI+G K  LI   +   +  LICG +
Sbjct: 89  TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFT 136

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 153 LAHIASEFNEMPHISWIATAYLLSSATFQPL-YGKISDIFGRKPLLIFSNVMFALGCLIC 211
           L  ++ +F+    +S +  + ++   +  PL +  +SD+ GR+     S  ++ +  + C
Sbjct: 225 LGTVSDKFHVSQEVSILTCSLMVLGFSLGPLIWSPVSDLLGRRVAYFISLGLYVIFNIPC 284

Query: 212 GLSPGLWCLVAGRF 225
            L+P + CL+A RF
Sbjct: 285 ALAPNIGCLLACRF 298

>KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]
           {ON} similar to uniprot|P43562 Saccharomyces cerevisiae
           YFL040W Hypothetical ORF
          Length = 502

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 31/71 (43%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFXXXXXXXXXXXXXXXXX 242
           L+G ++D  GR P      +++ +G +I      +W L+AGRF                 
Sbjct: 68  LFGIMTDKLGRAPTFRVLALIWIIGSIISAAVLNVWMLIAGRFIRGIAVGSFSVLLPVYI 127

Query: 243 XDIVPLRNRAL 253
            ++VP + R L
Sbjct: 128 GEVVPEQRRGL 138

>YDL199C Chr4 complement(101290..103353) [2064 bp, 687 aa] {ON}
           Putative transporter, member of the sugar porter family
          Length = 687

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           +Y  I +   RK +L  S ++++LG ++  L+   WCL+ GRF
Sbjct: 180 VYSGILEPCSRKKMLQISTMIYSLGAIVQVLALNQWCLLLGRF 222

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 40/81 (49%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           + + S ++  F   LD+ I S  + +  +++     +S ++   L  SA  Q  +  +SD
Sbjct: 73  LFLFSAFICAFSYGLDSIIRSVYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSD 132

Query: 190 IFGRKPLLIFSNVMFALGCLI 210
           +FGR  + I +   + +G +I
Sbjct: 133 VFGRLSIFIVAIAFYVVGTII 153

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 105 AKTIDLETSSIEAKNNTGLSPARIK--IIMGSMYLGIFLASLDNTIVSTLLAHIASEFN- 161
            K +  E    E      LS  + K  + + S +  + + + D  IVS  +  IA + N 
Sbjct: 18  GKKLSRERFRHEMDPRRTLSTVKPKTWLFVASAFFALLVEATDFFIVSLNVVKIAEDLNV 77

Query: 162 EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLV 221
               ++W  T  L++      LYG I D FG+K   + +  M ++  L+ G +      +
Sbjct: 78  NDEKVTWGMTIALMTRTIGAVLYGYIGDQFGQKASFMINIGMISILQLLTGFATTFPYFI 137

Query: 222 AGR 224
           A R
Sbjct: 138 ACR 140

>Skud_4.116 Chr4 (208941..211250) [2310 bp, 769 aa] {ON} YDL138W
           (REAL)
          Length = 769

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 187 ISDIFGRKPLLIFSN-VMFALGCLICGLSPGLWCLVAGR 224
           ISD +GRKP ++FS  ++F++G  +   S GL  L+ GR
Sbjct: 166 ISDSYGRKPTIMFSTAIIFSIGNSLQVASGGLVLLIVGR 204

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           ++  +SD++GR+     S  ++ +  + C L+P L CL+A RF
Sbjct: 224 IWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRF 266

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           ++  +SD++GR+     S  ++ +  + C L+P L CL+A RF
Sbjct: 225 IWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRF 267

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           ++  +SD++GR+     S  ++ +  + C L+P L CL+A RF
Sbjct: 225 IWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRF 267

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S ++  F   LD+ I S  + +  +++     +S ++   L  SA  Q  +  +SD+FGR
Sbjct: 77  SAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSDVFGR 136

Query: 194 KPLLIFSNVMFALGCLI 210
             + I + + + +G +I
Sbjct: 137 LSMFIVAIMFYVVGTVI 153

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%)

Query: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193
           S ++  F   LD+ I S  + +  +++     +S ++   L  SA  Q  +  +SD+FGR
Sbjct: 77  SAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSDVFGR 136

Query: 194 KPLLIFSNVMFALGCLI 210
             + I + + + +G +I
Sbjct: 137 LSMFIVAIMFYVVGTVI 153

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+  ++ L S +F  + G++ DI+G K ++I   +   +  LICG +
Sbjct: 115 TWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFT 162

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           ++  +SD++GR+     S  ++ +  + C L+P L CL+A RF
Sbjct: 234 IWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRF 276

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 183 LYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225
           ++  +SD++GR+     S  ++ +  + C L+P L CL+A RF
Sbjct: 234 IWSPVSDLYGRRIAYFVSMGLYVIFNIPCALAPNLGCLLACRF 276

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 166 ISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           + W   +Y+L SA    + GK+ D+ G K +++F  +   +  LI G S
Sbjct: 80  VGWANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFS 128

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+  ++ L S +F  + G+I DI+G K  LI   ++  +  LICG +
Sbjct: 114 TWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 168 WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           W+  ++ L S +F  + G++ DI+G K  L    ++  L  +ICGL+
Sbjct: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLA 172

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 153 LAHIASEFNEMPHISWIATAYLLSSATFQPL-YGKISDIFGRKPLLIFSNVMFALGCLIC 211
           L  ++ +F+    +S +  + ++   +  PL +  +SD+FGR+     S  ++ +  + C
Sbjct: 221 LFTVSDKFHVSQEVSILTCSLMVIGFSLGPLIWSPVSDLFGRRVAYFVSLGLYVIFNIPC 280

Query: 212 GLSPGLWCLVAGRF 225
            L+P + CL+  RF
Sbjct: 281 ALAPNIGCLLVCRF 294

>CAGL0I03872g Chr9 (337985..340273) [2289 bp, 762 aa] {ON} some
           similarities with uniprot|Q12300 Saccharomyces
           cerevisiae YDL138w RGT2 or uniprot|P10870 Saccharomyces
           cerevisiae YDL194w SNF3
          Length = 762

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 187 ISDIFGRKPLLIFSN-VMFALGCLICGLSPGLWCLVAGR 224
           ISDI+GRK  +IFS  ++F++G  +   + GL  L+ GR
Sbjct: 183 ISDIYGRKSTIIFSTMIIFSIGNSLQVAAGGLALLIVGR 221

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+  ++ L S +F  + G+I DI+G K  LI   + F +  LI G +
Sbjct: 115 TWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFT 162

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 31/48 (64%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214
           +W+ +++ L+  +F  + G++ DI+G K +L+   ++  +  +ICGLS
Sbjct: 114 AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLS 161

>Kwal_56.24841 s56 complement(1167890..1169425) [1536 bp, 511 aa]
           {ON} YDL138W (RGT2) - glucose permease [contig 160] FULL
          Length = 511

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 17/111 (15%)

Query: 131 IMGSMY----LGIFLA------SLDNTIVSTLLA--HIASEFNEMPHISWIATAYLLSSA 178
           I GS Y    +G+F+A        D   +S +LA  H+ + F +  H +   T+ + S  
Sbjct: 15  IQGSKYRALSVGLFVAFGGILFGYDTGTISGILAMDHVKTTFTDRGHFTAGETSLITSIL 74

Query: 179 TFQPLYGK-----ISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGR 224
           +    +G      +SD  GR+  LI S V+F +G ++   +     L+ GR
Sbjct: 75  SAGTFFGSMSAPLVSDNLGRRYGLIVSTVIFTIGVILQVAATTQELLIVGR 125

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%)

Query: 130 IIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISD 189
           I++ S ++  +   L+  I      +  S + E   +S +     + SA  Q +Y ++SD
Sbjct: 67  ILLFSAFVCGYAYGLECNIRYIYTGYATSSYAEHSLLSTVNVINAVVSAASQIIYSRLSD 126

Query: 190 IFGRKPLLIFSNVMFALGCLI 210
            FGR  L I + V++ +G +I
Sbjct: 127 FFGRLTLFIIAIVLYVVGTII 147

>CAGL0A04323g Chr1 (429121..429771) [651 bp, 216 aa] {ON} similar to
           uniprot|P34222 Saccharomyces cerevisiae YBL057c
          Length = 216

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 15/23 (65%)

Query: 437 MGKRTIPSFFSTALGSLGAGYYM 459
           MG   IPSFF  A+ SL  GYY+
Sbjct: 1   MGSNIIPSFFGIAVASLATGYYL 23

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 70/143 (48%), Gaps = 25/143 (17%)

Query: 391 LPVAFLK--NRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFST 448
           +P+++++  ++  L S +AN F ++G+    YF   + AG L+ KP D     I SFF+T
Sbjct: 401 VPLSYIRRVSKLTLPSLIANGFILIGLSLVIYFSIDHLAGDLHGKPAD----GIISFFNT 456

Query: 449 ALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSV 508
              +L  G            + AF  + ++  LQ S+ +P+     ++ L++    GL +
Sbjct: 457 KHWTLFIGT----------AIFAFEGIGLIIPLQNSMRDPS-----KFPLVL----GLVM 497

Query: 509 LITVTLLAMIAAVPHEHQAATTS 531
           + T  +  +IA + +    ++T 
Sbjct: 498 ICTTVMFIIIATIGYLSYGSSTE 520

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 137 LGIFLASLDNTIVSTLLAHIASEFNEMP-HISWIATAYLLSSATFQPLYGKISDIFGRKP 195
           +G FL+ +  T V + +  +A E +       W+  A+ L       + G++ DIFG K 
Sbjct: 131 IGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKK 190

Query: 196 LLIFSNVMFALGCLICGLS 214
           +L+   ++  +  LICG S
Sbjct: 191 VLLLGYIITTIWTLICGFS 209

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGL 213
           SW  T+Y ++ A F    G++ DI G   L   S  +F L  L+C +
Sbjct: 66  SWALTSYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAV 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,794,206
Number of extensions: 2167647
Number of successful extensions: 7986
Number of sequences better than 10.0: 326
Number of HSP's gapped: 7964
Number of HSP's successfully gapped: 455
Length of query: 657
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 541
Effective length of database: 40,180,143
Effective search space: 21737457363
Effective search space used: 21737457363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)