Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H15576g8.322ON28228214140.0
Kwal_56.239148.322ON2652595704e-72
TDEL0F044808.322ON2602595503e-69
Ecym_42538.322ON2582565401e-67
AGL194C8.322ON2562545356e-67
Kpol_1036.688.322ON2562525217e-65
TPHA0C008208.322ON2662595219e-65
YLR128W (DCN1)8.322ON2692564888e-60
KLLA0D16346g8.322ON3012534873e-59
KLTH0G12320g8.322ON2542444825e-59
CAGL0M04257g8.322ON2732654592e-55
KAFR0H022708.322ON2682614496e-54
NDAI0G025908.322ON2862864509e-54
TBLA0A039308.322ON2662634453e-53
KNAG0G024408.322ON2652614401e-52
ZYRO0F10362g8.322ON2512494355e-52
Skud_12.1978.322ON1791803531e-40
Suva_10.2218.322ON1781783461e-39
NCAS0C032708.322ON1841833434e-39
Smik_12.1918.322ON1251082087e-20
Ecym_46987.377ON39436950.002
YBL058W (SHP1)7.377ON42338830.063
ZYRO0B03014g7.377ON40138800.14
Smik_2.587.377ON42590790.16
Suva_2.597.377ON42842790.19
NCAS0H026405.543ON64868780.28
ABR211C7.377ON38940770.33
NDAI0C009805.543ON66260770.35
Skud_2.467.377ON42636770.36
Smik_10.2505.172ON34666731.0
NCAS0E026907.377ON39855721.3
KLTH0B05786g2.125ON167962721.7
TBLA0B061102.311ON108271712.1
CAGL0A01452g4.90ON81471702.3
Kpol_1030.377.377ON36336683.5
ZYRO0D12914g5.543ON60341683.9
TDEL0C017007.377ON39036684.4
TPHA0E009907.377ON36836674.6
CAGL0A04345g7.377ON39241675.6
NCAS0C041408.135ON545125676.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H15576g
         (282 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   549   0.0  
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   224   4e-72
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   216   3e-69
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   212   1e-67
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   210   6e-67
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   205   7e-65
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   205   9e-65
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   192   8e-60
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   192   3e-59
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   190   5e-59
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   181   2e-55
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   177   6e-54
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   177   9e-54
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   176   3e-53
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   174   1e-52
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   172   5e-52
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   140   1e-40
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   137   1e-39
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   136   4e-39
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...    85   7e-20
Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar...    41   0.002
YBL058W Chr2 (111437..112708) [1272 bp, 423 aa] {ON}  SHP1UBX (u...    37   0.063
ZYRO0B03014g Chr2 complement(244268..245473) [1206 bp, 401 aa] {...    35   0.14 
Smik_2.58 Chr2 (105336..106613) [1278 bp, 425 aa] {ON} YBL058W (...    35   0.16 
Suva_2.59 Chr2 (108746..110032) [1287 bp, 428 aa] {ON} YBL058W (...    35   0.19 
NCAS0H02640 Chr8 complement(521008..522954) [1947 bp, 648 aa] {O...    35   0.28 
ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON} S...    34   0.33 
NDAI0C00980 Chr3 (191931..193919) [1989 bp, 662 aa] {ON} Anc_5.5...    34   0.35 
Skud_2.46 Chr2 (95087..96367) [1281 bp, 426 aa] {ON} YBL058W (REAL)    34   0.36 
Smik_10.250 Chr10 complement(393667..394707) [1041 bp, 346 aa] {...    33   1.0  
NCAS0E02690 Chr5 (537047..538243) [1197 bp, 398 aa] {ON} Anc_7.3...    32   1.3  
KLTH0B05786g Chr2 (474183..479222) [5040 bp, 1679 aa] {ON} simil...    32   1.7  
TBLA0B06110 Chr2 (1442038..1445286) [3249 bp, 1082 aa] {ON} Anc_...    32   2.1  
CAGL0A01452g Chr1 (149750..152194) [2445 bp, 814 aa] {ON} simila...    32   2.3  
Kpol_1030.37 s1030 (81590..82681) [1092 bp, 363 aa] {ON} (81590....    31   3.5  
ZYRO0D12914g Chr4 complement(1089169..1090980) [1812 bp, 603 aa]...    31   3.9  
TDEL0C01700 Chr3 (297260..298432) [1173 bp, 390 aa] {ON} Anc_7.3...    31   4.4  
TPHA0E00990 Chr5 (202855..203961) [1107 bp, 368 aa] {ON} Anc_7.3...    30   4.6  
CAGL0A04345g Chr1 complement(429936..431114) [1179 bp, 392 aa] {...    30   5.6  
NCAS0C04140 Chr3 complement(848632..850269) [1638 bp, 545 aa] {O...    30   6.1  

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/282 (94%), Positives = 267/282 (94%)

Query: 1   MVCQRIWLLDTTAELSYTNNLSMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALN 60
           MVCQRIWLLDTTAELSYTNNLSMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALN
Sbjct: 1   MVCQRIWLLDTTAELSYTNNLSMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALN 60

Query: 61  EYYDKKQGGFVNKKPVKYSHELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICL 120
           EYYDKKQGGFVNKKPVKYSHELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICL
Sbjct: 61  EYYDKKQGGFVNKKPVKYSHELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICL 120

Query: 121 AELLKCEKIDKDITEQQFLSSWTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYD 180
           AELLKCEKIDKDITEQQFLSSWTEHGCKNMIHMK               YFSHIYNYTYD
Sbjct: 121 AELLKCEKIDKDITEQQFLSSWTEHGCKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYD 180

Query: 181 LIVEESERHLNIDTAAEYWELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTM 240
           LIVEESERHLNIDTAAEYWELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTM
Sbjct: 181 LIVEESERHLNIDTAAEYWELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTM 240

Query: 241 FLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYMDEALGIL 282
           FLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYMDEALGIL
Sbjct: 241 FLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYMDEALGIL 282

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  224 bits (570), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 112/259 (43%), Positives = 161/259 (62%), Gaps = 7/259 (2%)

Query: 20  NLSMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFV-NKKPVKY 78
            L M Q    + EF++LT C+K  A ++LS N+WAL YALN+YYD   GGF  + +P  Y
Sbjct: 5   QLFMLQRDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRP--Y 62

Query: 79  SHELVETFDKY-ADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQ 137
           S EL++ F KY ++ K  IT+  L ++IEDLG  LED  T+CLAEL++C  + +DI+   
Sbjct: 63  SPELLKVFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDT 122

Query: 138 FLSSWTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAE 197
           F+ SW +  C+N   MK               YF  IYNYT+ L +E  ++ L ++T+  
Sbjct: 123 FIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIA 182

Query: 198 YWELFFHNSH-YAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIR 256
           YWEL F  +  YA+ +   RL++WI++ + +  +  V +D W MFLKF + FPD+E+L +
Sbjct: 183 YWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAK--VHRDVWKMFLKFAVAFPDNEALKK 240

Query: 257 GYDEMDAWPLVFDEYYEYM 275
           GY E DAWPLV DEYYEY+
Sbjct: 241 GYSEDDAWPLVIDEYYEYL 259

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  216 bits (550), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 159/259 (61%), Gaps = 5/259 (1%)

Query: 23  MAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKK--PVKYSH 80
           M Q  + ++EF+SLT C   TA  +L RN W L YALN+YYD+  GGF+ +   PV Y  
Sbjct: 1   MPQKDDLVSEFVSLTQCESKTAKDFLRRNQWKLEYALNDYYDQMPGGFIEEPHTPVTYPE 60

Query: 81  ELVETFDKYA-DSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFL 139
           EL+  +DKY  + +  I ++ +++ IEDL Y LEDL TICLA+LL C ++   I++ QFL
Sbjct: 61  ELLALYDKYVLEDQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQFL 120

Query: 140 SSWTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYW 199
            +W   GC  +  M+               Y + IYNYT+DL +++++R L+ DTAAEYW
Sbjct: 121 HNWYMQGCSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRDLDTDTAAEYW 180

Query: 200 ELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYD 259
            LFF     AV ++ + L +W+ F   +  ++ VT+DTW M L+F  +FP   ++   Y+
Sbjct: 181 RLFFQPGT-AVHVNPALLNSWLAFLDSEQ-KTVVTRDTWKMLLEFFKQFPSLSAVKTSYN 238

Query: 260 EMDAWPLVFDEYYEYMDEA 278
           E DAWP + DEYYEY++++
Sbjct: 239 EADAWPYIIDEYYEYLEDS 257

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  212 bits (540), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 154/256 (60%), Gaps = 2/256 (0%)

Query: 22  SMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHE 81
           S A+ ++ I +FMS+T+  + TA K+L+ N W+L YAL++ Y  +   ++N +   Y  E
Sbjct: 3   SNARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLY-TRGTSYLNTERT-YDAE 60

Query: 82  LVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSS 141
           L  TF  YA     +  + L+KY+ DLGY LED  TICLA+LLK E +  DI E+QFLS+
Sbjct: 61  LYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLST 120

Query: 142 WTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYWEL 201
           W + GC N+  M                YF  IY+YT+ + V+   R L+IDTA  YW L
Sbjct: 121 WADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTL 180

Query: 202 FFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEM 261
            F +  +A  I  +RL++W  F  +++  + VT+DTW M  KF +KFPDD++L+  Y EM
Sbjct: 181 LFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM 240

Query: 262 DAWPLVFDEYYEYMDE 277
            AWPL+ DEYY ++ E
Sbjct: 241 GAWPLIMDEYYGWIKE 256

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  210 bits (535), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 160/254 (62%), Gaps = 6/254 (2%)

Query: 22  SMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHE 81
           S A+ +E I EF+++T+ T   A  YL RN W+L +AL+++Y +  GG    +  +YS E
Sbjct: 3   SNARQRELIREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQSGGG---GRAEQYSAE 59

Query: 82  LVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSS 141
           LV TF++YA +   +  E L++Y+ DLG+ LED+AT+CLA LLK E++  DI+  QFLS+
Sbjct: 60  LVATFERYA-AGGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLST 118

Query: 142 WTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYWEL 201
           W   GC ++  M+               YF  +Y YT+ L ++   R L+++TA  YW L
Sbjct: 119 WHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSL 178

Query: 202 FFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEM 261
           FF +  YAVT+   RL++W EF   ++G  +V++DTW MF +F  +FPDD  L+  Y+E+
Sbjct: 179 FFLDHTYAVTVPAPRLRSWFEFL--RAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNEL 236

Query: 262 DAWPLVFDEYYEYM 275
            +WPLV DEYYE++
Sbjct: 237 ASWPLVIDEYYEWV 250

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  205 bits (521), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 159/252 (63%), Gaps = 4/252 (1%)

Query: 32  EFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGF-VNKKPVKYSHELVETFDKYA 90
           EF+ LTNC K  ATKYL RN+W L+YALNEYYDK+ G F V ++ ++Y  EL++ F KY+
Sbjct: 7   EFIGLTNCDKKVATKYLKRNNWNLNYALNEYYDKEVGSFLVEEEVIEYPEELIQIFKKYS 66

Query: 91  -DSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHGCKN 149
            D+   I  +  ++ I DL Y LED+ TICLAEL+ C+ +   IT+ QFLS+W E GC  
Sbjct: 67  NDNGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLSTWYEQGCSQ 126

Query: 150 MIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFHNSHYA 209
           + HMK               Y++HIY Y++DLI + +E+ +  D A EYW+LFF +S   
Sbjct: 127 LKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRDSNEKCIEKDMAIEYWKLFF-SSKCP 185

Query: 210 VTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFD 269
           +TI++ +L +WIEF       S +T+D W   L++  K+P  E L + Y+E+D WP + D
Sbjct: 186 ITINELQLNSWIEFINVNEIES-ITRDVWERLLEYFKKYPTLEILSKNYNELDPWPYIMD 244

Query: 270 EYYEYMDEALGI 281
           EYYE++++   I
Sbjct: 245 EYYEFLEDTKRI 256

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  205 bits (521), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 150/259 (57%), Gaps = 13/259 (5%)

Query: 30  INEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHELVETFDKY 89
           + EF  LT+ +   A KYLS N W L+YALNE+YD++ GGFV+  P +Y  EL+E F++Y
Sbjct: 5   VREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELFERY 64

Query: 90  ADSKRC-----------ITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQF 138
            + K             I  + L+++IEDLGY LEDL T+CLA ++ C  +   IT  QF
Sbjct: 65  NNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQF 124

Query: 139 LSSWTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEY 198
           L +W    C N+  +K               YF++IYNY++ LI EE+ + + IDTA EY
Sbjct: 125 LEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEY 184

Query: 199 WELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGY 258
           W+LFF +    + I   +L  W +F T  SG+ T+TKD W M L+F  KFP        Y
Sbjct: 185 WKLFFGDGT-PLHIEKEQLDNWNKFLT-ISGKKTITKDEWKMILEFFKKFPTVTEFKDEY 242

Query: 259 DEMDAWPLVFDEYYEYMDE 277
           D MD WP + DEY+EY++E
Sbjct: 243 DPMDPWPYIMDEYHEYLEE 261

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  192 bits (488), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 149/256 (58%), Gaps = 9/256 (3%)

Query: 24  AQP-KETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNK-----KPVK 77
           A P +E I  F SLT C    + KYL RN W ++YALN+YYDK+ G F ++      P  
Sbjct: 11  ASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPV 70

Query: 78  YSHELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQ 137
           Y  EL + F+ Y ++     +++L+K+IE+LGY LEDLAT+CLA LL  +K+++ +  + 
Sbjct: 71  YPKELTQVFEHYINNN-LFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKRED 129

Query: 138 FLSSWTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAE 197
           FLS+W   GC  +  M+               YF+ IYNY ++LI++ + + ++ D   +
Sbjct: 130 FLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQ 189

Query: 198 YWELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRG 257
           YW+LFF    Y V +    L+ W  F  +  G++T++KDTW M L F  ++P  + +I  
Sbjct: 190 YWKLFFQ-PEYPVRMEPDLLEAWFRF-LRDEGKTTISKDTWRMLLLFFKRYPTIQKIISD 247

Query: 258 YDEMDAWPLVFDEYYE 273
           YDE  AWP + DE+YE
Sbjct: 248 YDETAAWPFIIDEFYE 263

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  192 bits (487), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 146/253 (57%), Gaps = 11/253 (4%)

Query: 32  EFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQ--GGFVNKKPVKYSHELVETFDKY 89
           EFM+LT CT   A +YL +N   + YALN+YYD     GG        Y+  LV  F+KY
Sbjct: 49  EFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQS----YNPSLVAIFEKY 104

Query: 90  ADSKRCIT--VENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHGC 147
           ++           L+++IEDLG  +ED  T+CL+++L  + + K ++ +QFL++W++  C
Sbjct: 105 SNGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCC 164

Query: 148 KNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFHNSH 207
             +  MK               YF  IY+YT+ L  +E  RHL  D A EYW +FF ++ 
Sbjct: 165 DTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNK 224

Query: 208 YAVTISDSRLKTWIEFYTKKSG---RSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAW 264
           YA+ IS  RL +W+EF         +  ++ D W MF KFI ++P+DESL + YDEM AW
Sbjct: 225 YALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAW 284

Query: 265 PLVFDEYYEYMDE 277
           PL+ DEYYE+++E
Sbjct: 285 PLLIDEYYEFLEE 297

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  190 bits (482), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 147/244 (60%), Gaps = 7/244 (2%)

Query: 28  ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHELVETFD 87
           + I EF++LT  ++ TA  YLS N+WAL YALN++YD  QGGF ++ P     +L+  F+
Sbjct: 4   QDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPP---PPQLLTLFN 60

Query: 88  KYADSKR-CITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHG 146
           +Y   +   I+ + L+++I DLG  LED  T+C+A+ + C  + + ++++ F+  W ++ 
Sbjct: 61  EYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL 120

Query: 147 CKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFH-N 205
           C+N+  +K               YF HIY++TY L +E +E+ L+++TA  YW L F  +
Sbjct: 121 CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTD 180

Query: 206 SHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWP 265
             YA+ I   RL +W  F T+   R  +  D W MFLKF   FPD+++L +GY+E DAWP
Sbjct: 181 GAYAIQIPQKRLCSWTAFLTRNVSR--IHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWP 238

Query: 266 LVFD 269
           ++ D
Sbjct: 239 VLID 242

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  181 bits (459), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 148/265 (55%), Gaps = 16/265 (6%)

Query: 27  KETINEFMSLTNCTKDT-ATKYLSRNSWALSYALNEYYDKKQGGFVN----KKPVKYSHE 81
           KE +  F SLT+CT +  A +YLS N+W ++YALNEYYDK+ GGF      +   KY  E
Sbjct: 7   KELMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYDKEVGGFTEDHMIRHQFKYPDE 66

Query: 82  LVETFDKYA-----DSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQ 136
           LV  F  YA     D  + IT + L+ YI+DLGY LEDL TI LA  L+C+ ++  ITE+
Sbjct: 67  LVSLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPITEK 126

Query: 137 QFLSSWTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAA 196
           QFL  W   GC  +  M+               YF+ IYNY++DL   + +  +  D A 
Sbjct: 127 QFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDLNASK-QGVVETDIAI 185

Query: 197 EYWELFFHNSHYAVT----ISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDE 252
           EYW+LFF  +   ++    +  + L  W +F  +   +  + KDTW M L F  KFP  +
Sbjct: 186 EYWKLFFEENRTKLSGIIKVDQAHLDLWCKF-LQDEHKKLIHKDTWQMLLLFFKKFPSLD 244

Query: 253 SLIRGYDEMDAWPLVFDEYYEYMDE 277
           ++   Y+E DAWP   DE+YEY++E
Sbjct: 245 AIKTEYNEADAWPYTIDEFYEYLEE 269

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  177 bits (449), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 143/261 (54%), Gaps = 11/261 (4%)

Query: 27  KETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFV------NKKPVKYSH 80
           +E I  F+  T C    A KYLS+N W ++YALN++YD + GGF       N++ V Y  
Sbjct: 7   EEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAV-YPK 65

Query: 81  ELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLS 140
           ELV+ F  Y      I  + ++K I+D G  +EDLATICLA +L  E +   I    FL 
Sbjct: 66  ELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQ 125

Query: 141 SWTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERH--LNIDTAAEY 198
              E GC  +  +K               YF+ IYN+++ LI+++  R+  +++D A EY
Sbjct: 126 YLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEY 185

Query: 199 WELFFHN-SHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRG 257
           W+LFF N S  +V IS+  L  W +F   +  +  V+KD W M L+F  KF D ESL   
Sbjct: 186 WKLFFLNESIQSVEISNELLSLWFQFLADER-KKQVSKDIWQMILEFFRKFKDLESLKES 244

Query: 258 YDEMDAWPLVFDEYYEYMDEA 278
           YDE D WP V DE+YEY+ + 
Sbjct: 245 YDENDPWPFVIDEFYEYLQDT 265

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  177 bits (450), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 105/286 (36%), Positives = 146/286 (51%), Gaps = 49/286 (17%)

Query: 44  ATKYLSRNSWALSYALNEYYDKKQGGFVNKKPV------------KYSHELVETFDKYAD 91
           A KYLSRN+W L+YALNEYYDK+ G F+                 KY  EL+  F KY+ 
Sbjct: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKKYSS 61

Query: 92  SKR-----CITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHG 146
                    I V+ L+ YI DL Y LEDL TICLA+LL CE +   I +QQFLS+W   G
Sbjct: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121

Query: 147 CKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVE----ESER-------------- 188
           C  +  M+               YF+ IYNYT+DLI++    +S R              
Sbjct: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181

Query: 189 ------------HLNIDTAAEYWELFFH-NSHYAVTISDSRLKTWIEFYTKKSGRSTVTK 235
                       +L+++TA  YW++FF+ N  Y V ++   L  W +F  ++  +  +TK
Sbjct: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEER-KKEITK 240

Query: 236 DTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYMDEALGI 281
           D W M L+F  KF + E + + YDE  AWP + DE+YEY+ +   I
Sbjct: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  176 bits (445), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 142/263 (53%), Gaps = 9/263 (3%)

Query: 23  MAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKK-------- 74
           M    +T+ EFMSL N    TA KYL RN W L YALN++YD + G F+ +         
Sbjct: 1   MMASDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKIL 60

Query: 75  PVKYSHELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDIT 134
            ++Y   L E ++ YA     +  E L+K ++DLGY ++ L T+CLA+L+ C      I 
Sbjct: 61  GIEYVRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPIL 120

Query: 135 EQQFLSSWTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDT 194
              F+ S   + C+++  +K               Y++ IY+  ++L++EE ++ ++ +T
Sbjct: 121 LSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSET 180

Query: 195 AAEYWELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESL 254
           A EYW+LFF   +Y + +   + + W + Y   +    +TKD W M L+F  KFP    L
Sbjct: 181 AQEYWDLFFACQNYPIKVQSDQYQQWFK-YLSNANIKEITKDQWAMLLRFFKKFPSLSEL 239

Query: 255 IRGYDEMDAWPLVFDEYYEYMDE 277
            R Y E  AWP +FDEYYEY+++
Sbjct: 240 QRKYSEDSAWPYIFDEYYEYLED 262

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  174 bits (440), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 143/261 (54%), Gaps = 9/261 (3%)

Query: 27  KETINEFMSLTNCT-KDTATKYLSRNSWALSYALNEYYDKKQGGF------VNKKPVKYS 79
           ++ I++F+ LT C  +  A +YL  + W ++YALN++YDK+ G F      V +  V Y 
Sbjct: 3   EDAIHDFIELTQCRDRKKAERYLRESHWNVNYALNDFYDKEVGNFFSTYKDVPQDNVVYP 62

Query: 80  HELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFL 139
            EL+  FD+Y+++   IT E ++ YI DL   ++DL TICLA+LL  E +   IT +QFL
Sbjct: 63  PELIHVFDQYSEAG-VITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQFL 121

Query: 140 SSWTEHGCKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYW 199
           + W   GC  +  MK               YF  IY YT+ L+VE  +  L+  +  EYW
Sbjct: 122 AQWFLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVEPDQNKLDAASTIEYW 181

Query: 200 ELFF-HNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGY 258
           +LFF     Y + I    L  W  +  ++S   +VT+D W M  +F  +F     + +GY
Sbjct: 182 KLFFDQEKKYPMIIDQELLDPWFVYLGEQSENMSVTEDIWKMVYQFFNRFRSLGDVKQGY 241

Query: 259 DEMDAWPLVFDEYYEYMDEAL 279
           DEM AWP++ DE+ EY+ + +
Sbjct: 242 DEMAAWPILIDEFIEYLQDTV 262

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  172 bits (435), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 138/249 (55%), Gaps = 11/249 (4%)

Query: 30  INEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHELVETFDKY 89
           +  F SL  C+  TA  YL+ ++W ++ ALN+YYD +     + +   YS EL + F KY
Sbjct: 5   VATFKSLAQCSDRTARDYLNTHNWDVNQALNDYYDSE-----HDQDQSYSPELPQLFRKY 59

Query: 90  A---DSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHG 146
           A        +  + L++YI DLGY +++LATICLA+LL C+++   ITE QF  +W ++G
Sbjct: 60  AVVTPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQFSYNWQQNG 119

Query: 147 CKNMIHMKXXXXXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFHNS 206
           C ++  M                Y + IYNYT++L ++   + L   TA +YW LFF   
Sbjct: 120 CTSLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALDPGAKTLETHTAVQYWTLFFATG 179

Query: 207 HYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWPL 266
            Y V +     + WI F  ++    ++++DTW M   F  +F + +S+   Y+E DAWP 
Sbjct: 180 QYPVIVEQQFFQLWISFVQQE---QSISRDTWRMLFPFFNRFSNLQSVRDNYNEADAWPY 236

Query: 267 VFDEYYEYM 275
           + DE+YEY+
Sbjct: 237 IIDEFYEYL 245

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  140 bits (353), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 111/180 (61%), Gaps = 2/180 (1%)

Query: 98  VENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHGCKNMIHMKXXX 157
           +++L+K+IEDLGY LEDLAT+CL +LL  + +++ +  + FLS+W   GC  +  M+   
Sbjct: 1   MDSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCI 60

Query: 158 XXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFHNSHYAVTISDSRL 217
                       Y++ +Y+Y + LI++ + ++++ID A +YW LFF    Y V I  + L
Sbjct: 61  KRLDVKLHEDLQYYTQVYDYAFRLILDSNRKNIDIDDAIQYWTLFFQPV-YPVHIESNLL 119

Query: 218 KTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYMDE 277
           ++W  F  +  G++ ++KDTW M L F  ++   +S+I GYDE  AWP + DE+YEY+ +
Sbjct: 120 ESWFHF-LRDEGKTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQD 178

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  137 bits (346), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 105/178 (58%), Gaps = 2/178 (1%)

Query: 98  VENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHGCKNMIHMKXXX 157
           +++L+K+IEDLGY LEDLAT+CL  LL  +K+++ +  + FLS+W   GC  + +MK   
Sbjct: 1   MDSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCV 60

Query: 158 XXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFHNSHYAVTISDSRL 217
                       YF+ IY+YT+ LI++ + + ++ + A +YW L F    Y + +    L
Sbjct: 61  KGLDAKLHEDLQYFTEIYDYTFHLILDTNRKDIDTEEAIQYWTLLF-QPEYPIHMEPGLL 119

Query: 218 KTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYM 275
           + W  F     G+ T+TKD W M L+F  ++P   S+I  YDE  AWP + DE+YE++
Sbjct: 120 EAWFRF-LHDEGKRTITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFL 176

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  136 bits (343), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 100/183 (54%), Gaps = 4/183 (2%)

Query: 98  VENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHGCKNMIHMKXXX 157
           ++ LM Y+ DLG  LEDL TICL  LL C+ I  DIT  QFL +W   GC ++  MK   
Sbjct: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60

Query: 158 XXXXXXXXXXXXYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFH--NSHYAVTISDS 215
                       YF  IYNYT+ LI  + ++ L ++TA  YW+LF       + V +  +
Sbjct: 61  VDLNDKLHSDKQYFIDIYNYTFGLIT-DPDKDLEVETAVAYWKLFLQPKEGEFPVRVDPT 119

Query: 216 RLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYM 275
            L  W +F  +++ +  +T+D W M + F  KFP+   +  GYDE  AWP + DEYYEY+
Sbjct: 120 LLNLWFQFLDEEN-KKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYL 178

Query: 276 DEA 278
            + 
Sbjct: 179 QDT 181

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score = 84.7 bits (208), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 170 YFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFHNSHYAVTISDSRLKTWIEFYTKKSG 229
           YF+ IYNYT+ L+++   + ++I+   +YW+LFF    Y V+I  + L+ W  F     G
Sbjct: 18  YFTLIYNYTFHLLLDSYRKDIDINECIQYWKLFFR-PEYPVSIEQNLLEAWFRF-LHDEG 75

Query: 230 RSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYMDE 277
           +  + KDTW M L F  K+     ++  YDE  AWP + DE+YEY+ +
Sbjct: 76  KMMINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEFYEYLQD 123

>Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar
          to Ashbya gossypii ABR211C
          Length = 394

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 28/36 (77%)

Query: 28 ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY 63
          + I +FM+LTNC+ D AT+++++++  L  A+N+YY
Sbjct: 4  QQIQQFMTLTNCSADVATQFINKSNGDLEDAINKYY 39

>YBL058W Chr2 (111437..112708) [1272 bp, 423 aa] {ON}  SHP1UBX
          (ubiquitin regulatory X) domain-containing protein that
          regulates Glc7p phosphatase activity and interacts with
          Cdc48p; interacts with ubiquitylated proteins in vivo
          and is required for degradation of a ubiquitylated
          model substrate
          Length = 423

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 26 PKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY 63
          P ETI +FM+LTN + + A +YLS     L+ ALN YY
Sbjct: 5  PDETIQQFMALTNVSHNIAVQYLSE-FGDLNEALNSYY 41

>ZYRO0B03014g Chr2 complement(244268..245473) [1206 bp, 401 aa]
          {ON} similar to uniprot|P34223 Saccharomyces cerevisiae
          YBL058W SHP1 UBX (ubiquitin regulatory X) domain-
          containing protein that regulates Glc7p phosphatase
          activity and interacts with Cdc48p interacts with
          ubiquitylated proteins in vivo and is required for
          degradation of a ubiquitylated model substrate
          Length = 401

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 26 PKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY 63
          P E I +FM+L NC  +TA +YL +    L  ALN YY
Sbjct: 5  PDENIQQFMALANCPFNTAQEYL-QEFGDLGEALNAYY 41

>Smik_2.58 Chr2 (105336..106613) [1278 bp, 425 aa] {ON} YBL058W
           (REAL)
          Length = 425

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 28  ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY--------DKKQGGFVNKKPVKYS 79
           E+I +FM+LTN + + A +YLS     L+ ALN YY        D+++G   N++  K S
Sbjct: 7   ESIQQFMALTNVSHNIAVQYLSE-FGNLNEALNSYYATQADDKKDRREGAHWNRQQEKES 65

Query: 80  HELVETFDKYADSKRCITVENLMKYIEDLG 109
            +  E        K+ +  EN+      LG
Sbjct: 66  KQ--EALSSTNCIKKAMDTENIGGSGHKLG 93

>Suva_2.59 Chr2 (108746..110032) [1287 bp, 428 aa] {ON} YBL058W
          (REAL)
          Length = 428

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 28/42 (66%), Gaps = 2/42 (4%)

Query: 23 MAQ-PKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY 63
          MA+ P ETI +FM+LTN + + A +YLS     L+ A+N YY
Sbjct: 1  MAEVPDETIQQFMALTNVSHNIAVQYLSE-FEDLNEAINSYY 41

>NCAS0H02640 Chr8 complement(521008..522954) [1947 bp, 648 aa] {ON}
           Anc_5.543 YML013W
          Length = 648

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 3/68 (4%)

Query: 27  KETINEFMSLTNCTKDTAT---KYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHELV 83
           +E +NEF S++   +D      ++L  NSW L  AL  Y+D      +N   V     +V
Sbjct: 42  EEKLNEFQSISGFPEDDLADIIRHLQSNSWNLELALGSYFDGNWKEQLNALQVPEPEPVV 101

Query: 84  ETFDKYAD 91
           ET     +
Sbjct: 102 ETLPPVPE 109

>ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YBL058W
          (SHP1)
          Length = 389

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%)

Query: 28 ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQ 67
          E I +FM LTN + + A KYL  +   L  ALN +Y  +Q
Sbjct: 4  EQIQQFMMLTNSSAEVARKYLGEHEDDLEDALNGFYANQQ 43

>NDAI0C00980 Chr3 (191931..193919) [1989 bp, 662 aa] {ON}
          Anc_5.543 YML013W
          Length = 662

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 27 KETINEFMSLTNCTKD---TATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHELV 83
          ++ +NEF ++TN  +D      K L  N W L  +L+ Y+D      +N  PV  SH L 
Sbjct: 40 EDKLNEFQTITNFPEDEIPNIIKLLQNNGWNLEISLSRYFDNDWKESLNAPPVP-SHPLA 98

>Skud_2.46 Chr2 (95087..96367) [1281 bp, 426 aa] {ON} YBL058W
          (REAL)
          Length = 426

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 28 ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY 63
          ETI +FM+LTN + + A +YLS     L+ ALN YY
Sbjct: 7  ETIQQFMALTNVSHNIAVQYLSE-FGDLNEALNSYY 41

>Smik_10.250 Chr10 complement(393667..394707) [1041 bp, 346 aa] {ON}
           YJL023C (REAL)
          Length = 346

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 189 HLNIDTAAEYWELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKF 248
            LN D A      F  NSH +  I D   K  I+ +    GRSTV       +L  +  F
Sbjct: 218 RLNGDKATREHSHFEKNSHNSTIIEDKSKKRLIDNF----GRSTVGTAKDGYYLYIVKIF 273

Query: 249 PDDESL 254
           PD+E+L
Sbjct: 274 PDEETL 279

>NCAS0E02690 Chr5 (537047..538243) [1197 bp, 398 aa] {ON}
          Anc_7.377 YBL058W
          Length = 398

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 28 ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHEL 82
          E I +FM+LTN + + A++YL +    L+ A+N ++        +  P   ++EL
Sbjct: 7  EAIQQFMALTNGSHEQASQYLEQYDGDLNEAVNAFF------MASSNPTPPANEL 55

>KLTH0B05786g Chr2 (474183..479222) [5040 bp, 1679 aa] {ON} similar to
            uniprot|P53552 Saccharomyces cerevisiae YNL139C RLR1
            Required for LacZ RNA expression from certain plasmids
            suppressor of the Transcriptional (T) defect of Hpr1 (H)
            by Overexpression (O) plays a role in transcription
            elongation by RNA polymerase II Involved in transcription
          Length = 1679

 Score = 32.3 bits (72), Expect = 1.7,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 28   ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHELVETFD 87
            E +NE   +  C + T T YL+R+    S  L E    +QG    ++P +Y   L E F+
Sbjct: 1277 EVLNEMTDVLKCLETTGTSYLNRHIRNRS-VLTELRQIEQG--TARRPREYKARLAELFE 1333

Query: 88   KY 89
             Y
Sbjct: 1334 AY 1335

>TBLA0B06110 Chr2 (1442038..1445286) [3249 bp, 1082 aa] {ON}
           Anc_2.311 YGL156W
          Length = 1082

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 179 YDLIVEESERHLNIDTAAEYWELFFHNSHYAVTI--------SDSRLKTWIEFYTKKSGR 230
           +DLIV  +E+  N+       E+  +NS   V I        S + +KT +E+   K+GR
Sbjct: 684 HDLIVLPNEQKTNLSIKDRNDEIIMNNSKLNVIIDKKTGVITSITDVKTGVEYLDLKNGR 743

Query: 231 STVTKDTWTMF 241
           +T+  + + MF
Sbjct: 744 NTLGANQFVMF 754

>CAGL0A01452g Chr1 (149750..152194) [2445 bp, 814 aa] {ON} similar
           to uniprot|P53008 Saccharomyces cerevisiae YGL027c CWH41
          Length = 814

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 5/71 (7%)

Query: 79  SHELVETFDKYADSKRCITVE---NLMKYIEDLGYCLEDLATICL--AELLKCEKIDKDI 133
           SH L    D Y  SK C   E   + + ++  +   L+ +ATI    A++LK E+++ ++
Sbjct: 570 SHCLPSGLDDYPRSKPCDVTELHVDALSWVGVMARSLKQIATILDEDADILKYEEVENNV 629

Query: 134 TEQQFLSSWTE 144
            E   L  W+E
Sbjct: 630 IENLELLHWSE 640

>Kpol_1030.37 s1030 (81590..82681) [1092 bp, 363 aa] {ON}
          (81590..82681) [1092 nt, 364 aa]
          Length = 363

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 28 ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY 63
          E + +FM++ N +   A KYL+  +  L  A+N YY
Sbjct: 4  ENVQQFMAMANVSATVAEKYLNEYNGDLGDAINAYY 39

>ZYRO0D12914g Chr4 complement(1089169..1090980) [1812 bp, 603 aa]
          {ON} similar to uniprot|Q04228 YML013W Saccharomyces
          cerevisiae SEL1 UBX (ubiquitin regulatory X) domain-
          containing protein that interacts with Cdc48p
          Length = 603

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 27 KETINEFMSLTNCTKD---TATKYLSRNSWALSYALNEYYD 64
          +E +N F ++T    D   +  K L R+ W L  AL+ Y+D
Sbjct: 18 EEKLNHFQAITTFPDDDLPSVIKLLERDGWGLELALSHYFD 58

>TDEL0C01700 Chr3 (297260..298432) [1173 bp, 390 aa] {ON}
          Anc_7.377 YBL058W
          Length = 390

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 28 ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY 63
          ++I +FM+L NC+   A KYL      L+ ALN YY
Sbjct: 7  DSIQQFMALANCSLAVAQKYLEE-FGDLTEALNAYY 41

>TPHA0E00990 Chr5 (202855..203961) [1107 bp, 368 aa] {ON}
          Anc_7.377 YBL058W
          Length = 368

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 28 ETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY 63
          E +N+F++LT+ ++  A +YL   S  +  ALN YY
Sbjct: 4  ENVNQFIALTSASQPVAEQYLELYSDDIGDALNAYY 39

>CAGL0A04345g Chr1 complement(429936..431114) [1179 bp, 392 aa]
          {ON} similar to uniprot|P34223 Saccharomyces cerevisiae
          YBL058w SHP1
          Length = 392

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 23 MAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYY 63
          M+   + I +FM+LT+ + D A +YL +    L  ALN YY
Sbjct: 1  MSDSDKVIQQFMTLTDRSIDVAREYLEQYDNDLGGALNAYY 41

>NCAS0C04140 Chr3 complement(848632..850269) [1638 bp, 545 aa] {ON}
           Anc_8.135 YGL176C
          Length = 545

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 54/125 (43%), Gaps = 12/125 (9%)

Query: 3   CQRIWLLDTTA-ELSYTNNLSMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNE 61
            Q ++++D T  E+ Y       +P  TI +  S TN ++ T    LS +   L Y    
Sbjct: 373 TQLLFMMDPTVIEVEY------LRPPMTIFQ-TSFTNLSRKTEIFDLSPDGHFLCYGFAP 425

Query: 62  YYDKKQGGFVNKKPVKYSHELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLA 121
                Q G      + Y+  LV  FD   DSKR +T    ++ ++D  + LED  +I  A
Sbjct: 426 ESGGTQKGDFEVFSLNYNENLV--FD--IDSKRQLTTFYPIRKLQDYKHILEDSVSIVDA 481

Query: 122 ELLKC 126
              K 
Sbjct: 482 SFTKI 486

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,356,320
Number of extensions: 1330942
Number of successful extensions: 4043
Number of sequences better than 10.0: 55
Number of HSP's gapped: 4137
Number of HSP's successfully gapped: 56
Length of query: 282
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 174
Effective length of database: 41,097,471
Effective search space: 7150959954
Effective search space used: 7150959954
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)