Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H16434g8.286ON55555523400.0
KLTH0G13112g8.286ON3493056912e-85
KLLA0F19690g8.286ON3242916709e-83
Skud_4.3878.286ON3362956562e-80
Ecym_42828.286ON3402726389e-78
KAFR0B053708.286ON3292876309e-77
TDEL0F041308.286ON3283076301e-76
ZYRO0D06600g8.286ON3302876203e-75
NDAI0J010008.286ON3392606041e-72
CAGL0B01991g8.286ON3302575952e-71
NCAS0B035908.286ON3292895916e-71
YDR126W (SWF1)8.286ON3362965882e-70
Smik_4.3728.286ON3352915847e-70
Suva_2.2898.286ON3352805794e-69
TPHA0C010708.286ON3332855672e-67
TBLA0D040408.286ON3292985532e-65
Kwal_56.236978.286ON3382775411e-63
Kpol_1033.168.286ON3212535341e-62
AGR065W8.286ON3262645017e-58
KNAG0H031108.286ON3312404764e-54
NCAS0C029208.389ON374912254e-19
TBLA0H009208.389ON3601142244e-19
ZYRO0C04092g8.389ON3661282201e-18
NDAI0G022508.389ON3891272183e-18
Skud_12.3218.389ON3561452165e-18
YLR246W (ERF2)8.389ON3591432121e-17
Smik_12.3068.389ON3591452112e-17
Suva_10.3428.389ON3561432093e-17
TPHA0C023608.389ON4041512094e-17
Kwal_23.33028.389ON3531362051e-16
TDEL0F051308.389ON3591272051e-16
CAGL0G08217g8.389ON3261322031e-16
SAKL0H13860g8.389ON3521642032e-16
KLLA0E02069g3.12ON3251222003e-16
Ecym_41788.389ON3681322013e-16
KAFR0H019808.389ON361752004e-16
KLLA0D18370g8.389ON355841997e-16
YOL003C (PFA4)6.28ON3781651943e-15
Smik_15.1676.28ON3781641943e-15
Suva_15.1726.28ON3981641944e-15
KAFR0A085903.12ON3311601915e-15
KAFR0A051306.28ON396941911e-14
Kpol_1014.293.12ON3261171881e-14
Ecym_20143.12ON3391441891e-14
TDEL0A003103.12ON329681871e-14
KLTH0F19580g3.12ON3421441881e-14
TPHA0P015603.12ON3311191872e-14
KNAG0F029306.28ON3861471855e-14
SAKL0C13596g3.12ON3331231835e-14
NDAI0G013403.12ON3351591835e-14
AGL125C8.389ON367661836e-14
KLTH0F08668g8.389ON358501837e-14
NCAS0E013003.12ON3271551819e-14
KNAG0K025703.12ON3281411801e-13
TDEL0G044106.28ON3811851821e-13
KNAG0A027108.389ON3541391811e-13
Skud_15.1596.28ON3791851811e-13
Kwal_55.221263.12ON3601241801e-13
Ecym_30326.28ON3771221774e-13
ZYRO0C03410g3.12ON327691755e-13
Kwal_56.224596.28ON3831391759e-13
TPHA0J003906.28ON380771712e-12
NDAI0C026506.28ON389811713e-12
TBLA0H001503.12ON345541703e-12
Suva_14.153.12ON3301411684e-12
NCAS0D021406.28ON376661695e-12
CAGL0E02497g6.28ON3761901677e-12
SAKL0E01518g6.28ON3791461669e-12
YNL326C (PFA3)3.12ON3361411659e-12
Kpol_1037.236.28ON378921669e-12
Skud_14.153.12ON3361431641e-11
KLTH0C10978g6.28ON377741652e-11
Smik_14.63.12ON3341431632e-11
KLLA0C06204g6.28ON3771231642e-11
ZYRO0C07546g6.28ON377621623e-11
CAGL0D02508g3.12ON332681596e-11
ADL197C3.12ON390491518e-10
ACL003C6.28ON375921472e-09
TBLA0B004806.28ON377501383e-08
KAFR0I011105.579ON370491293e-07
Kpol_1004.575.579ON362911232e-06
CAGL0K06347g5.579ON352881188e-06
KLTH0G04972g5.579ON367471161e-05
Kwal_47.183665.579ON3561011162e-05
TBLA0E028305.579ON386641152e-05
Ecym_41145.579ON372491152e-05
YDR459C (PFA5)5.579ON374991143e-05
Smik_4.7375.579ON378991133e-05
TDEL0A044405.579ON365641125e-05
ABR203W5.579ON359661108e-05
KNAG0C028305.579ON354651108e-05
NCAS0F013905.579ON374581091e-04
Suva_2.6345.579ON388991081e-04
Skud_4.7345.579ON3801121082e-04
NDAI0H018905.579ON406641072e-04
SAKL0G06160g5.579ON364471044e-04
KLTH0E02420g5.626ON734841045e-04
KLLA0D06149g5.579ON349471035e-04
Smik_4.5155.626ON76468990.003
ZYRO0D13860g5.579ON365118970.003
NDAI0H008505.626ON78655970.004
CAGL0M08712g5.626ON76368970.004
ZYRO0C11132g5.626ON75954940.009
KAFR0H005705.626ON75743940.010
Skud_4.5275.626ON76454920.018
TBLA0J008305.626ON739157900.027
TPHA0C003705.626ON75943900.028
Suva_2.4325.626ON76354890.038
KNAG0C062305.626ON75269870.057
SAKL0G07326g5.626ON73768870.058
NCAS0C052805.626ON75778860.076
KNAG0B031405.626ON682176860.078
YDR264C (AKR1)5.626ON76458850.095
Kpol_526.325.626ON77769850.10
Ecym_13305.626ON73955840.16
Suva_8.875.626ON73050820.23
Smik_15.2135.626ON74450810.29
TDEL0A049205.626ON75041810.31
YOR034C (AKR2)5.626ON74956810.33
AER388C5.626ON72439780.74
KLLA0E16721g5.626ON75241770.98
AGR346C2.136ON105883761.5
SAKL0C05918g1.199ON87546724.1
Skud_15.1995.626ON74148699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H16434g
         (555 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...   905   0.0  
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...   270   2e-85
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...   262   9e-83
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...   257   2e-80
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...   250   9e-78
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...   247   9e-77
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...   247   1e-76
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...   243   3e-75
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....   237   1e-72
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...   233   2e-71
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}     232   6e-71
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...   231   2e-70
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...   229   7e-70
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...   227   4e-69
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...   223   2e-67
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...   217   2e-65
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...   213   1e-63
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....   210   1e-62
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...   197   7e-58
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...   187   4e-54
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     91   4e-19
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    91   4e-19
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    89   1e-18
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     89   3e-18
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    88   5e-18
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    86   1e-17
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    86   2e-17
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    85   3e-17
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    85   4e-17
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    84   1e-16
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    84   1e-16
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    83   1e-16
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    83   2e-16
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    82   3e-16
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    82   3e-16
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    82   4e-16
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    81   7e-16
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...    79   3e-15
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...    79   3e-15
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...    79   4e-15
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    78   5e-15
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...    78   1e-14
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    77   1e-14
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    77   1e-14
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    77   1e-14
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    77   1e-14
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    77   2e-14
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...    76   5e-14
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    75   5e-14
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      75   5e-14
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    75   6e-14
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    75   7e-14
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    74   9e-14
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    74   1e-13
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...    75   1e-13
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    74   1e-13
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...    74   1e-13
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    74   1e-13
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...    73   4e-13
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    72   5e-13
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...    72   9e-13
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...    70   2e-12
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28      70   3e-12
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    70   3e-12
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    69   4e-12
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...    70   5e-12
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...    69   7e-12
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...    69   9e-12
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    68   9e-12
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...    69   9e-12
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    68   1e-11
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...    68   2e-11
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    67   2e-11
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...    68   2e-11
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...    67   3e-11
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    66   6e-11
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    63   8e-10
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...    61   2e-09
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...    58   3e-08
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    54   3e-07
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    52   2e-06
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    50   8e-06
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    49   1e-05
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    49   2e-05
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    49   2e-05
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    49   2e-05
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    49   3e-05
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    48   3e-05
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    48   5e-05
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    47   8e-05
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    47   8e-05
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    47   1e-04
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    46   1e-04
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    46   2e-04
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    46   2e-04
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    45   4e-04
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    45   5e-04
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    44   5e-04
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    43   0.003
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    42   0.003
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    42   0.004
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    42   0.004
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    41   0.009
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    41   0.010
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    40   0.018
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    39   0.027
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    39   0.028
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    39   0.038
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    38   0.057
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    38   0.058
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    38   0.076
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    38   0.078
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    37   0.095
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    37   0.10 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    37   0.16 
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    36   0.23 
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    36   0.29 
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    36   0.31 
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    36   0.33 
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    35   0.74 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    34   0.98 
AGR346C Chr7 complement(1370857..1374033) [3177 bp, 1058 aa] {ON...    34   1.5  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    32   4.1  
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    31   9.4  

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/555 (81%), Positives = 455/555 (81%)

Query: 1   MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSI 60
           MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSI
Sbjct: 1   MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSI 60

Query: 61  YIYCVLMFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRVP 120
           YIYCVLMFYKDLYRDLSPYLLFLERF                CMTIEPDSTKSLADCRVP
Sbjct: 61  YIYCVLMFYKDLYRDLSPYLLFLERFLIVPLLLLGPIITGYLCMTIEPDSTKSLADCRVP 120

Query: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL
Sbjct: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180

Query: 181 SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240
           SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT
Sbjct: 181 SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240

Query: 241 TNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLLEN 300
           TNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLLEN
Sbjct: 241 TNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLLEN 300

Query: 301 ANTRIDYGGNVGLKPXXXXXXXXXXXXXNLRXXXXXXXXXXXXXXSQDPEKLXXXXXXXX 360
           ANTRIDYGGNVGLKP             NLR              SQDPEKL        
Sbjct: 301 ANTRIDYGGNVGLKPGADGIGGGFGAGINLRDKLKAGGGFGAGLDSQDPEKLGMGGGFGA 360

Query: 361 XLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDYKDSFNTXXXXXXXFNKRPDSAA 420
            LD                                LDYKDSFNT       FNKRPDSAA
Sbjct: 361 GLDYNDNFGMGGGSGGGFDYDGIDKFGGGGGGGFGLDYKDSFNTGGGAGAGFNKRPDSAA 420

Query: 421 DPXXXXXXXXXTSTNVHIGEQHRKTIFDAKISMGGGAGMDYHENTGLPSLGGGSAVEIHV 480
           DP         TSTNVHIGEQHRKTIFDAKISMGGGAGMDYHENTGLPSLGGGSAVEIHV
Sbjct: 421 DPGFGFGGGGGTSTNVHIGEQHRKTIFDAKISMGGGAGMDYHENTGLPSLGGGSAVEIHV 480

Query: 481 NALGRELDLAKDIGGGFPGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIY 540
           NALGRELDLAKDIGGGFPGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIY
Sbjct: 481 NALGRELDLAKDIGGGFPGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIY 540

Query: 541 DKGNFWANLWDRIGK 555
           DKGNFWANLWDRIGK
Sbjct: 541 DKGNFWANLWDRIGK 555

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score =  270 bits (691), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 185/305 (60%), Gaps = 6/305 (1%)

Query: 1   MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSI 60
           M L  W+ ++PQ+VL LFSPLF++   F WYY  +FHP+F+D  R+RWK+  +P FY SI
Sbjct: 3   MGLFIWILIIPQLVLSLFSPLFRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFYLSI 62

Query: 61  YIYCVLMFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRVP 120
           Y YC  +F+KD+   +   L  +ER                  + I+P ST + +     
Sbjct: 63  YAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTIWIKPKSTYA-SPMLDA 121

Query: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           +DE+IFH G  C+TC   K AR+KHC IC++C+ + DHHC+W NNCIG+GNY+YFY FL+
Sbjct: 122 YDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLV 181

Query: 181 SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240
           SNV L +Y FLRL  +Q       + ++ +L+L+IL GCF +I+AVF Y QF LV DGMT
Sbjct: 182 SNVFLTNYGFLRLLFLQ-----RFVHSRQLLILSILLGCFGVILAVFSYFQFVLVRDGMT 236

Query: 241 TNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLLEN 300
           TNE++KW  + + +R   +V D  G YYFR+L +   D  +      + S    +  L +
Sbjct: 237 TNEENKWLVIHDMIRARQMVTDDTGKYYFRLLADCQEDSAESLTNPRHSSQGPNEFHLND 296

Query: 301 ANTRI 305
           ++  I
Sbjct: 297 SSPDI 301

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%)

Query: 500 HSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWDRI 553
           H N S    Y +YSTNPYD+ TY V++   I     + NIYD+G FW NL  R+
Sbjct: 293 HLNDSSPDIYVYYSTNPYDNATYDVKNPKEILSTAAITNIYDEGGFWKNLMARV 346

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score =  262 bits (670), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 143/291 (49%), Positives = 178/291 (61%), Gaps = 9/291 (3%)

Query: 1   MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSI 60
           M LLF LFVV Q+ LL+FSP FK ++ F WYY HI++PLF D  RYRWKY +VP FY  I
Sbjct: 1   MFLLFLLFVVSQVGLLVFSPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACI 60

Query: 61  YIYCVLMFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRVP 120
            I+CV +FY  L   ++PYL  LE+                  + ++P   +  A  +  
Sbjct: 61  LIFCVHLFYNKLNDTVNPYLYSLEK-AFIPITIAFTSLTGVASVFVKPLGLQ--AGPQFQ 117

Query: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
            D IIFHP  +CQTC  IK  RSKHC IC +CI + DHHCIW+NNC+G GNY+YFY FLL
Sbjct: 118 PDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177

Query: 181 SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240
           SN  LL+Y+ LRL  + L   T   K K  L L +LT  F +I  VF Y Q  LV+DGMT
Sbjct: 178 SNCLLLTYASLRL--LTLFRITAFKKDKFFLSLFLLTTAFSLIAIVFTYYQLKLVNDGMT 235

Query: 241 TNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSN 291
            NEQDKW+ VQE+MR+GNLV+D  G  Y+R    S S   Q  E   Y +N
Sbjct: 236 NNEQDKWYLVQEYMRNGNLVKDMDGVLYYR----SMSTDAQTAEPIFYSTN 282

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 480 VNALGRELDLAKDIGGGFPGHSNVSPKKNYR--FYSTNPYDDLTYHVEDYDVIKDPKDLN 537
           V    R  +L KD+ G     S  +  +     FYSTN YD   YH+ +   I   +++ 
Sbjct: 245 VQEYMRNGNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEII 304

Query: 538 NIYDKGNFWANLWDRI 553
           N+YD+G+F  NL +RI
Sbjct: 305 NLYDRGSFLDNLKERI 320

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score =  257 bits (656), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 183/295 (62%), Gaps = 8/295 (2%)

Query: 4   LFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIY 63
           + ++ +V  +VL+LFSP+FKS  PF   Y  +F P   D  +YRWK+++VPLFYTSIY+Y
Sbjct: 5   VLFVLLVSIVVLILFSPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFYTSIYLY 64

Query: 64  CVLMFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDST---KSLADCRVP 120
            V  ++  +   +   L  LER                  M  + + +   +  +  + P
Sbjct: 65  LVYTYHAKVEPLIKNDLFLLERILIGPIIILPPVALGILAMVTKAEDSNVHRPGSTEKYP 124

Query: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           +D +I++P   C TC   KPARS+HCSICN+CIL+ DHHCIWVNNCIGKGNY  FY FL+
Sbjct: 125 YDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLI 184

Query: 181 SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240
           SN+  +SY+FLRL SI L S T     + +L L+IL GCF II A+F Y Q  +V +GMT
Sbjct: 185 SNIVSMSYAFLRLCSISLKSSTA--LPRAVLTLSILCGCFTIICAIFTYLQLAIVREGMT 242

Query: 241 TNEQDKWFTVQEFMRDGNLVR---DKKGHYYFRILDESSSDRDQKEEEDSYRSNN 292
           TNEQDKW+T+QE+MR+G LVR   D    ++ ++ ++  +    ++++ ++ S N
Sbjct: 243 TNEQDKWYTIQEYMREGKLVRSLNDDPQSWFLKLTEKGDAAEPLQDQQGTFYSTN 297

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 26/43 (60%)

Query: 511 FYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWDRI 553
           FYSTN YD   Y +  Y  IKD  ++ N+YDKG F AN  D I
Sbjct: 293 FYSTNAYDHKRYILMHYITIKDASEITNVYDKGTFLANFTDLI 335

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score =  250 bits (638), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 127/272 (46%), Positives = 168/272 (61%), Gaps = 4/272 (1%)

Query: 1   MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSI 60
           M+++ WL  + QIVL+L SPLFKS  PF WYYA +F PLF+    Y+WKY +VP FYT I
Sbjct: 3   MLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGI 62

Query: 61  YIYCVLMFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRVP 120
           YIYC  +FY  +Y ++   L  LE                   +T  P  T +     +P
Sbjct: 63  YIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVT-SPHDTITYVGPEIP 121

Query: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           FD IIFH   +C++C   K ARSKHCSIC +CIL+ DHHC+W+NNCIG GNY+YFY FLL
Sbjct: 122 FDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181

Query: 181 SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240
           SN ++LSY+ +RL+S+       +   K  L L IL  CF +I   F Y QF LV DGMT
Sbjct: 182 SNCSMLSYATIRLSSVAPSGLWRS--NKSFLSLMILVCCFAVISISFTYMQFALVRDGMT 239

Query: 241 TNEQDKWFTVQEFMRDGNLVR-DKKGHYYFRI 271
           TNE+DKW+T+ + MR+  L++ +    +Y RI
Sbjct: 240 TNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRI 271

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 508 NYRFYSTNPYDDLTYHVED--YDVIKDPKDLNNIYDKGNFWANLWDR 552
            Y +YSTNPYD  TY + D  Y V+   +D+ NIYD+ +FW NL  R
Sbjct: 291 QYEYYSTNPYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQR 337

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  247 bits (630), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 129/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)

Query: 7   LFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVL 66
           +FV+ QI+ LL SP  K    F +YY  IF P  KD  +Y+WKY++VP+FY ++Y Y VL
Sbjct: 9   IFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFYVTLYTYMVL 68

Query: 67  MFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCR---VPFDE 123
           +++  L   +   L  LER+                 M I P+S+            FD 
Sbjct: 69  LYFTKLNPIIKSQLTILERWVIIPFSLLISLLSGILTMRIRPESSLGFNSSPYQDFEFDS 128

Query: 124 IIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNV 183
           +IF+P T C TC   KPARSKHC+ICN+C+L+ DHHCIW NNCIG GNY+YFY FL+SN 
Sbjct: 129 LIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNT 188

Query: 184 TLLSYSFLRLTSIQLMSQTENIKTKPMLVLT--ILTGCFDIIVAVFGYTQFNLVHDGMTT 241
            LL Y+FLR   I L++   +I   P +VLT  IL+G F  I+ VF Y QF LV+DGMTT
Sbjct: 189 LLLGYAFLR---IILLTAYSDIGF-PNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTT 244

Query: 242 NEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSY 288
           NE+DKWFT+QEFMR+G L+R   G +     +E +    +    ++Y
Sbjct: 245 NEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAY 291

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 480 VNALGRELDLAK-DIGGGFPGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNN 538
           +    RE  L + D G     H      +  RFYSTN YD   Y   ++  I    ++ N
Sbjct: 253 IQEFMREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITHHDEIPN 312

Query: 539 IYDKGNFWANL 549
           IYDKG+F  NL
Sbjct: 313 IYDKGSFLKNL 323

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score =  247 bits (630), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 178/307 (57%), Gaps = 13/307 (4%)

Query: 3   LLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYI 62
           +L +L V  QI++LL SP +K   PF WYY  IF PL ++  R+RWK+ VVP FY S+Y 
Sbjct: 6   VLLFLVVAAQIIVLLLSPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYC 65

Query: 63  YCVLMFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRVP-- 120
           Y + +  +D+   +   LL +E+                  MT++  +++          
Sbjct: 66  YIIFVLIRDVIPVIGNRLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEY 125

Query: 121 -FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL 179
            +D I+++P   C+TCH  KPARS+HC++C +C+L+ DHHC+WVNNCIGKGNY++FY FL
Sbjct: 126 DYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFL 185

Query: 180 LSNVTLLSYSFLRLTSIQLMSQ-TENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDG 238
           + NV  LSY FLR+  I +M   +  +  + +L+ TIL G F II  VF Y Q  LV+DG
Sbjct: 186 VVNVISLSYGFLRVLWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDG 245

Query: 239 MTTNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLL 298
           MTT E+DKW+T+Q+ MR+GNLVR   G ++          +DQ+     Y +N     L 
Sbjct: 246 MTTGEKDKWYTIQQIMREGNLVRTLDGQFFI---------QDQQNPNQFYSTNAYDSKLY 296

Query: 299 ENANTRI 305
              N  I
Sbjct: 297 VPQNYSI 303

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 480 VNALGRELDLAKDIGGGFPGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNI 539
           +  + RE +L + + G F      +P +   FYSTN YD   Y  ++Y ++ DPKD+ NI
Sbjct: 257 IQQIMREGNLVRTLDGQFFIQDQQNPNQ---FYSTNAYDSKLYVPQNYSIVNDPKDITNI 313

Query: 540 YDKGNFWANL 549
           YD+G+FW  L
Sbjct: 314 YDQGSFWYKL 323

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score =  243 bits (620), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 177/287 (61%), Gaps = 6/287 (2%)

Query: 1   MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSI 60
           M+L+    ++ QI +LL SPLFK   PF  YY ++F PLF+D  R+RWK+ +VPLFY+SI
Sbjct: 1   MMLILIAALILQIAVLLISPLFKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFYSSI 60

Query: 61  YIYCVLMFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRV- 119
           Y+  V +  K++   LSP L F + +                   I P++TKS     + 
Sbjct: 61  YLGVVHLAIKNVIPQLSPGLNFFDYWFFIPFFIVLTPATGILAAIIGPETTKSCKRRNID 120

Query: 120 --PFDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYG 177
              +D ++F+P   C+TC   KPARSKHC++CN+C+L VDHHCIW+NNC+G GNY YFY 
Sbjct: 121 KFRYDNLLFYPNINCRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYL 180

Query: 178 FLLSNVTLLSYSFLRLTSIQLMSQTENIK-TKPMLVLTILTGCFDIIVAVFGYTQFNLVH 236
           FL+ N   +SY+F+R  S+ ++    NIK  + +L   +LTGCF +I  VF Y Q  +V 
Sbjct: 181 FLVLNSLSMSYAFIR--SMSIVGLKPNIKYPRSILAFNLLTGCFALICIVFTYLQLCMVR 238

Query: 237 DGMTTNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKE 283
           +GMTTNE+DKWFT+ E+MR+  LV+   G +Y+ + D      DQ E
Sbjct: 239 EGMTTNEKDKWFTIHEYMREKRLVKSSSGKWYYDLTDRLDLPTDQHE 285

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 32/45 (71%)

Query: 505 PKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANL 549
           P   + F+STNPYD   Y ++ Y +I+D + +NNIYD+G+F ANL
Sbjct: 280 PTDQHEFFSTNPYDGRLYRLQSYTLIEDAERINNIYDEGSFMANL 324

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score =  237 bits (604), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 161/260 (61%), Gaps = 7/260 (2%)

Query: 15  LLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYR 74
           LLL SP +K+  PF  YY H+F P+ +D+ RYRWKY++VP FY +++IY    +Y  +  
Sbjct: 17  LLLLSPRYKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFYLTLFIYLTYCYYTKVEP 76

Query: 75  DLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLAD-----CRVPFDEIIFHPG 129
            ++  L F+E +                 M   P++  +  +      R P+DEI+++P 
Sbjct: 77  LIASQLYFIEVWIWIPFMIFSPVIFGILTMVTIPNTVNNRRNQEKVLYRYPYDEIMYYPN 136

Query: 130 TICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYS 189
             C+TC  +KPARSKHC ICN CIL+ DHHC+WVNNCIG+GNY YFY FLL N   ++YS
Sbjct: 137 IECRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYS 196

Query: 190 FLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFT 249
           F+RL    +  Q     ++ +L L IL G F +I A F + Q  LV DGMTTNEQDKWFT
Sbjct: 197 FIRL--FLMYCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVKDGMTTNEQDKWFT 254

Query: 250 VQEFMRDGNLVRDKKGHYYF 269
           +QE+MRDG L+R K  + +F
Sbjct: 255 LQEYMRDGKLIRTKDENKWF 274

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 31/43 (72%), Gaps = 2/43 (4%)

Query: 511 FYSTNPYDDLTYHV--EDYDVIKDPKDLNNIYDKGNFWANLWD 551
           FYSTN YD   YH+  ++Y +++DP+ + N+YD G+F+ NL D
Sbjct: 292 FYSTNAYDHEGYHLSSDEYTIVEDPRQITNLYDSGDFFTNLKD 334

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score =  233 bits (595), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 159/257 (61%), Gaps = 6/257 (2%)

Query: 20  PLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSPY 79
           P F+    F WYY  ++ P+  D  RYR K+ VVP+FY S+Y Y V +FY   +  +SP 
Sbjct: 21  PQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFYLSVYSYMVYIFYSRTFAIISPM 80

Query: 80  LLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSL---ADCRVPFDEIIFHPGTICQTCH 136
           L  +E +                 M I+PDS+ +    ++ R P+D +++ P   C+TC 
Sbjct: 81  LTSIETYVVIPLMLILPLFFGSMSMIIKPDSSNAHQIGSEKRYPYDNLLYFPQHECRTCK 140

Query: 137 KIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLTSI 196
           ++KPARSKHC++CN CI + DHHC+W+NNC+G GNY YFY FL SN+ LLSYSF+RL  I
Sbjct: 141 QVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFI 200

Query: 197 QLMSQTENIK---TKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEF 253
           Q      N      K +L+L+IL G F +I+AV+ Y  F LV+ GMTTNE+DKW  V ++
Sbjct: 201 QFNKSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFELVNSGMTTNEKDKWQMVHDY 260

Query: 254 MRDGNLVRDKKGHYYFR 270
           +  G+LVRD +G Y+ +
Sbjct: 261 INTGDLVRDPEGKYFIK 277

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 488 DLAKDIGGG-FPGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFW 546
           DL +D  G  F  + N     NY FYST+ YD   Y + DY  +K P ++ NIYDKGNF 
Sbjct: 265 DLVRDPEGKYFIKYQN--GGNNYEFYSTDSYDGTQYTIVDYFTVKSPAEITNIYDKGNFI 322

Query: 547 ANLWDRIG 554
            NL + IG
Sbjct: 323 NNLREFIG 330

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  232 bits (591), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 123/289 (42%), Positives = 173/289 (59%), Gaps = 10/289 (3%)

Query: 7   LFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVL 66
           L +V Q++LLL SP ++ + PF  YY  +FHPL +D  +++ K+ ++P+FY  +Y+Y + 
Sbjct: 8   LLIVSQVILLLISPRYRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFYFVLYLYLIY 67

Query: 67  MFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXX-XXCMTIEPDSTKSLAD---CRVPFD 122
            +Y  +   ++  L   E++                  M  +P  TK  +D       FD
Sbjct: 68  CYYSKVAPFINNQLWAFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSDEIDNEYAFD 127

Query: 123 EIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSN 182
            +IF+P  +C+TC   KPARSKHCSIC++C+L+ DHHCIWVNNC+GKGNY YFY FL++N
Sbjct: 128 NLIFYPQILCRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITN 187

Query: 183 VTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTN 242
              L+Y+F+RL +I     T     K  L LTIL GCF +I  +F + Q NL  +GMTTN
Sbjct: 188 TFSLTYAFIRLLTI--FYTTNVYLPKNTLTLTILCGCFSVICGIFTFLQLNLAQEGMTTN 245

Query: 243 EQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSN 291
           E+DKWFTV EFMRDG LVR + G +YF        D D  E+   Y +N
Sbjct: 246 EKDKWFTVHEFMRDGKLVRTQSGRWYF----ADPHDSDISEDSVFYSTN 290

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 6/76 (7%)

Query: 480 VNALGRELDLAKDIGGGF----PGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKD 535
           V+   R+  L +   G +    P  S++S  ++  FYSTN YD   Y + ++++I+DP  
Sbjct: 253 VHEFMRDGKLVRTQSGRWYFADPHDSDIS--EDSVFYSTNGYDHTEYTLRNFEIIEDPSR 310

Query: 536 LNNIYDKGNFWANLWD 551
           + NIYD+G+F ANL D
Sbjct: 311 ITNIYDRGDFLANLRD 326

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score =  231 bits (588), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 180/296 (60%), Gaps = 10/296 (3%)

Query: 4   LFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIY 63
           L ++ ++  +VL+L SP+FKS  PF  +Y ++F P   D  +YRWK ++VPLFYTSIY+Y
Sbjct: 5   LLFVLLIGFVVLILLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLY 64

Query: 64  CVLMFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTK---SLADCRVP 120
            V  ++  +   +   L  LER                  M    + +K   S +    P
Sbjct: 65  LVYTYHMRVESTIKNELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGSTEEYP 124

Query: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           +D ++++P   C TC  +KPARSKHCSICN+C+L+ DHHCIW+NNCIGKGNY  FY FL+
Sbjct: 125 YDYLLYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184

Query: 181 SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240
           SN+  + Y+FLRL  I L S +     + +L LTIL GCF II A+F Y Q  +V +GMT
Sbjct: 185 SNIFSMCYAFLRLWYISLNSTST--LPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMT 242

Query: 241 TNEQDKWFTVQEFMRDGNLVR---DKKGHYYFRILDES--SSDRDQKEEEDSYRSN 291
           TNEQDKW+T+QE+MR+G LVR   D    ++F+  ++   +++  Q +    Y +N
Sbjct: 243 TNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTN 298

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 28/43 (65%)

Query: 511 FYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWDRI 553
           FYSTN YD   Y++  Y  IKD  ++ NIYDKG F ANL D I
Sbjct: 294 FYSTNAYDHKHYNLTHYITIKDASEIPNIYDKGTFLANLTDLI 336

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  229 bits (584), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 165/291 (56%), Gaps = 32/291 (10%)

Query: 19  SPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSP 78
           SP+FKS  PF  +Y ++F P   D  +YRWK+++VP+FYT IY+Y V  ++  +   +  
Sbjct: 20  SPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFYTLIYLYLVYTYHTRVEWLVRS 79

Query: 79  YLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRVPFDEIIFHPGTI------- 131
            L   ER                  +T+ P +   L       D     PG+        
Sbjct: 80  ELFLCERILVVPI------------ITLAPIACGILVMVTKAEDSYHHKPGSTEKYPYDY 127

Query: 132 --------CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNV 183
                   C TCH IKPARSKHCSICN+CIL+ DHHCIWVNNCIGKGNY  FY FL+SN+
Sbjct: 128 LLYYPVVKCSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNI 187

Query: 184 TLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNE 243
             L Y+FLRL  I L S+T     + +L LTIL GCF II  +F Y Q  +V +GMTTNE
Sbjct: 188 FSLLYAFLRLWCISLNSKTA--LPRAVLTLTILCGCFTIICIIFTYLQLTIVREGMTTNE 245

Query: 244 QDKWFTVQEFMRDGNLVR---DKKGHYYFRILDESSSDRDQKEEEDSYRSN 291
           QDKW+T+QE+MR+G LVR   D    ++ ++ ++ ++   Q +    Y +N
Sbjct: 246 QDKWYTIQEYMREGKLVRSLNDNCQSWFLKLTEDDTTKLTQDQHATFYSTN 296

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%)

Query: 501 SNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWDRI 553
           + ++  ++  FYSTN YD   Y++  Y  IKD  +++NIYDKG F AN  D I
Sbjct: 282 TKLTQDQHATFYSTNAYDHKQYNLAHYITIKDASEISNIYDKGTFLANFTDLI 334

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  227 bits (579), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 170/280 (60%), Gaps = 8/280 (2%)

Query: 19  SPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSP 78
           SP+FKS  PF  +Y  +F P   D  +YRWK+++VPLFYTSIY+Y V  ++  +   +  
Sbjct: 20  SPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKN 79

Query: 79  YLLFLERFXXXXXXXXXXXXXXXXCMTIEPDST---KSLADCRVPFDEIIFHPGTICQTC 135
            L  LER                  M  + + +   K  +  + P+D ++++PG  C TC
Sbjct: 80  ELFLLERILIVPIIILPPVVLGILAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTC 139

Query: 136 HKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLTS 195
             IK ARSKHCSICN+C+L+ DHHCIWVNNCIGKGNY  FY FL SN+  +SY+FLRL  
Sbjct: 140 RTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYF 199

Query: 196 IQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEFMR 255
           I   S    +  + +L LTIL GCF II A+F Y Q  +V +GMTTNEQDKW+T+QE+MR
Sbjct: 200 ISFNSTA--VLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMR 257

Query: 256 DGNLVR---DKKGHYYFRILDESSSDRDQKEEEDSYRSNN 292
           +G LVR   D    ++ +  ++  + +  +++  ++ S N
Sbjct: 258 EGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTN 297

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 28/43 (65%)

Query: 511 FYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWDRI 553
           FYSTN YD   Y ++ Y  IKD  ++ NIYDKG F ANL D I
Sbjct: 293 FYSTNAYDHHRYRLKHYTTIKDASEITNIYDKGTFLANLVDLI 335

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score =  223 bits (567), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 122/285 (42%), Positives = 161/285 (56%), Gaps = 9/285 (3%)

Query: 19  SPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSP 78
           SP  K+  PF  YY  ++ P  KD   Y+WKY+VVP FY SIY+Y V  +Y  +   +  
Sbjct: 19  SPFLKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVN 78

Query: 79  YLLFLERFXXXXXXXXXXXXXXXXCMTIEPD-------STKSLADCRVPFDEIIFHPGTI 131
           +L   ER                  M  +P        S       + PFD II+H G +
Sbjct: 79  HLNLFERGILLPLLIVLTPSFGILTMVTKPINIHGNGISQHDKLKNKFPFDNIIYHSGNV 138

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C TC+  KPARSKHC+IC  CIL+ DHHCIWVNNCIG GNYKYF+ FLL N   LSY+FL
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFL 198

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQ 251
           RL  I L S+ +  K+K +L L ILTG F +I  VF Y Q   V++GMTTNE DKW+ VQ
Sbjct: 199 RLLHITL-SKPDVPKSKNILALCILTGSFSVICGVFFYLQMKQVNNGMTTNETDKWYAVQ 257

Query: 252 EFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKM 296
           E MR+G L++ +  + +F +  E + D   +    ++  N   K+
Sbjct: 258 ELMREGKLIKSEDNN-WFALSTEDAPDSPSQVYSTNFYDNKTYKI 301

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 480 VNALGRELDLAK-DIGGGFPGHSNVSPKKNYRFYSTNPYDDLTYHVE-DYDVIKDPKDLN 537
           V  L RE  L K +    F   +  +P    + YSTN YD+ TY +  DY ++KD  ++ 
Sbjct: 256 VQELMREGKLIKSEDNNWFALSTEDAPDSPSQVYSTNFYDNKTYKISNDYHIVKDASEIP 315

Query: 538 NIYDKGNFWANL 549
           N+YD+G F  NL
Sbjct: 316 NVYDRGTFLDNL 327

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  217 bits (553), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 113/298 (37%), Positives = 171/298 (57%), Gaps = 10/298 (3%)

Query: 7   LFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVL 66
           + V+ QI++L  SP FK+      YY + + P+ +D  +YRWK+++VP+FY +++IY V+
Sbjct: 9   VLVILQILILFISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVI 68

Query: 67  MFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRV---PFDE 123
            FY  +   +   L + ERF                 M I PD+    ++  +    +D 
Sbjct: 69  NFYAKVEPLIHDKLTYFERFFFIPISIISTPFFGIITMLINPDTALMYSNDSIKKYAYDR 128

Query: 124 IIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNV 183
           I++ P T C+TC   KPARSKHC++C++CIL+ DHHC+WVNNCIG+GN+ YFY FL  N 
Sbjct: 129 ILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNT 188

Query: 184 TLLSYSFLRLTSIQL--MSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTT 241
             +SY+ +RL  I L      EN+  + ++ L IL GCF  I   F Y Q  +V DGMTT
Sbjct: 189 LFMSYASMRLLEITLNFRRAGENVP-RDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTT 247

Query: 242 NEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLLE 299
           NE+DKW+T+Q  M D  LV+    ++Y   ++    D+ + E   +   ++KK  L E
Sbjct: 248 NEKDKWYTIQCLMEDKKLVKSSDNNWYISFVN----DQGETEFYSTNAYDHKKYQLTE 301

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 501 SNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWD 551
           S V+ +    FYSTN YD   Y + +Y VI + +D+ NIYDKG+ W N  D
Sbjct: 276 SFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDKGSLWKNFKD 326

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score =  213 bits (541), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 171/277 (61%), Gaps = 6/277 (2%)

Query: 1   MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSI 60
           M L  W FVV Q+VLLLFSPL ++   F WYY ++F+P+F+D  ++R+K++VVP+ Y +I
Sbjct: 1   MSLYIWAFVVVQLVLLLFSPLLRARPVFKWYYRNVFYPIFEDADKFRFKFHVVPILYLAI 60

Query: 61  YIYCVLMFYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRVP 120
           Y+YC L+F++D+   +   L  +ER+                 M ++P+ST  +A     
Sbjct: 61  YLYCCLLFFRDIEGLIHSRLYAIERWFIIPVALMTPISCGLLTMLVKPEST-YIAPPVDQ 119

Query: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           FD I+FH G  C+TC   K ARSKHC+IC +C  + DHHC+W NNCIGKGNY+YFY FL 
Sbjct: 120 FDGILFHAGVECRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLA 179

Query: 181 SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240
           SNV L  Y F RL  +Q       +K++ +L L +L G F +I+ +F Y Q  L+ DGMT
Sbjct: 180 SNVFLTVYGFTRLLYLQ-----PTVKSRTLLTLALLLGSFALILVIFSYFQVVLIKDGMT 234

Query: 241 TNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSS 277
           TNE+ KW  V + MR   LV D  G +Y+RI +   S
Sbjct: 235 TNEESKWLVVHDMMRARKLVVDNAGKFYYRIPENEDS 271

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 498 PGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWDRIGK 555
           P  +  SP + Y FYSTNPYD+ TY V+    I D +++ NIYDKG+F  NL DRI +
Sbjct: 282 PELTTTSPSR-YTFYSTNPYDNCTYTVKYPREIVDYEEITNIYDKGSFCNNLKDRIRR 338

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score =  210 bits (534), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 151/253 (59%), Gaps = 5/253 (1%)

Query: 19  SPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSP 78
           SP+FK   P   YY   + P F D  RYRWKY +VP  Y  +Y++ ++ ++  +   ++P
Sbjct: 19  SPIFKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNP 78

Query: 79  YLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSL---ADCRVPFDEIIFHPGTICQTC 135
           +L + E+                  M  +P+++      ++ R  FDEI++ P   C+TC
Sbjct: 79  HLYWFEKGLILPIMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTC 138

Query: 136 HKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLTS 195
            K KPARSKHCSIC+KCIL+ DHHCIWVNNCIG GNYK+FY F+  N   + Y F RL  
Sbjct: 139 RKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIYCFTRLLF 198

Query: 196 IQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEFMR 255
           I +  +  +  ++ +L + IL G F II +VF Y Q +LV  G+TTNE DKW+T+ E+ R
Sbjct: 199 ISIKYKVTS--SRAILTMNILCGSFAIICSVFTYLQLDLVSQGITTNEMDKWYTIHEYCR 256

Query: 256 DGNLVRDKKGHYY 268
           DG L R K G+++
Sbjct: 257 DGKLARSKSGNWF 269

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 26/45 (57%)

Query: 507 KNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWD 551
            N  FYSTN YD   Y    Y +I DP D+ NIYDKG+ W N  D
Sbjct: 273 SNNTFYSTNIYDHTRYSPTQYTIINDPTDIQNIYDKGSCWLNFID 317

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score =  197 bits (501), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 146/264 (55%), Gaps = 11/264 (4%)

Query: 8   FVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLM 67
             V Q  L+L +P  ++  PF WYY  +F  + +DT R+RWKY   P FY  +Y YCV +
Sbjct: 8   LAVTQAGLILAAPALRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFYAGVYAYCVWL 67

Query: 68  FYKDLYRDLSPYLLFLERFXXXXXXXXXXXXXXXXCMTIEPDSTKSLADCRVPFDEIIFH 127
           FY ++Y +++  L   ER+                  T       +       +D ++FH
Sbjct: 68  FYGEVYAEIAKALWVPERWVLPAAVVAPAAAGVAAAATPAAVPADAA------YDGLLFH 121

Query: 128 PGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLS 187
            G  C+TC   KPARS+HC +C +C+ + DHHC+W+NNC+G+GNY  FY  L ++  LL+
Sbjct: 122 DGVECRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLFYLALGAHCALLT 181

Query: 188 YSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKW 247
           Y  +RL     ++       + +L L +L   F ++   F  TQ  LV DGMTTNEQDKW
Sbjct: 182 YGAVRLP----LAAPAGRWPRALLALELLVASFAVLCVWFTATQVALVRDGMTTNEQDKW 237

Query: 248 FTVQEFMRDGNLVRDKKGHYYFRI 271
           + VQE MR+G LVR  +G +Y R+
Sbjct: 238 YAVQESMREGTLVR-LRGRFYHRV 260

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 511 FYSTNPYDDLTY--HVEDYDVIKDPKDLNNIYDKGNFWANLWDRI 553
           FYSTN YD  TY  H E Y V+   +++ N+YD G+F  NL  R+
Sbjct: 268 FYSTNAYDHRTYALHNEPYAVVTSHEEIPNVYDTGSFCENLRQRL 312

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score =  187 bits (476), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 140/240 (58%), Gaps = 6/240 (2%)

Query: 27  PFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSPYLLFLERF 86
           P  WYY  ++ P   D  RYR KY +VP+FY S+Y Y + ++  +L   +   L F+E +
Sbjct: 28  PLSWYYEKVYRPFLADPTRYRVKYYIVPVFYFSLYCYMLNLYRSELLPVIWGRLYFIELY 87

Query: 87  XXXXXXXXXXXXXXXXCMTIEP------DSTKSLADCRVPFDEIIFHPGTICQTCHKIKP 140
                            M   P      D   + ++ + P+D I+++P T C++CH +K 
Sbjct: 88  FFQPLLLAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKW 147

Query: 141 ARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLTSIQLMS 200
           ARSKHCSIC +CI + DHHCIW N CIG+GN+ YFY FL  +  +L+Y+F RL    +++
Sbjct: 148 ARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAFARLFFFVVVA 207

Query: 201 QTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEFMRDGNLV 260
             +   T+  L L +LTG F ++V +F Y Q  LV +GMTTNEQDKWF + E+MRDG  V
Sbjct: 208 DNKLTSTRSTLTLLMLTGTFALLVDLFTYWQMMLVKEGMTTNEQDKWFLIHEYMRDGKCV 267

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 14/79 (17%)

Query: 473 GSAVEIHVNALGRELDLAKDIGGGFPGHSNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKD 532
           G  V +  N   ++  L  D  G              +FYSTN YD   Y + +Y ++K+
Sbjct: 264 GKCVNVSCNGSTKKWFLESDEDG--------------KFYSTNAYDHTAYTLTNYHIVKN 309

Query: 533 PKDLNNIYDKGNFWANLWD 551
             ++ N+YDKG+FW N  D
Sbjct: 310 ASEIINMYDKGSFWENFKD 328

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (64%), Gaps = 2/91 (2%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C+TC   +P RS HCSIC  C+LM DHHC+WVNNC+G+ NY+YF  FL S+   L+  FL
Sbjct: 184 CKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSST--LTSIFL 241

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDI 222
            + +   +++T ++   P+ VL I+ G   I
Sbjct: 242 IVNAAIDVARTPDVTDTPVAVLLIVYGFLTI 272

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 63/114 (55%), Gaps = 5/114 (4%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C TCH  +P R+ HCSIC  CI + DHHCIW+NNC+G  NY+YF  FL+    +LS  F+
Sbjct: 190 CSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVG--AILSSIFI 247

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDIIV--AVFGYTQFNLVHDGMTTNE 243
            +     +++       P+ +L I+ GC  II    + GY    L   G TT E
Sbjct: 248 IINCSIHVARIRRASNAPVAILLIVYGCLTIIYPGILLGY-HIALTGTGQTTRE 300

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 69/128 (53%), Gaps = 11/128 (8%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C +C   +P R+ HCS C  CIL  DHHCIWVNNCIG+ NY+YF  FL S   +LS  FL
Sbjct: 181 CTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLAS--AILSSIFL 238

Query: 192 RLTSIQLMSQTENIKTK-PMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTV 250
                  +    N+ +K P+ +L ++ G   II     Y    L++  + T  Q    T 
Sbjct: 239 IANCSIHIYHHRNLPSKVPVTILLLIYGGLAII-----YPMLLLIYHILMTGRQQ---TT 290

Query: 251 QEFMRDGN 258
           +EF+R+ N
Sbjct: 291 REFLREAN 298

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 71/127 (55%), Gaps = 14/127 (11%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C TC   +P RS HCSIC  CI+  DHHCIWVNNCIG+ NY++F  FLLS     +  FL
Sbjct: 217 CTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGT--FTSIFL 274

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDII--VAVFGYTQFNLVHDGMTTNEQDKWFT 249
            + +   +++T  ++  P+ VL I+ G   I   + +F Y      H  MT  +Q    T
Sbjct: 275 IINASIDIARTPKVRDTPVAVLLIIYGGLTIWYPLILFCY------HIFMTGTQQ----T 324

Query: 250 VQEFMRD 256
            +E+++ 
Sbjct: 325 TREYLKS 331

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 77/145 (53%), Gaps = 12/145 (8%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           CQ+C   +P R+ HCS CN C+++ DHHC+WVNNC+GK NY++F  FLLS +   S   L
Sbjct: 175 CQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAI-FSSVFLL 233

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQ 251
              +I +  +++  +  P+ +L ++     I      +T     H  M   +Q    T +
Sbjct: 234 TNCAIHIARESDGPRNYPVALLLLIYAGLTIWYPAILFTY----HIFMAGTQQ----TTR 285

Query: 252 EFMRDGNLVRDKKGHYYFRILDESS 276
           EF++    +  KK   + R++ E +
Sbjct: 286 EFLKG---IGSKKNPVFHRVVKEQN 307

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 12/143 (8%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C +C   +P RS HCS CN C+++ DHHCIWVNNCIGK NY++F  FLL  + L S   L
Sbjct: 175 CPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAI-LSSVILL 233

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQ 251
              +I +  ++   +  P+ +L +   C+  +   +    F   H  M  N+Q    T +
Sbjct: 234 TNCAIHIARESGGPRDCPVAILLL---CYAGLTLWYPAILFTY-HIFMAGNQQ----TTR 285

Query: 252 EFMRDGNLVRDKKGHYYFRILDE 274
           EF++    +  KK   + R++ E
Sbjct: 286 EFLKG---IGSKKNPVFHRVVKE 305

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 76/145 (52%), Gaps = 12/145 (8%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           CQ+C   +P RS HCS CN C+++ DHHCIWVNNCIGK NY++F  FLLS V + S   L
Sbjct: 175 CQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAV-ISSIILL 233

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQ 251
              +I +  ++      P+ +L +   C+  +   +    F   H  M   +Q    T +
Sbjct: 234 ANCAIHIARESGGPGHYPVAILLL---CYAGLTLWYPAILFTY-HVFMAGTQQ----TTR 285

Query: 252 EFMRDGNLVRDKKGHYYFRILDESS 276
           EF++    +  KK   + R+  E +
Sbjct: 286 EFLKG---IGSKKNPVFHRVTKEQN 307

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 75/143 (52%), Gaps = 12/143 (8%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C +C   +P RS HCS CN C+++ DHHCIWVNNCIGK NY++F  FLLS +   S   L
Sbjct: 175 CTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAI-FSSILLL 233

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQ 251
              ++ +  ++   +  P+ +L +   C+  +   +    F   H  M   +Q    T +
Sbjct: 234 VNCAVHIARESGGPRDYPVAILLV---CYVGLTVWYPAILFTY-HIFMAGTQQ----TTR 285

Query: 252 EFMRDGNLVRDKKGHYYFRILDE 274
           EF+R    +  KK   + R++ E
Sbjct: 286 EFLRG---IGSKKNPVFHRVVKE 305

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 83/151 (54%), Gaps = 15/151 (9%)

Query: 118 RVPF-DEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFY 176
           R+P  DE  +   T C+TC   +P RS HCSIC+ C++ +DHHC+W+NNC+GK NY+YF 
Sbjct: 181 RLPIKDESQYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFL 240

Query: 177 GFLLSNVTLLSYSFLRL-TSIQLMSQTENIKTK---PMLVLTILTGCFDIIVAVFGYTQF 232
            FL S  T+++  FL + T I +       K     P+ +L  + G   I   +     +
Sbjct: 241 IFLTS--TIMTVIFLLINTGIHIGKNRHEKKPASNIPVTILLTVYGSLSISYPII-LLAY 297

Query: 233 NLVHDGMTTNEQDKWFTVQEFMRDGNLVRDK 263
           +LV  G  TN+     T +EF++    +RD+
Sbjct: 298 HLVLTG--TNQ-----TTREFLKYVYEIRDQ 321

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (53%), Gaps = 16/136 (11%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C TC   +P R+ HCS+C  CIL  DHHC WVNNCIG+ NY+YF  FL+S+  L +   +
Sbjct: 173 CPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSS-WLTAVICI 231

Query: 192 RLTSIQLMSQTENIKTKPMLVLTI---LTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWF 248
              +I++   T  +K    ++L I   L  C+  ++ ++        H  +T+ +Q    
Sbjct: 232 VSCAIRIAHATRLVKVAVAILLLIYCALCSCYPFLLLLY--------HVFLTSTQQ---- 279

Query: 249 TVQEFMRDGNLVRDKK 264
           T +E+++ G    D +
Sbjct: 280 TTREYLKGGRPTTDIR 295

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 67/127 (52%), Gaps = 16/127 (12%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C +C   +P R+ HCS C  C++  DHHCIWVNNC+G+ NY+YF  FL+  V L     +
Sbjct: 181 CTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTV-LAELFLI 239

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDII--VAVFGYTQFNLVHDGMTTNEQDKWFT 249
              SI +  ++  +   P+ +L ++  C  I+    + GY      H  MT  +Q    T
Sbjct: 240 ANCSIHIARRSSQV---PVTILLLVYACLSILYPAILLGY------HVFMTGTQQ----T 286

Query: 250 VQEFMRD 256
            +EF++ 
Sbjct: 287 TREFLKQ 293

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 70/132 (53%), Gaps = 18/132 (13%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C TC   +P R+ HCS+C  C+L  DHHCIWVNNC+G+ NY+YF  FLLS+ TL     +
Sbjct: 160 CHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSS-TLACALLI 218

Query: 192 RLTSIQL---MSQTENIKTKPMLVLTILTGCFDII----VAVFGYTQFNLVHDGMTTNEQ 244
              ++ L   + +   +  +P+ V  +L     ++    V + GY      H  M+  +Q
Sbjct: 219 ANCALHLHRALHEGIRVSHRPLPVAVLLCVYAAVLCVYPVILLGY------HVAMSGTQQ 272

Query: 245 DKWFTVQEFMRD 256
               T +E++R 
Sbjct: 273 ----TTREYLRS 280

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 85/164 (51%), Gaps = 26/164 (15%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C TC   +P R+ HCS C  CI+  DHHC WVNNCIG+ NY YF+ FL+S V  ++ +F+
Sbjct: 172 CTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCV--IATAFI 229

Query: 192 RLTSIQLMSQTENIKTKPMLVLTI----LTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKW 247
                  +S++ + K  P+ +L +    L  C+  I+ V+        H  +T ++Q   
Sbjct: 230 IANCAIRVSRSVHAKDAPVAILLLIYCGLVVCYPFILLVY--------HIFLTGSQQ--- 278

Query: 248 FTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSN 291
            T +E+++    +  K       I  + SS +D   ++ S+ +N
Sbjct: 279 -TTREYLKS---IGSKNP-----IFHKISSSQDNPFQKGSFLAN 313

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           CQTC   KP R  HCS CNKC L +DHHC W  +C+G  N K+F  F L+  T+ S   L
Sbjct: 105 CQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQF-LAYTTVYSLYVL 163

Query: 192 RLTSIQLMSQTENIKTKPML----VLTILTGCFDIIVAVFGYTQFN--LVHDGMTTNEQD 245
            +TS QL S    +K K  L    +L +        +A F +T +   LV    TT EQ 
Sbjct: 164 LMTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLVTKNETTIEQY 223

Query: 246 KW 247
           +W
Sbjct: 224 EW 225

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 63/132 (47%), Gaps = 8/132 (6%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C TC   +P R+ HCS CN CI+  DHHCIWVNNC+G+ NY+YF  F+ S V  L+   L
Sbjct: 189 CTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAV--LTIILL 246

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQ 251
            +     +S+       P L+L    G       + G     L     TT+E  K     
Sbjct: 247 VINCSVRLSKGSPTAKTPSLLLICYCGVGIWYPLILGIYHIFLAGTQQTTHEYLK----- 301

Query: 252 EFMRDGNLVRDK 263
             ++ GN +  K
Sbjct: 302 -LIKSGNPICHK 312

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C+TC   +P R+ HCSIC  C++  DHHCIW+NNC+G+ NY+YF  FL+S  TL S   L
Sbjct: 178 CRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISG-TLASIFLL 236

Query: 192 RLTSIQLMSQTENIK 206
              +I L  +  +I 
Sbjct: 237 ANCAIHLARRRRSIS 251

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 2/84 (2%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           CQTC   +P RS HCS+C+ C+L  DHHC W+NNCIGK NY++F  FL+++   +S   L
Sbjct: 174 CQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMAST--ISCILL 231

Query: 192 RLTSIQLMSQTENIKTKPMLVLTI 215
            L S   +S +  ++  P+ +L I
Sbjct: 232 ILLSSFRLSYSPQVRYTPVSLLII 255

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF- 190
           C+ C   KP RS HC  CN+C+LM+DHHC W  NC+G  NY +F  FL   +   S  F 
Sbjct: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139

Query: 191 LRLTSIQLMSQTENI-----KTKPMLVLTILTG----CFDIIVAVFGYTQFNLVHDGMTT 241
           ++   I  + Q  ++     K   ++ LTI +         I  +F    FN + +G + 
Sbjct: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQ 199

Query: 242 NEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEED 286
            E      ++     G L +    + + RI  ES S +++K+ E+
Sbjct: 200 IESWDMDRLESLFNSGRLTQKLIDNTW-RIYPESRSFQNKKDAEE 243

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 78/164 (47%), Gaps = 11/164 (6%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF- 190
           C+ C   KP RS HC  CN+C+LM+DHHC W  NC+G GNY +F  FL   +   S  F 
Sbjct: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILFC 139

Query: 191 LRLTSIQLMSQTEN-----IKTKPMLVLTILTG----CFDIIVAVFGYTQFNLVHDGMTT 241
           +++  I  + Q  N      K   +  LTIL+         I  +F    FN + +G + 
Sbjct: 140 IQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLTITVLFLRCLFNQIVNGRSQ 199

Query: 242 NEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEE 285
            E      ++       L++ K  +  +RI  ES + + +++ E
Sbjct: 200 IESWDMDRLESLFDSRRLIQ-KLIYNTWRIYPESKTLQHERDAE 242

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 79/164 (48%), Gaps = 11/164 (6%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF- 190
           C+ C   KP RS HC  CN+C+LM+DHHC W  NC+G  NY +F  F+   +    + F 
Sbjct: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159

Query: 191 LRLTSIQLMSQTENI-----KTKPMLVLTILTG----CFDIIVAVFGYTQFNLVHDGMTT 241
           ++L  +  + Q  ++     K   ++ LTILT         IV +F    FN + +G + 
Sbjct: 160 IQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLTIVILFLRCLFNQIINGRSQ 219

Query: 242 NEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEE 285
            E      ++       L++ K     +RI  E+ S + +++ E
Sbjct: 220 IESWDMDRLESLFDSQRLIK-KLIENTWRIYPEARSPQLERDAE 262

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 75/160 (46%), Gaps = 12/160 (7%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           ICQTC   KP R  HCS CN+CIL +DHHC W   CIG  N KYF  FL    T  S   
Sbjct: 105 ICQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFY-CTSYSIIV 163

Query: 191 LRLTSIQLMS-------QTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNE 243
           L +TSIQ+         + E I  K + V  +    F  +V   G++ F L+ +  T   
Sbjct: 164 LFVTSIQIYHWFRSTSYEYEFIDFKLLTVWLLAIVIFISLVLFTGFSVFQLLGNQTTI-- 221

Query: 244 QDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKE 283
             + +  + +  + N++ D  G     I D  S   + K+
Sbjct: 222 --ELYAYRRYKAELNIIGDLDGSENINIFDLGSRYENWKD 259

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 6/94 (6%)

Query: 130 TICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL----LSNVTL 185
           T C+ C   KP R+ HC  CNKCILM+DHHC W  NC+G  NY +F  FL    ++   L
Sbjct: 79  TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFL 138

Query: 186 LSYSFLRLTSI--QLMSQTENIKTKPMLVLTILT 217
           L+  F R+  I     S +  ++ + +++LTILT
Sbjct: 139 LAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILT 172

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 63/117 (53%), Gaps = 8/117 (6%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +C+TC+  KP R  HCS C+KCIL +DHHC W   C+G  N KYF  FL+   T+ +   
Sbjct: 105 VCRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYT-TVYAILV 163

Query: 191 LRLTSIQL-------MSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240
           +  TS Q+       + +TE IK + ++V  +    F  +    G++ +  +++  T
Sbjct: 164 MTYTSFQIYDWFKNELYETEIIKIRLLMVWILSVAVFLTVTCFTGFSIYQTINNRTT 220

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 74/144 (51%), Gaps = 16/144 (11%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C TC   KP RS HCS CNKC L  DHHC W ++CIG  N K+F  FL+ + TL S S  
Sbjct: 110 CATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYS-TLYSISIF 168

Query: 192 RLTSIQLMS-------QTENIKTKPMLVLTILTGCFDIIVAVFGYTQFN--LVHDGMTTN 242
              ++Q++S        T+ I    ++V  + TG     V++F +T F+  L+    TTN
Sbjct: 169 IAATLQIVSWFRNQNYTTQYIDINLLVVWLLSTGA---SVSLFCFTGFSIYLLTKNQTTN 225

Query: 243 EQDKWFTVQEFMRDGNLVRDKKGH 266
           E +     +   RD  +  +  GH
Sbjct: 226 ELN---ASKYLNRDLEIFNESLGH 246

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 1/68 (1%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +C+TCH  KP R  HCS CN+CIL +DHHC W+ +C+G  N KYF  FL+   TL +++ 
Sbjct: 107 LCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLM-YATLYAFNV 165

Query: 191 LRLTSIQL 198
           L   +IQL
Sbjct: 166 LIFDTIQL 173

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 69/144 (47%), Gaps = 10/144 (6%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C+ C   KP R  HCS C KC L +DHHC W  +C+G  N KYF  FL+   T+ S    
Sbjct: 106 CRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYG-TVFSILIF 164

Query: 192 RLTSIQLMSQTENIK------TKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQD 245
            L+  +L+   +N +        P+LV+ IL+    I +  F      L+    TT E  
Sbjct: 165 LLSGTELLLWFKNQRYNQEMIQLPLLVVWILSVAISISMLAFTSYTVYLITKNQTTIEMY 224

Query: 246 KWFTVQEFMRDGNLVRDKKGHYYF 269
           +W  ++    + N++ + +G   F
Sbjct: 225 EWSNLKA---EANIMDEVRGTNTF 245

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 61/119 (51%), Gaps = 7/119 (5%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +C+TC+  KP RS HCS CN+C+L +DHHC W + CIG  N K+F  FL+ N T  +Y  
Sbjct: 109 VCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYNTT-YAYVI 167

Query: 191 LRLTSIQLM------SQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNE 243
             LTS Q+       S         +L L IL     + ++ F      +V +  TT E
Sbjct: 168 AILTSKQMYNWFDDGSYENEFVNMYLLFLWILALVVSLALSCFAGFSVYMVMNNKTTIE 226

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 67/147 (45%), Gaps = 20/147 (13%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL----LSNVTLLS 187
           C  C+  KP RS HC  C +C+LM+DHHC W  NC+G GN+  F  FL    ++   L  
Sbjct: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141

Query: 188 YSFLRLTSI------QLMSQTENIKTKPMLVLTILTG----CFDIIVAVFGYTQFNLVHD 237
           Y  LR+ +I       +     +  TK ++ L +LT         I A+F     N V  
Sbjct: 142 YLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVTNQVIG 201

Query: 238 GMTTNEQDKWFTVQEFMRDGNLVRDKK 264
           GMT  E   W    E  R  N+   KK
Sbjct: 202 GMTQIE--SW----EMERLQNMFYSKK 222

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 66/123 (53%), Gaps = 7/123 (5%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           IC+ C   KP RS HCS CNKC L +DHHC W  +CIG  N K F  FLL       + F
Sbjct: 104 ICRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFVF 163

Query: 191 LRLTSIQLMSQTEN-IKTKPMLVLTILT-GCFDII--VAVFGYTQFN--LVHDGMTTNEQ 244
           +  T +QL    +N +  K ++ L+++T     II  +++F +T ++  LV    TT E 
Sbjct: 164 MT-TGLQLWKWLDNKMYEKELIDLSLMTVWLLSIISCISMFAFTSYSIYLVTKNTTTIEM 222

Query: 245 DKW 247
             W
Sbjct: 223 YGW 225

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 82/159 (51%), Gaps = 10/159 (6%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +CQTC   KP R  HCS CNKCIL +DHHC W   CIG  N K+F  FL+   T+ ++  
Sbjct: 108 LCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIY-CTIYAFVA 166

Query: 191 LRLTSIQLMS--QTENIKTKPMLVLTILTG--CFDIIVAVFGYTQFNL--VHDGMTTNEQ 244
           L L S Q ++  + +N   + +    ++ G   F I ++V  ++ F++  V    TT E 
Sbjct: 167 LGLISYQFVNWYKNQNYMNEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRTTIEM 226

Query: 245 DKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKE 283
              + ++ + RD  ++   +   +  I +  S+  + KE
Sbjct: 227 ---YGIRRYNRDFAILNGTEESDFKNIFELDSNLLNWKE 262

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL----LSNVTLLS 187
           C TC   +P R+ HC++C+ CIL  DHHC W+NNCIG+ N++YF  FL    LS++ LL+
Sbjct: 187 CTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWLLT 246

Query: 188 YSFLRL 193
              L+L
Sbjct: 247 CCALKL 252

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLS 181
           C TC   +P R+ HCS C  C+L  DHHC WVNNCIG+ NY+YF  FL S
Sbjct: 178 CATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLAS 227

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 76/155 (49%), Gaps = 8/155 (5%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +CQTC   KP R  HCS C+KCIL +DHHC W   CIG  N KYF  FL+   T  S   
Sbjct: 100 LCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIY-CTAYSIVV 158

Query: 191 LRLTSIQLM-----SQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQD 245
           L  TS +L       Q E+ +   +++LT+      I V++  ++ F+ ++  +      
Sbjct: 159 LFFTSCELHYWFSGKQYED-ELIDLMLLTVWILAIVITVSLIFFSSFS-IYQLLKNQTTI 216

Query: 246 KWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRD 280
           + + ++   RD  L+R  +      I D  S  R+
Sbjct: 217 EMYGMKREKRDLELLRGLEDAEVDNIFDLGSRRRN 251

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +CQ+C   KP R  HCS C++CIL +DHHC W+  C+G  N K F  FLL   T  +   
Sbjct: 102 VCQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYT-TAYAIFV 160

Query: 191 LRLTSIQLMSQ------TENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQ 244
           L +TS+QL          E + +  +L L I +    I + +F     + V    TT E 
Sbjct: 161 LSMTSVQLYRWFYNDKFQEELISGYLLFLWIFSLVVFIAMTLFSAFSVSQVLKNQTTIEM 220

Query: 245 DKWFTVQEFMRDGNLVRDKKG 265
              + VQ +     ++ D++ 
Sbjct: 221 ---YGVQRWRNQARILGDQQA 238

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 24/185 (12%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C+ C   KP R+ HC  CN+C+LM+DHHC W  NC+G  N+ +F  FL+  +   ++   
Sbjct: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139

Query: 192 RLTS-IQLMSQTENIK-----TKPMLVLTILTG----CFDIIVAVFGYTQFNLVHDGMTT 241
           +L S I ++ +  N+         ++ LTILT         I  +      N + +GM+ 
Sbjct: 140 QLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLTITILLCRCLANQIFNGMSQ 199

Query: 242 NEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSD-----RDQKEEEDSYRSNNKKKM 296
            E  +   +Q       LV          +L E++ D     R+Q  E  +   +  K++
Sbjct: 200 IETWELERLQALFDSKRLV---------PLLIEAAWDIFPGTREQINESTAAELSMNKEL 250

Query: 297 LLENA 301
            LE+ 
Sbjct: 251 RLEDV 255

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 67/139 (48%), Gaps = 14/139 (10%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C   +P R+ HC IC  C+   DHHC W+NNC+G+ NY+YF  FL +     +  F+
Sbjct: 186 CTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCATCTVLFV 245

Query: 192 RLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQ 251
             ++I L  +T  +     +VL   +G     +A++      + H  MT   Q    T +
Sbjct: 246 S-SAIHLSHETRAVP----IVLVAYSG-----IALWYPLVLLVYHVCMTATGQ----TTR 291

Query: 252 EFMRDGNLVRDKKGHYYFR 270
           EF+   + V++   H   R
Sbjct: 292 EFLHTLDGVKNPVLHPRVR 310

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 83/185 (44%), Gaps = 20/185 (10%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF- 190
           C+ C   KP RS HC  CN+C+LM+DHHC W  NC+G  NY +F  FL   +   S  F 
Sbjct: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139

Query: 191 LRLTSIQLMSQTENI-----KTKPMLVLTILTG----CFDIIVAVFGYTQFNLVHDGMTT 241
           +++  I  + Q  ++     +   ++ LTIL+         I  +F     N + +G + 
Sbjct: 140 MQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSNQIINGRSQ 199

Query: 242 NEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLLENA 301
            E      ++     G L+  K     +RI  E+ S + +++ +         K+L +  
Sbjct: 200 IESWDMDRLESLCDSGKLI-PKLIDNTWRIYPEARSSQHERDAD---------KLLTQRG 249

Query: 302 NTRID 306
             R D
Sbjct: 250 RARFD 254

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 62/124 (50%), Gaps = 11/124 (8%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C+TC   KP R  HCS CNKC L +DHHC W  +C+G  N KYF  FLL      +YS L
Sbjct: 133 CRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTT---AYSIL 189

Query: 192 R--LTSIQLM----SQ--TENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNE 243
              LT   L+    SQ   + +   P+L++ IL+    I +  F      LV    TT E
Sbjct: 190 VFFLTGADLLMWFRSQGYNQELINLPLLIVWILSLVITISMLAFTSYTIYLVAKNQTTIE 249

Query: 244 QDKW 247
             +W
Sbjct: 250 MYEW 253

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 61/122 (50%), Gaps = 10/122 (8%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL---LSNVTLLSY 188
           C+ C   KP R+ HC  C +C+L++DHHC +  NC+G  N+ +F  FL   ++  T LS 
Sbjct: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139

Query: 189 SFLRLTSIQL---MSQTENIKTKPMLVLTILTGC----FDIIVAVFGYTQFNLVHDGMTT 241
            F + T        S  + +  K ++ LTILT         I  +FG    N V +GMT 
Sbjct: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199

Query: 242 NE 243
            E
Sbjct: 200 IE 201

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +C+TCH  KP R  HCS C+KCIL +DHHC W   CIG  N ++F  +LL   T     F
Sbjct: 106 VCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIF 165

Query: 191 LRLTSIQLM 199
           L  +SIQL+
Sbjct: 166 L-FSSIQLL 173

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 66/139 (47%), Gaps = 9/139 (6%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSY-S 189
           ICQ C   KP R+ HC  C++C+L++DHHC W  NC+G  N+ +F  FL+  +   SY  
Sbjct: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLG 138

Query: 190 FLRLTSIQLMSQTENIK---TKPMLVLTILTGCFD-----IIVAVFGYTQFNLVHDGMTT 241
           F+    I +  Q  + +    K  LV   +    +      I+ +      N    GMT 
Sbjct: 139 FMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQ 198

Query: 242 NEQDKWFTVQEFMRDGNLV 260
            E+ +W  ++    +G L+
Sbjct: 199 IERWEWERIENQFNNGRLI 217

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSY-SF 190
           C+ C+  KP RS HC  CN+C+LM+DHHC W  NCIG  N+ +F  FLL  +    +  F
Sbjct: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLF 139

Query: 191 LRLTSIQLMSQTENIKT 207
            ++  I  M    N+ +
Sbjct: 140 YQIKRIIYMWNNRNLPS 156

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 129 GTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSY 188
            T C+ C+  KP RS HC  CN+C+LM+DHHC W  NC+G  N+ +F  FL+    +++ 
Sbjct: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMW--IIITT 138

Query: 189 SFLRLTSIQLMSQTENIKTKP 209
            FL +  ++      N++  P
Sbjct: 139 GFLLVHLLKRTMTMWNLRHLP 159

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 35/54 (64%)

Query: 129 GTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSN 182
             +C+TC   KP R  HCS C++CIL +DHHC W   CIG  N+KYF  FL+ N
Sbjct: 103 ARVCRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYN 156

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNV----TLL 186
           +CQ CH  KP R  HCS C+ CIL +DHHC W   C G  N K F  FL+        +L
Sbjct: 105 VCQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTFYAFLVL 164

Query: 187 SYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNL--VHDGMTTNEQ 244
            YS   L +    S + N +     +L +      I ++V  +T F++  V +  TT E 
Sbjct: 165 IYSCYELGT-WFHSGSFNQELIDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQTTIEL 223

Query: 245 DKWFTVQEFMRDGNLVRDKKG 265
              + ++ + RD  ++ D  G
Sbjct: 224 ---YGMRRYRRDLEIINDTYG 241

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVT---LLSY 188
           C+ C   KP R+ HC  CN+C+LM+DHHC W  NC+G  N+ +F  FL   V     L Y
Sbjct: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139

Query: 189 SFLRLT 194
             L+ T
Sbjct: 140 QLLKRT 145

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 84/190 (44%), Gaps = 19/190 (10%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL----LSNVTLLS 187
           C+ C   KP RS HC  CN+C+LM+DHHC W  NC+G  N+ +F  FL    +   +L  
Sbjct: 80  CKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAI 139

Query: 188 YSFLRLTSIQLMSQTENIK--TKPMLVLTILTGCFDIIVAVFGYTQ----FNLVHDGMTT 241
           +   R+ SI +   + +       ++ LTILT     I+           FN + +G + 
Sbjct: 140 FLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQ 199

Query: 242 NEQDKWFTVQEFMRDGNL--VRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLL- 298
            E  +   ++   R   L  +  +   Y F  L      R++  E  +    NKK++ L 
Sbjct: 200 IESWEMDRLETLARMSKLLPILIENVWYIFPNL------RNEHVESQAEALLNKKRLSLD 253

Query: 299 ENANTRIDYG 308
           E  N   D G
Sbjct: 254 ELVNFPYDLG 263

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 64/146 (43%), Gaps = 12/146 (8%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL----S 181
           F     C  C+  KP R+ HC  CN+C+L +DHHC W  NC+G  N+ +F  FL     +
Sbjct: 74  FEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIET 133

Query: 182 NVTLLSYSFLRLTSIQLMSQTEN--IKTKPMLVLTILTGCFDIIVAVFGYTQF-----NL 234
              LL+Y   R+  +       N  +    ++ LTILT   D  V +           N 
Sbjct: 134 TSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTP-MDAFVLLTISLLLLRCAKNQ 192

Query: 235 VHDGMTTNEQDKWFTVQEFMRDGNLV 260
           +  GMT  E  +   ++     G L+
Sbjct: 193 ILKGMTQIESWEMDRIENMFHSGQLI 218

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +CQ CH  KP R  HCS C+ CIL +DHHC W   C G  N K+F  FL+   TL ++  
Sbjct: 105 VCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYT-TLYAFLV 163

Query: 191 LRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVF----GYTQFNL--VHDGMTTNEQ 244
           L  T  +L +   +      L+   L G   + VAVF     +T F++  V    TT E 
Sbjct: 164 LIYTCYELGTWFNSGSFNRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQTTIEV 223

Query: 245 DKWFTVQEFMRDGNLVRDKKG 265
                ++ + RD  ++ D  G
Sbjct: 224 HG---MRRYRRDLEILNDSYG 241

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 6/92 (6%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C+ C+  KP R+ HC  C +C+LM+DHHC W  NC+G  N+ +F  FL   +   +Y   
Sbjct: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139

Query: 192 RLTS-IQLMSQTENIKT-----KPMLVLTILT 217
            L S I  + ++ N+ +       ++ LTI T
Sbjct: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITT 171

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 70/143 (48%), Gaps = 14/143 (9%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +CQ CH  KP R  HCS C+ CIL +DHHC W   C G  N K+F  FL+       Y+F
Sbjct: 105 VCQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTT---FYAF 161

Query: 191 LRL--TSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVF----GYTQFNL--VHDGMTTN 242
           L L  T  +L +   +      L+   L G   + +AVF     ++ F++  V +  TT 
Sbjct: 162 LVLIDTCYELGTWFNSGSFSRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQTTI 221

Query: 243 EQDKWFTVQEFMRDGNLVRDKKG 265
           E     +++ + RD  ++ D  G
Sbjct: 222 ELH---SMRRYRRDLEILNDSYG 241

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 39/74 (52%)

Query: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           F+  I      C+ C   KP R+ HC  C +C+L +DHHC W  NC+G  N+ +F  FL 
Sbjct: 69  FEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLT 128

Query: 181 SNVTLLSYSFLRLT 194
             V   SY  L LT
Sbjct: 129 WVVLTTSYLGLLLT 142

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 68/143 (47%), Gaps = 14/143 (9%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +CQ CH  KP R  HCS C+ C+L +DHHC W   C G  N K+F  FL+       Y+F
Sbjct: 105 VCQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTT---CYAF 161

Query: 191 LRL--TSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVF----GYTQFNL--VHDGMTTN 242
           L L  T  +L +   +      L+   L G   + VAVF     +T F++  V    TT 
Sbjct: 162 LVLIYTCYELGTWFNSGSFNRELIDFQLLGVALLAVAVFITVLAFTVFSIYQVCKNQTTI 221

Query: 243 EQDKWFTVQEFMRDGNLVRDKKG 265
           E      ++ + RD  ++ D  G
Sbjct: 222 EVHG---MRRYRRDLEIINDSYG 241

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 58/123 (47%), Gaps = 10/123 (8%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSY-SF 190
           C+ C   KP R+ HC  CN+C+L +DHHC W  NC+G  N+ +F  FL   +   +Y  F
Sbjct: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTAYLLF 139

Query: 191 LRLTSIQLMSQTENI-----KTKPMLVLTILTG----CFDIIVAVFGYTQFNLVHDGMTT 241
           L +  I L+    +       T  ++ + I+T         + ++ G   +N    GMT 
Sbjct: 140 LLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLTVSSLLGRCIYNQCLHGMTQ 199

Query: 242 NEQ 244
            E 
Sbjct: 200 IES 202

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C+ C   KP R+ HC  CN+C+L +DHHC W  NC+G  N+ +F  FL   +    Y   
Sbjct: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139

Query: 192 RL 193
            L
Sbjct: 140 EL 141

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 131 ICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF 190
           +C++C   KP R  HCS CN C+L +DHHC W   C+G  N K+F  FL+   T+ S   
Sbjct: 105 VCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIY-CTVYSILV 163

Query: 191 LRLTSIQL 198
           L L+S+++
Sbjct: 164 LILSSMEI 171

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           C  C   KP R  HCS C+KC L  DHHC+W   CIG  N+K+F  FLL
Sbjct: 171 CVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLL 219

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIG----KGNYKYFYGFLLSNVTLLS 187
           C  C   KP R+ HC  CN+C+L++DHHC W  NC+G       +  F   + +   LL 
Sbjct: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLH 139

Query: 188 YSFLRL--TSIQLMSQTENIKTKPMLVLTILT 217
           Y   R+  T +   +    +  + ++ LTILT
Sbjct: 140 YFVKRIKFTWVNRYATANLVSKQELIFLTILT 171

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 4/50 (8%)

Query: 142 RSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL----LSNVTLLS 187
           R+ HC  CN C++M+DHHC W  NC+G  NY +F  FL    +S   LLS
Sbjct: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 28/49 (57%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           C  C  +K  RS H S+ N CI   DH+CIW+   IGK NYK F  FL 
Sbjct: 119 CSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFLF 167

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 43/91 (47%), Gaps = 1/91 (1%)

Query: 105 TIEPDSTKSLADCRVPFDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVN 164
           +IEP +T S+        +I  +P   C TC  +K  R+ H      CI   DHHC+WV 
Sbjct: 98  SIEPTATASIPPPVFYECDINGYP-IWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVG 156

Query: 165 NCIGKGNYKYFYGFLLSNVTLLSYSFLRLTS 195
             IGK NY  F  F+     LL   ++ + S
Sbjct: 157 TVIGKSNYLLFTQFVFYFSCLLLIFWISIVS 187

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 1/88 (1%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C  +K  R+KH S    C+   DH+C+W+   IG  NY+ F  F+     LL   ++
Sbjct: 116 CSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAVLLMIVWI 175

Query: 192 RLTS-IQLMSQTENIKTKPMLVLTILTG 218
            ++  I+ + Q        ++VL I++G
Sbjct: 176 TISVYIRDIRQYHARLNANLIVLLIISG 203

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGF 178
           C  C  IK  R+ H S    CI   DH+C+W+   +G+ NY+ F  F
Sbjct: 132 CTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQF 178

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 50/101 (49%), Gaps = 11/101 (10%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYK-------YFYGFLLSNVT 184
           C  C  +K  R+ H S    CI   DH+C+W+   +G+ NY+       YF+ F +  + 
Sbjct: 125 CTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYMIA 184

Query: 185 LLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVA 225
            ++ SFLR     + S+++  +  P +++ +   C  +++ 
Sbjct: 185 SIA-SFLRRI---IKSRSQIPRVNPNILVVLALCCMAMLMV 221

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C  +K  R+ H S    C+   DH+C+WV   IGK NY  F  F+      LS  ++
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWV 182

Query: 192 RLTS 195
            + S
Sbjct: 183 SIVS 186

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           C TC  +K  RS H  +   C+   DH+C+W+   IG+ NYK F  +++
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVM 175

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 5/99 (5%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C  +K  R+ H S    CI   DH+C+W+   IG+ NY+ F  F     TLL   ++
Sbjct: 131 CSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYFSTLLLIMWV 190

Query: 192 RLTS-IQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGY 229
            +   I++++Q  N    P L   I++    ++ A+ G+
Sbjct: 191 SICVYIRIITQ-HNHNYSPNLNANIIS---TLVFAILGW 225

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 5/99 (5%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C  +K  RS H S    CI   DH+C+W+   IG+ NY+ F  F     +LL   ++
Sbjct: 131 CSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQFTGYFSSLLLIMWV 190

Query: 192 RLTS-IQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGY 229
            +   I+ ++Q  +    P+     LT  F    A+FG+
Sbjct: 191 SICVFIRNITQHHHNHNSPLNANVFLTLAF----AIFGW 225

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C  +K  R+ H S    C+   DH C W+   IG+ NY++F  F++    L  + F+
Sbjct: 127 CSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVFV 186

Query: 192 RLTS 195
            + +
Sbjct: 187 PICA 190

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C  +K  R+ H      C+  +DH+C+W+   IG+ NY+ F  FL+  +      F+
Sbjct: 122 CSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHALIIFV 181

Query: 192 RLTSIQ 197
            + S+Q
Sbjct: 182 SVVSLQ 187

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%)

Query: 130 TICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYS 189
           T C  C  +K  R+ H      C+   DH+C W+   IG GNY  F  FL+    LL   
Sbjct: 124 TWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYMDCLLLIM 183

Query: 190 FLRLT 194
           ++ ++
Sbjct: 184 WISMS 188

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL-LSNVTLLSY 188
           C  C  +K +RS H     +CIL  DH+C W+   I + NY+ F  ++   N+ LL Y
Sbjct: 118 CTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYVGWFNLLLLWY 175

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 5/99 (5%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C  +K  R+ H S    C+   DH+C+WV   IG+ NY+ F  F+    +LL   +L
Sbjct: 137 CSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVTYFSSLLLLMWL 196

Query: 192 RLTS-IQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGY 229
            +   I+ ++Q       P+ V  ILT    + +A+FG+
Sbjct: 197 SICVYIRDITQRHRGHNPPLNVNVILT----LALALFGW 231

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 49/112 (43%), Gaps = 6/112 (5%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL--LSNVTLLSYS 189
           C  C  +K  R+ H S    C+   DH+C+W    IG+ NY+ F  F+   S + L+ ++
Sbjct: 132 CSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFVAYFSILLLIMWA 191

Query: 190 FLRLTSIQLM----SQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHD 237
            + + + ++     SQ   I    ML L      + +  +  G   F +  +
Sbjct: 192 SICVYTKEITQRHHSQGPRINVNVMLTLAFAILGWLLTTSTLGSAIFYMSQN 243

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C  +K  R  H      CI   DH+C W+   IG+ NY+ F  ++     LL++ +L
Sbjct: 117 CTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFYYNLLLAWIWL 176

Query: 192 RLTS 195
            +++
Sbjct: 177 SISA 180

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGF 178
           C  C  +K  R+ H +    C+   DH+C+W+   +G+ NY+ F  F
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 112 KSLADCRVPFDEII----FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCI 167
           + L   R+   E++    F     C   +K KP RSK        I+  DH C W+ N +
Sbjct: 430 QELEPVRIAIKELLRIGKFDTRHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDV 489

Query: 168 GKGNYKYFYGFLLSNVTLLSYSFL 191
           G  N+K F  FLLS V+ +S  F+
Sbjct: 490 GLLNHKQFIYFLLSLVSGVSCFFI 513

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGF 178
           C  C  +K +R+ H +    C+   DH+C+W+   +G+ NYK F  F
Sbjct: 128 CSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQF 174

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTL 185
           F   + C      KP RSK+ S+ N  +   DH+C W+ N +G  N+K F  F+ S  + 
Sbjct: 466 FDTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITSMESG 525

Query: 186 LSYSFLRL 193
           + ++FL L
Sbjct: 526 I-FTFLAL 532

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 50/118 (42%), Gaps = 7/118 (5%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191
           C  C  +K  R+ H      C+   DH C ++ + IGK NY+ F  + +     L+  + 
Sbjct: 127 CTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIWT 186

Query: 192 RLTSIQLMSQTENIK------TKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNE 243
            + +  + S T + +         ++ + ILT  F I V     TQ N +    T+ E
Sbjct: 187 SIVA-YIRSITRDYRGHGSHLNGNLIAILILTTLFWITVTSLLLTQLNCIVKNKTSIE 243

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           F     C      KP RSK+  + N  +   DH C W+ N +G  N+K F GF+L
Sbjct: 468 FDSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFIL 522

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTL 185
           F   + C      KP RSK+  + +  IL  DH+C W+ N +G  N+K F  F+L+ + L
Sbjct: 450 FDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILA-LEL 508

Query: 186 LSYSFLRL 193
             +SF+++
Sbjct: 509 GIFSFVKV 516

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 139 KPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYF-YGFLLSNVTLLSYSFL 191
           KP RS+  S+ N  +   DH+C WV N IG  N+K F    LL  + +L +++L
Sbjct: 471 KPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEILMLLFNYL 524

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 139 KPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLS 181
           KP RSK  +  N  +   DH+C WV N IG  N+K F  F++S
Sbjct: 470 KPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIIS 512

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL 179
           F     C      KP RSK  S+ N  +   DH+C W+ N +G  N+K F  F+
Sbjct: 466 FDTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 66/157 (42%), Gaps = 19/157 (12%)

Query: 139 KPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL-LSNVTLLSYSFLRLTSIQ 197
           KP RSK   +    +   DH+C WV N IG  N+K F  F+  S VT+ S+  +      
Sbjct: 475 KPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVTIWSFVIVCFEYFD 534

Query: 198 LMSQTENIKTKPM----LVLTILTGCFDIIVAVFGYTQ------------FNLVHDGMTT 241
            +   E+ K   M    +   +L   F +++ V+   Q            F ++  G+T 
Sbjct: 535 ELEVEEDAKCLLMGGGSVCKGVLKSRFTLLLMVWSMLQGVWVMFLICVQLFQMLR-GITN 593

Query: 242 NEQDKWFTVQEFMRDG-NLVRDKKGHYYFRILDESSS 277
           NE +K     E M    N + +     Y  +++ES S
Sbjct: 594 NEFNKLANAHESMVGSRNEIFNTTPEGYGEVVEESRS 630

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%)

Query: 139 KPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLS 181
           KP RS++  + N  +   DH+C WV N +G  N+K F  F+LS
Sbjct: 471 KPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILS 513

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL 179
           F     C      KP RS+  S+ N  +   DH+C W+ N +G  N+K F  F+
Sbjct: 465 FDTKNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTL 185
           F     C    + KP R K  S  ++ +L  DH+C WV N +G  N+K F  +++S V L
Sbjct: 454 FDTKNFCIETWQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMS-VGL 512

Query: 186 LSYSFLRLT 194
               F++L+
Sbjct: 513 GIVCFVKLS 521

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTL 185
           F     C +    KP RSK  +     +   DH C W+ N IG  N+K F  F+L   T 
Sbjct: 446 FDAKHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFILCLETC 505

Query: 186 LSYSFLRL 193
           + + FL+L
Sbjct: 506 I-FVFLKL 512

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 31/78 (39%)

Query: 103 CMTIEPDSTKSLADCRVPFDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIW 162
           C+ IE D        +   D   F     C      KP RS   ++    +   DH C W
Sbjct: 428 CVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPW 487

Query: 163 VNNCIGKGNYKYFYGFLL 180
           + N IG  N+K F  F+L
Sbjct: 488 IYNDIGLKNHKNFMWFIL 505

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 71/176 (40%), Gaps = 24/176 (13%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYK-YFYGFLLSNVT 184
           F+  T C      KP R     +  + +   DH+C W+ N +G  N+K Y +  +L    
Sbjct: 399 FNCHTFCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILLETF 458

Query: 185 LLSYSFLRLTSIQLMSQT---------------ENIKTKPM-LVLTILTGCFDIIVAVFG 228
           L+++  L      LM +T               +N+K   + LV TI    F   V    
Sbjct: 459 LMTFGVLNWRYFGLMEKTAECFLFNRTIICHGYKNLKVVFLFLVWTIFQAIF---VGNLL 515

Query: 229 YTQFNLVHDGMTTNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEE 284
             Q   +  G+TT E      ++EF+R+ +L   K  + YF + + +  D     +
Sbjct: 516 MLQLRKIAYGITTFEL---VFLKEFVRNRSL-ETKICNDYFDVREAAKCDESASAD 567

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 7/58 (12%)

Query: 139 KPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLS---YSFLRL 193
           KP RSK   + N  +   DH+C W+ N +G  N+K F  F    +TL+    ++FL L
Sbjct: 479 KPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFF----ITLMESGIFTFLAL 532

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGF-LLSNVT 184
           F     C      KP RS++  + +  +   DH C W+ N IG  N+K F  F +L  + 
Sbjct: 473 FDTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVIG 532

Query: 185 LLSYSFLRL 193
           +  Y++L +
Sbjct: 533 IWEYTYLAM 541

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 140 PARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLT 194
           P RSK+ +  N  I   DH+C WV N IG  N+K F  F++  + +  + F+RL+
Sbjct: 464 PLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMF-LQIGVFIFVRLS 517

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLS 181
           C    + KP RSK+       +   +H+C WV N IG  N+K F  F  S
Sbjct: 431 CVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFS 480

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%)

Query: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLS 181
           C    + KP RSK        +   DH C WV N IG  N+K F  F L+
Sbjct: 445 CVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALT 494

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 139 KPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL 179
           KP RS+  S+    I   DH+C W+ N +G  N+K F  F+
Sbjct: 469 KPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFV 509

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLS 181
           F     C    + KP RSK+       +   DH+C W+ N +G  N+K F  F ++
Sbjct: 442 FDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVT 497

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 140 PARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGF 178
           P R+K+    +  IL  DH+C W+ N IG  N+K F  F
Sbjct: 456 PLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 140 PARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180
           P RSK+       I   DH C WV N IG  N+K FY F++
Sbjct: 476 PLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVV 516

>AGR346C Chr7 complement(1370857..1374033) [3177 bp, 1058 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL132W
           (KRE33)
          Length = 1058

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 154 LMVDHHCIWVNNCIGKGN---YKYFYGFLLSNVTLLSYSFLRLTSIQLM------SQTEN 204
           L  +H C+ +N   G+ +    ++   F    ++LLSY F + T++Q +      S+ EN
Sbjct: 765 LTGEHTCVMLNVLEGRESKWLVEFARDFHKRFMSLLSYDFSKFTAVQALNVFESASKAEN 824

Query: 205 IKTKPMLVLTILTGCFDIIVAVF 227
           + T+P  +  +     D++++ +
Sbjct: 825 LGTQPAAIQALTRETLDLMLSPY 847

>SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {ON}
           similar to uniprot|Q75BN0 Ashbya gossypii ACR241C
           ACR241Cp and weakly similar to YKR064W uniprot|P36023
           Saccharomyces cerevisiae YKR064W Hypothetical ORF
          Length = 875

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 1/46 (2%)

Query: 127 HPGTICQTCHKIKPARSKHCSICNKCILMVDHH-CIWVNNCIGKGN 171
            P  +C  C + K    K    C+ C+ + D   C ++N  +GKG 
Sbjct: 8   RPTVVCSNCKRRKSKCDKQKPACSNCVRLGDEATCTYLNEPVGKGT 53

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 126 FHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYK 173
           F     C    + K  RSK+       +   DH+C W+ N IG  N+K
Sbjct: 436 FDKENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHK 483

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.141    0.448 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,600,332
Number of extensions: 2336695
Number of successful extensions: 8600
Number of sequences better than 10.0: 134
Number of HSP's gapped: 8741
Number of HSP's successfully gapped: 154
Length of query: 555
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 440
Effective length of database: 40,294,809
Effective search space: 17729715960
Effective search space used: 17729715960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)