Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16786g8.273ON74743648e-47
Kwal_YGOB_YDR119W-A8.273ON74751755e-18
KLTH0G13442g8.273ON74751747e-18
KLLA0F19371g8.273ON80701591e-15
Ecym_42978.273ON74691512e-14
Suva_2.2808.273ON66681442e-13
YDR119W-A (COX26)8.273ON66681408e-13
Smik_4.3648.273ON65681363e-12
Kpol_YGOB_YDR119W-A8.273ON75681356e-12
Skud_4.3808.273ON66681321e-11
TDEL0F040008.273ON62361155e-09
TPHA0A017408.273ON79691166e-09
CAGL0B01875g8.273ON74381052e-07
TBLA0F030308.273ON75541052e-07
KNAG0H031708.273ON7169973e-06
ZYRO0D06908g8.273ON7771958e-06
NDAI0J012908.273ON7565861e-04
KLLA0F19382gsingletonON7548720.017
KAFR0B054408.273ON6631680.071
KAFR0B027608.273ON7944680.078
NOTE: 1 genes in the same pillar as SAKL0H16786g were not hit in these BLAST results
LIST: NCAS0B03770

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16786g
         (74 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...   144   8e-47
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    72   5e-18
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    72   7e-18
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    66   1e-15
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    63   2e-14
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    60   2e-13
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    59   8e-13
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    57   3e-12
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    57   6e-12
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    55   1e-11
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    49   5e-09
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    49   6e-09
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    45   2e-07
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    45   2e-07
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    42   3e-06
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    41   8e-06
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    38   1e-04
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    32   0.017
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    31   0.071
KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273...    31   0.078

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score =  144 bits (364), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA
Sbjct: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60

Query: 61 VLGWPFAVKKIVHS 74
          VLGWPFAVKKIVHS
Sbjct: 61 VLGWPFAVKKIVHS 74

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 72.0 bits (175), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 1  MFSSQVLRSTAAISRSAV--ASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASM 58
          M SSQ+LRS AA+   A   ASK  S+V+ +A   R    WA+ EAKR+VPT+ +W  SM
Sbjct: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSR-ARQWAVIEAKRIVPTVAMWATSM 59

Query: 59 AAVLGWPFAVKKIVH 73
            +LGWPF V+ IVH
Sbjct: 60 TIMLGWPFGVRAIVH 74

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 71.6 bits (174), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MFSSQVLRSTAAISRSAVA--SKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASM 58
          M SSQ+L+S A +   A +  S+ AS+V+L+    R    WA+ EAKRLVP I +WGA M
Sbjct: 1  MLSSQILKSVATLQGVAASQVSRSASRVVLKGPSSR-ARKWAVIEAKRLVPAIGMWGAFM 59

Query: 59 AAVLGWPFAVKKIVH 73
           AVLGWPFAV+ +VH
Sbjct: 60 GAVLGWPFAVRALVH 74

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 65.9 bits (159), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 2/70 (2%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MF ++ LRSTA I+ +  A++  +K  +R+   R+GE WA+TEA+RL PTI ++G  + +
Sbjct: 1  MFFTKALRSTATIAMNH-ATQTTTKTAVRSGR-RVGEAWAVTEARRLGPTILMYGTFIVS 58

Query: 61 VLGWPFAVKK 70
          VLGWPF V+K
Sbjct: 59 VLGWPFLVRK 68

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 62.8 bits (151), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          M  S++L++ + I +S +++ GA +    A+   +GEPW +TE KRLVPTI +WG +M  
Sbjct: 1  MLYSRILKAVSTIPKSPMSNIGARRA---ATSKHIGEPWMVTETKRLVPTILIWGGTMTG 57

Query: 61 VLGWPFAVK 69
          +L WP   +
Sbjct: 58 ILLWPIIFR 66

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 60.1 bits (144), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 43/68 (63%), Gaps = 11/68 (16%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MF SQVLRS+A   R+A         + R + GR+GE W ITE++RL+P +F WGA +  
Sbjct: 1  MFFSQVLRSSA---RAAP--------IKRYTGGRVGEAWMITESRRLIPEVFQWGAVICT 49

Query: 61 VLGWPFAV 68
           LGWP AV
Sbjct: 50 CLGWPGAV 57

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 58.5 bits (140), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 11/68 (16%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MF SQVLRS+A   R+A         + R + GR+GE W ITE +RL+P IF W A ++ 
Sbjct: 1  MFFSQVLRSSA---RAAP--------IKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSV 49

Query: 61 VLGWPFAV 68
           LGWP AV
Sbjct: 50 CLGWPGAV 57

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 57.0 bits (136), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 11/68 (16%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MF S+VLRS+A   R+A         + R + GR+GE W ITE +RL+P +F W A+++ 
Sbjct: 1  MFFSEVLRSSA---RAAP--------IKRYTGGRVGESWVITEGRRLIPEVFQWSATLSI 49

Query: 61 VLGWPFAV 68
           LGWP AV
Sbjct: 50 CLGWPSAV 57

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 56.6 bits (135), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MFS  + R+TA + R   A + AS     A+ G +GE WA+TEAKR+ PTI  WG ++ A
Sbjct: 1  MFSRILARTTARVGRVQ-AVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTA 59

Query: 61 VLGWPFAV 68
          +L WPF +
Sbjct: 60 ILSWPFII 67

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 55.5 bits (132), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 11/68 (16%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MF SQVLRS+A   R+A         + R + GR+GE W ITE +RL+P +  W A+++ 
Sbjct: 1  MFFSQVLRSSA---RAAP--------IKRYTGGRVGESWVITEGRRLIPEVLQWSAALSI 49

Query: 61 VLGWPFAV 68
           LGWP AV
Sbjct: 50 CLGWPGAV 57

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 48.9 bits (115), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 25/36 (69%)

Query: 37 EPWAITEAKRLVPTIFLWGASMAAVLGWPFAVKKIV 72
          + WA++EAKRL P I  WG  +A  LGWPFA+K  +
Sbjct: 24 QSWAVSEAKRLTPAILGWGGFLAGCLGWPFAIKHFM 59

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 49.3 bits (116), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MFS  + +STA I+   +  + +S          LGE W +TEAKR+ P +  WG++M  
Sbjct: 1  MFSKIISQSTARIANRQII-RHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTT 59

Query: 61 VLGWPFAVK 69
          VL WP  +K
Sbjct: 60 VLLWPSFIK 68

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 45.1 bits (105), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 31 SHGRLGEPWAITEAKRLVPTIFLWGASMAAVLGWPFAV 68
          + GR+G  W I E KRL PT+  W + +   LGWPF +
Sbjct: 30 AQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGI 67

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 45.1 bits (105), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 16 SAVASKGASKVLLRASHGR--LGEPWAITEAKRLVPTIFLWGASMAAVLGWPFA 67
          +A +S   +++ LR S  R    E WA+TE KR+VP I  W   ++  LGWPF 
Sbjct: 6  AARSSASMARMQLRRSFTRSYTQESWAVTEVKRIVPNIAFWATLLSVSLGWPFC 59

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 42.0 bits (97), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 7/69 (10%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MF SQV +S   +S+  +  + AS      S GR+G  +  TE KR +P + LWG+ +  
Sbjct: 1  MFRSQVSKSLQRMSK-PIGLRYAS------SGGRVGPGFYRTEIKRRIPQVALWGSGLFL 53

Query: 61 VLGWPFAVK 69
          VL WPF  K
Sbjct: 54 VLEWPFFFK 62

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 41.2 bits (95), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          MF +QVLR++A       A+K A+K + ++S    GE W + EA+RL      W  S++ 
Sbjct: 1  MFFTQVLRNSAV-----SATKQAAKQISKSS---AGEQWGLLEARRLSRGAVEWAVSLSL 52

Query: 61 VLGWPFAVKKI 71
          +L WP A+ K 
Sbjct: 53 ILAWPAAIIKF 63

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 37.7 bits (86), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60
          +F+S + RS    +     + GA+  +        G PW  +E +R+ PTI  W   +  
Sbjct: 2  LFNSVLKRSIRNTAVRQFVTNGAAHTIRPVR----GLPWVSSEIQRVAPTILRWSTFLVV 57

Query: 61 VLGWP 65
          VLGWP
Sbjct: 58 VLGWP 62

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 32.3 bits (72), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 23 ASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAAVLGWPFAVKK 70
          A +V+  + H  +GE W  +E +RL P +  +   +  ++ WP+ VK+
Sbjct: 16 ARRVVYASGH-HVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVKE 62

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 30.8 bits (68), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 35 LGEPWAITEAKRLVPTIFLWGASMAAVLGWP 65
          +G P+   +AK+ V TI  WG  +   LGWP
Sbjct: 27 IGPPYLYLKAKQDVKTIAAWGTFLLVALGWP 57

>KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 79

 Score = 30.8 bits (68), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%)

Query: 28 LRASHGRLGEPWAITEAKRLVPTIFLWGASMAAVLGWPFAVKKI 71
          L    GR G PW + E KR +  I  +  +++ +  WPF+++ +
Sbjct: 24 LNPKSGRAGGPWGLMEFKRQIVLIPGFLLTLSVLCFWPFSIRAV 67

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.128    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,940,446
Number of extensions: 117159
Number of successful extensions: 303
Number of sequences better than 10.0: 20
Number of HSP's gapped: 302
Number of HSP's successfully gapped: 20
Length of query: 74
Length of database: 53,481,399
Length adjustment: 46
Effective length of query: 28
Effective length of database: 48,206,763
Effective search space: 1349789364
Effective search space used: 1349789364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)