Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H15554g8.323ON53653616790.0
Kwal_56.239168.323ON49947210921e-144
AGL195C8.323ON55447710521e-137
KLTH0G12298g8.323ON5001927082e-86
Ecym_42548.323ON5291916571e-78
TDEL0F044908.323ON5101966377e-76
ZYRO0F10384g8.323ON5581686224e-73
YDR145W (TAF12)8.323ON5391966162e-72
Smik_4.3898.323ON5251976152e-72
Skud_4.4048.323ON5351966153e-72
KAFR0B057208.323ON4841966095e-72
NCAS0B035708.323ON5191686064e-71
Suva_2.3068.323ON5411956051e-70
KLLA0D16368g8.323ON5111966021e-70
Kpol_543.638.323ON5851955974e-69
CAGL0E01397g8.323ON5751685712e-65
TPHA0A015608.323ON5401685431e-61
NDAI0J010208.323ON6381685435e-61
KNAG0I008908.323ON5081675233e-59
TBLA0A039408.323ON7521985346e-59
TBLA0H012808.323ON4051133008e-29
Kwal_33.145252.88ON30042760.82
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H15554g
         (536 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   651   0.0  
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   425   e-144
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   409   e-137
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   277   2e-86
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   257   1e-78
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   249   7e-76
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   244   4e-73
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   241   2e-72
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   241   2e-72
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   241   3e-72
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   239   5e-72
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   238   4e-71
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   237   1e-70
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   236   1e-70
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   234   4e-69
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   224   2e-65
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   213   1e-61
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   213   5e-61
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   206   3e-59
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   210   6e-59
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   120   8e-29
Kwal_33.14525 s33 complement(706024..706926) [903 bp, 300 aa] {O...    34   0.82 

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/536 (65%), Positives = 349/536 (65%)

Query: 1   MSAXXXXXXXXXXSQGNTPQPLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQ 60
           MSA          SQGNTPQPLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQ
Sbjct: 1   MSANNNNQPIPPNSQGNTPQPLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQ 60

Query: 61  AAKIKAIYDAYNXXXXXXXXXFGQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 120
           AAKIKAIYDAYN         FGQT                                  I
Sbjct: 61  AAKIKAIYDAYNKQKQQAAQAFGQTNNRPPAPAAGNPPQVAQNTQQRQNSNSANNPSSNI 120

Query: 121 RTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLEST 180
           RTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLEST
Sbjct: 121 RTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLEST 180

Query: 181 KAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQASTXXXXXXXXXXXX 240
           KAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST            
Sbjct: 181 KAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQASTQQQQQQQQQQQQ 240

Query: 241 XXXXKVNTNQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNSTST 300
               KVNTNQG                                           GNSTST
Sbjct: 241 QQQQKVNTNQGQISVSPVVQQTSSQPAAAASASMAATTPGASTPSQQQQKKPTQGNSTST 300

Query: 301 SRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTIT 360
           SRSPTQVTSV              RQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTIT
Sbjct: 301 SRSPTQVTSVNAAALLANNNTAAARQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTIT 360

Query: 361 GGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXX 420
           GGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSV                   
Sbjct: 361 GGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVGVDEGDGETTIDGDVEELL 420

Query: 421 XXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNS 480
                 FISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNS
Sbjct: 421 LDLADDFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNS 480

Query: 481 TTNYTQKLQGINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPVPSSND 536
           TTNYTQKLQGIN                                    QPVPSSND
Sbjct: 481 TTNYTQKLQGINAAKAVKTTSAAQTAAVAAAAAANNSAAPSSSSDNKAQPVPSSND 536

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  425 bits (1092), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 231/472 (48%), Positives = 274/472 (58%), Gaps = 23/472 (4%)

Query: 21  PLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNXXXXXXXX 80
           P Q+ T  S+QQ+A +FT  F EA RIG+ T +G+ELLKQA+ IKA+YDAY         
Sbjct: 21  PAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAY-RQRQQAAQ 79

Query: 81  XFGQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSEAYNKLTKTFG 140
            F Q                                   I+ LLTP+Q+EAY +L ++  
Sbjct: 80  GFDQNAPGASSAGSTSGSPATARAPNGTATNTISSN---IQNLLTPQQNEAYGRLIQSSN 136

Query: 141 DSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALPQ 200
           ++ + I+GE  YL++ IE+LD EIK RE +P  V++LE+ KAE++ KL+G  AS+ AL Q
Sbjct: 137 ENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVALNQ 196

Query: 201 KFHEAKKKFYIECAASNPNLKRFLQASTXXXXXXXXXXXXXXXXKVNTNQGXXXXXXXXX 260
           K  E KKKFYIECAA+NPNLKRFLQAST                  N+N           
Sbjct: 197 KLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQNASPLPTNSNGNQTSSPAQQQ 256

Query: 261 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNSTSTSRSPTQVTSVXXXXXXXXXX 320
                                               S ++SRSPTQVTSV          
Sbjct: 257 AAVQVPPPQNGTPGQTR-------------------SAASSRSPTQVTSVNAAAHLANNA 297

Query: 321 XXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPP 380
               R+AIFKQPNPS+PVSE +T K PT +  RSNRPTITGGSAMNAAAL TPVMTKLPP
Sbjct: 298 TSAARRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPP 357

Query: 381 YEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFISNVTGFACRLAK 440
           YEVD+ERVMSKRKLRELVKSV                         FI+NVT FACRLAK
Sbjct: 358 YEVDNERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAK 417

Query: 441 HRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGIN 492
           HRKSDNLDVRDIQLHLERNWNIRIPGY+ADE+RSTRKWN T +Y QKLQGIN
Sbjct: 418 HRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGIN 469

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  409 bits (1052), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 231/477 (48%), Positives = 273/477 (57%), Gaps = 22/477 (4%)

Query: 15  QGNTPQPLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNXX 74
           QGN   P  Q+T +S++QLA +F  L  EA ++GV T EG ELLK+A+ IKAIY+ Y+  
Sbjct: 67  QGNGQVP--QLTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQ 124

Query: 75  XXXXXXXFGQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSEAYNK 134
                                                        I+ LLTP+Q EAY K
Sbjct: 125 QAQQAFQV--------RNPAPAGQLAAAGTGQATAPRPTSSVASNIKMLLTPQQREAYEK 176

Query: 135 LTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDAS 194
           LT+TF +S KNI GE E+L+KNIEVLDTEIKNR+ EP+ V++LE+ K EL+TKL GL+  
Sbjct: 177 LTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETKKNELLTKLTGLNTQ 236

Query: 195 FQALPQKFHEAKKKFYIECAASNPNLKRFLQASTXXXXXXXXXXXXXXXXKVNTNQGXXX 254
           FQALP+KF E KKKFYIECAA+N NLK+FLQ +T                  NT  G   
Sbjct: 237 FQALPKKFQEDKKKFYIECAATNVNLKKFLQ-ATSQQQRASAGNTGTTNSPANTQLGANI 295

Query: 255 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNSTSTSRSPTQVTSVXXXX 314
                                                     ++  +R P QVT V    
Sbjct: 296 GAASAATPAAANAAPTGSSAATPQSQRQQMQRP---------NSGANRYPAQVTPVNAAA 346

Query: 315 XXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPV 374
                     R  IFKQPNPS+P+ EN+TP   T+V+YRSNRPTIT GSAMNA+AL  PV
Sbjct: 347 NQNNSGTA--RPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPV 404

Query: 375 MTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFISNVTGF 434
           MTKLPPYEVDSERVMSKRKLRELVK+V                         FI+NVT F
Sbjct: 405 MTKLPPYEVDSERVMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSF 464

Query: 435 ACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGI 491
           ACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGY+ADEIRST+KWN T  Y+QKLQGI
Sbjct: 465 ACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGI 521

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  277 bits (708), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 144/192 (75%)

Query: 301 SRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTIT 360
           SRSPTQVTSV              RQAIFKQPNPS+PVSE +T + PT V +RSNRPTIT
Sbjct: 278 SRSPTQVTSVNAAAHLANNATSAARQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTIT 337

Query: 361 GGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXX 420
           GGSAMNAAAL TPVMTKLPPYEVD+ERVMSKRKLRELVKSV                   
Sbjct: 338 GGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELL 397

Query: 421 XXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNS 480
                 FI+NVT FACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGY+ADE+RSTRKWN 
Sbjct: 398 LDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNP 457

Query: 481 TTNYTQKLQGIN 492
           TT+Y QKLQGIN
Sbjct: 458 TTSYNQKLQGIN 469

 Score =  181 bits (459), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 130/215 (60%), Gaps = 6/215 (2%)

Query: 16  GNTPQ--PLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNX 73
           GN  Q  P Q++T  S+QQ+A +F+  F EA R+G+ T +G+ELLKQA++IKA+YDAY  
Sbjct: 14  GNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY-R 72

Query: 74  XXXXXXXXFGQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSEAYN 133
                   F Q                                   I+ LLTP+Q+EAY 
Sbjct: 73  QRQQSAQGFEQ---GGATSNTGDNTAGTPTNARSPNGTPNNNMSSNIQNLLTPQQNEAYG 129

Query: 134 KLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDA 193
           +L +T  ++ + I+GE  YL+K IE+LD EIK R+ +P  V++LE+ K E++ KLRG  A
Sbjct: 130 RLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSA 189

Query: 194 SFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
           S+ AL QK  E KKKFYIECAA+NPNLKRFLQAST
Sbjct: 190 SYLALNQKLREDKKKFYIECAATNPNLKRFLQAST 224

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  257 bits (657), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 139/191 (72%), Gaps = 2/191 (1%)

Query: 301 SRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTIT 360
           SRSPTQVT V              R  IFKQPNPS+P+ E+V+P + T+V+YRSNRPTIT
Sbjct: 304 SRSPTQVTPVNAAANQNSNGAA--RPVIFKQPNPSIPIPESVSPISTTSVSYRSNRPTIT 361

Query: 361 GGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXX 420
           GGSAMNAAAL TPVMTKLPPYEVDSERVMSKRKLRELVKSV                   
Sbjct: 362 GGSAMNAAALTTPVMTKLPPYEVDSERVMSKRKLRELVKSVGIDDGDGETTIDGDVEELL 421

Query: 421 XXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNS 480
                 FI+NVT FACRLAKHRKSDNLDVRDIQLHLERNWNIR PGYSADEIRST+KWNS
Sbjct: 422 LDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRTPGYSADEIRSTKKWNS 481

Query: 481 TTNYTQKLQGI 491
           T  Y QK+Q I
Sbjct: 482 TPAYGQKMQVI 492

 Score =  154 bits (390), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 90/109 (82%)

Query: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179
           I+ LL P+Q EAY +LT+TF +SAKNI+GE E+L+KNIEVLDTEIKNR+SEP+ V +LES
Sbjct: 133 IKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPITVRQLES 192

Query: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
            K EL+ KL  L+  FQ LP+KF E KKKFYIECAA+N NLK+FLQA++
Sbjct: 193 KKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATS 241

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/58 (58%), Positives = 42/58 (72%), Gaps = 2/58 (3%)

Query: 15 QGNTPQPLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYN 72
          QGN   P  Q+T  S+QQLA +FT L  EA R+GV T EG ELLK+A+K+KAIY+ YN
Sbjct: 7  QGNGQVP--QLTPPSLQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYETYN 62

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  249 bits (637), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 121/196 (61%), Positives = 139/196 (70%), Gaps = 1/196 (0%)

Query: 297 STSTSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNR 356
           S + SR+ +QVT+V              + AIFKQ +P +P+SE VT K P+ V Y++NR
Sbjct: 296 SNTGSRAQSQVTNVNAAASMAYNNGAN-KSAIFKQSDPLVPISETVTAKTPSPVTYKTNR 354

Query: 357 PTITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXX 416
           PT+TGG+AMNAAALNTP MTKLPPYEVD+ERVMSKRKLRELVK+V               
Sbjct: 355 PTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDV 414

Query: 417 XXXXXXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTR 476
                     F+SNVTGFACRLAKHRKSDNLD RDIQLHLERNWNIRIPGYSADEIRSTR
Sbjct: 415 ESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTR 474

Query: 477 KWNSTTNYTQKLQGIN 492
           KWN   +Y QK+Q IN
Sbjct: 475 KWNPKPSYNQKMQAIN 490

 Score =  113 bits (282), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 104/209 (49%), Gaps = 13/209 (6%)

Query: 32  QLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNXXXXXXXXXFGQ------- 84
           +L  +F AL  EA  +G NT  G+ELL +A+KIKAIYD YN         F Q       
Sbjct: 29  ELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNRQRQQAAQAFVQGRNGGTP 88

Query: 85  -----TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSEAYNKLTKTF 139
                +                                  I+ +LTPEQ++ +  L++ F
Sbjct: 89  GANPASSGSTGSVGAVNAAGSSSSGSSQQSRSSGSQLANIIKQVLTPEQNQQFEALSQNF 148

Query: 140 GDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALP 199
              A +IR +  +L+++IE L+ E+ +++++  A ++LE  K EL   L+ L+  + AL 
Sbjct: 149 QARANSIRDKHTFLKQHIERLNQEV-SKQTDASAKKQLEEKKTELANNLKMLNMEYGALQ 207

Query: 200 QKFHEAKKKFYIECAASNPNLKRFLQAST 228
           Q+F   KKKFY+ECA  NP L+R LQ ST
Sbjct: 208 QEFQNGKKKFYVECARHNPALQRLLQRST 236

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  244 bits (622), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 130/168 (77%)

Query: 325 RQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVD 384
           + AIFKQ +P +P+SENVT K P+ VAY+SNRPT+TGG+AMNA+ LNTP +TKLPPYEVD
Sbjct: 366 KSAIFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVD 425

Query: 385 SERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFISNVTGFACRLAKHRKS 444
           +ERVMSKRKLRELVK+V                         F++NVTGFACRLAKHRKS
Sbjct: 426 TERVMSKRKLRELVKTVGIDDGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKS 485

Query: 445 DNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGIN 492
           DNLD RDIQLHLERNWNIRIPGYSADEIRSTRKWN + +Y QK+Q IN
Sbjct: 486 DNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSIN 533

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 73/109 (66%), Gaps = 1/109 (0%)

Query: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179
           I+ +LTPEQ++ Y+ L +TF     NIR +  +L +++E L+ EI N+++EP A ++LE 
Sbjct: 143 IKQVLTPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEI-NKKTEPAAKKQLED 201

Query: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
            K EL+T L+ L+  +  L Q+F   KKKFY+ECA  NP L+R LQ ST
Sbjct: 202 KKMELLTNLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 26/40 (65%)

Query: 32 QLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAY 71
          +L  +F  L  E+  +G NT  G+ELL QA+KIKA+Y  Y
Sbjct: 41 ELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNY 80

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  241 bits (616), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 117/196 (59%), Positives = 138/196 (70%), Gaps = 1/196 (0%)

Query: 296 NSTSTSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSN 355
           N++ T +S  +VT+V              + AIFKQ  P++P+SEN++ K P  VAYRSN
Sbjct: 323 NTSQTEQSKAKVTNVNATASMLNNISSS-KSAIFKQTEPAIPISENISTKTPAPVAYRSN 381

Query: 356 RPTITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXX 415
           RPTITGGSAMNA+ALNTP  TKLPPYE+D++RVMSKRKLRELVK+V              
Sbjct: 382 RPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGD 441

Query: 416 XXXXXXXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRST 475
                      F++NVT F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGYSADEIRST
Sbjct: 442 VEELLLDLADDFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRST 501

Query: 476 RKWNSTTNYTQKLQGI 491
           RKWN + NY QKLQ I
Sbjct: 502 RKWNPSQNYNQKLQSI 517

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 66/109 (60%), Gaps = 1/109 (0%)

Query: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179
           I+ +LTPE+++ Y KL + F     +I+ +  YL++NI+ L+ EI N++++    ++L+ 
Sbjct: 136 IKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEI-NKQTDEGPKQQLQE 194

Query: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
            K EL+   + L   +  L   +  +KK FY+ECA  NP L +FLQ ST
Sbjct: 195 KKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQEST 243

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 30 IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDA 70
          +Q++A +F  L  EA  +G  T  G+EL+ QAAKIK +YDA
Sbjct: 38 LQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDA 78

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  241 bits (615), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 116/197 (58%), Positives = 138/197 (70%), Gaps = 1/197 (0%)

Query: 295 GNSTSTSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRS 354
           GN+  T +S  +VT+V              + AIFKQ  P++P+SEN++ K P  VAYRS
Sbjct: 308 GNAPQTEQSKAKVTNVNATASMMNNVSSS-KSAIFKQTEPAIPISENISAKAPAPVAYRS 366

Query: 355 NRPTITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXX 414
           NRPTITGGSAMNA+ALNTP  TKLPPYE+D++RVMSKRKLRELVK+V             
Sbjct: 367 NRPTITGGSAMNASALNTPAATKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDG 426

Query: 415 XXXXXXXXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRS 474
                       F++NVT F+CRLAKHR+SDNL+ RDIQLHLERNWNIRIPGYSADEIRS
Sbjct: 427 DVEELLLDLADDFVTNVTAFSCRLAKHRRSDNLEARDIQLHLERNWNIRIPGYSADEIRS 486

Query: 475 TRKWNSTTNYTQKLQGI 491
           TRKWN + +Y QKLQ I
Sbjct: 487 TRKWNPSQSYNQKLQSI 503

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 98/213 (46%), Gaps = 15/213 (7%)

Query: 30  IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAY-------NXXXXXXXXXF 82
           +Q++  +FTAL  EA  +G  T  G+EL+ QAAKIK +YDA                   
Sbjct: 38  LQEMTAKFTALLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAYRNASM 97

Query: 83  GQTXX-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSEAYNKL 135
           G T                                         I+ +LTPE+++ Y KL
Sbjct: 98  GNTNSNSNNPVTMSTEKTSNSSQQHQQQHQQQQTRNNSNKFSSMIKQVLTPEENQEYEKL 157

Query: 136 TKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASF 195
            + F     +I+ +  +L++NI+ L+ EI N+++E  A ++L+  K EL+   + L   +
Sbjct: 158 WQNFQARHTSIKEKETFLKQNIDRLEQEI-NKQTEEGAKQQLQEKKNELLNDWKVLKIEY 216

Query: 196 QALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
             L   +  +KK FY+ECA  NP L +FLQ ST
Sbjct: 217 TKLFNSYQNSKKTFYVECARHNPALHKFLQEST 249

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  241 bits (615), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 117/196 (59%), Positives = 138/196 (70%), Gaps = 1/196 (0%)

Query: 296 NSTSTSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSN 355
           N+  T +S  +VT+V              + AIFKQ  P++P+SEN++ K P  VAYRSN
Sbjct: 319 NAPQTEQSKAKVTNVNATASMMSNVSAN-KSAIFKQTEPAIPISENISTKAPAPVAYRSN 377

Query: 356 RPTITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXX 415
           RPT+TGGSAMNA+ALNTPV TKLPPYE+D++RVMSKRKLRELVK+V              
Sbjct: 378 RPTVTGGSAMNASALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGD 437

Query: 416 XXXXXXXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRST 475
                      F++NVT FACRLAKHRKSDNL+ RDIQLHLERNWNIRIPGYSADEIRST
Sbjct: 438 VEDLLLDLADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRST 497

Query: 476 RKWNSTTNYTQKLQGI 491
           RKWN + +Y QKLQ I
Sbjct: 498 RKWNPSQSYNQKLQNI 513

 Score = 89.0 bits (219), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 94/212 (44%), Gaps = 14/212 (6%)

Query: 30  IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYD-------------AYNXXXX 76
           +Q++  +F AL  EA  +G  T  G+EL+ QAAKIK +YD             AY     
Sbjct: 38  LQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAYKNASM 97

Query: 77  XXXXXFGQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSEAYNKLT 136
                                                      I+ +LTPE+++ Y KL 
Sbjct: 98  GNANPNPSNLASLPTDKAPNPSQQQQQQQQQQARNNSNKFSNMIKQVLTPEENQEYEKLW 157

Query: 137 KTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQ 196
           + F     +I+    +L++N++ L+ EI N++++    ++LE  K EL+   + L   + 
Sbjct: 158 QNFQVRHTSIKEREAFLKQNVDRLEQEI-NKQTDEGTKQQLEEKKNELLNDWKVLKIEYT 216

Query: 197 ALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
            L   +  +KK FY+ECA  NP L +FLQ ST
Sbjct: 217 KLFNSYQNSKKTFYVECARHNPALHKFLQEST 248

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  239 bits (609), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 138/196 (70%), Gaps = 3/196 (1%)

Query: 297 STSTSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNR 356
           + S  RS +Q+T+V              +  IFKQ +P++P+SE+++ K P  V YR NR
Sbjct: 270 AASKPRSQSQITNVNAAASNSSSSN---KSVIFKQSDPAVPISESISSKTPIPVPYRVNR 326

Query: 357 PTITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXX 416
           PTI+GGSAMNAAALNTP+MTKLPPYE+D+ERVMSKRKLRELVK++               
Sbjct: 327 PTISGGSAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIDGDV 386

Query: 417 XXXXXXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTR 476
                     F++NVT FAC+LAKHRKSDNL+ +DIQLHLERNWNIRIPGYSADEIRSTR
Sbjct: 387 EELLLDLADDFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTR 446

Query: 477 KWNSTTNYTQKLQGIN 492
           KWN T +Y QKLQ IN
Sbjct: 447 KWNPTQSYNQKLQSIN 462

 Score =  117 bits (292), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 105/200 (52%), Gaps = 2/200 (1%)

Query: 30  IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNXXXXXXXXXFGQTXXXX 89
           + +L+ RF +L +EA ++G  T EG+EL+ QA+K+KA+YD YN                 
Sbjct: 28  LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNKQKQEAMAQAQARNNNA 87

Query: 90  XXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXIRTLLTPEQSEAYNKLTKTFGDSAKNIRG 148
                                          IR  LTPEQ++ Y+KL + F   A NI+ 
Sbjct: 88  NTANVNSSSSANSTEANTSGRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKD 147

Query: 149 ESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALPQKFHEAKKK 208
           +  +L++NI+ L  EI+ ++++  A ++L+  + EL+T L+ +   +  L Q+++  KK 
Sbjct: 148 KHTFLKQNIDRLVQEIE-KQTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKA 206

Query: 209 FYIECAASNPNLKRFLQAST 228
           FYIECA  NP+L+R LQ ST
Sbjct: 207 FYIECAKKNPDLQRLLQKST 226

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  238 bits (606), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 126/168 (75%)

Query: 325 RQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVD 384
           +Q IFKQ +P +PVS+ ++ K P AV YRSNRPT+TGGSAM+A+ALNTPVMTKLPPYE+D
Sbjct: 332 KQTIFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSAMSASALNTPVMTKLPPYELD 391

Query: 385 SERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFISNVTGFACRLAKHRKS 444
           +ERVMSKRKLRELVKS+                         FI+NVT FACRLAKHRKS
Sbjct: 392 TERVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMADDFITNVTSFACRLAKHRKS 451

Query: 445 DNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGIN 492
           DNL+ RDIQLHLERNW+IRIPGYSADEIRS RKWN    Y QKLQ IN
Sbjct: 452 DNLEARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTYNQKLQQIN 499

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 65/109 (59%)

Query: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179
           +R +LT EQ+  ++KL +TF   A  ++ +  +L++NIE L  EI  +     A ++LE 
Sbjct: 125 MRQVLTDEQNANFDKLDQTFRSRASALKDKHTFLKQNIERLTQEINKQADNVNARKQLEE 184

Query: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
            + EL+  L+ +      L QK+   KK FYIECA +NP+L++ LQ ST
Sbjct: 185 KRGELLRNLKAITMEHNTLYQKYQNGKKAFYIECAKTNPDLQKLLQKST 233

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%)

Query: 30 IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYN 72
          I++L  +F AL  EA  +G NT  G+ELL QA+K+KA+YD YN
Sbjct: 26 IRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNYN 68

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  237 bits (605), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 118/195 (60%), Positives = 136/195 (69%), Gaps = 1/195 (0%)

Query: 298 TSTSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRP 357
           T  S++ +QVT+V                AIFKQ  P++P+SEN++ K P  V YRSNRP
Sbjct: 327 TDQSKTKSQVTNVNATASMMSNASSSK-SAIFKQTEPAIPISENISTKAPAPVPYRSNRP 385

Query: 358 TITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXXX 417
           TITGGSAMNA ALNTPV TKLPPYE+D++RVMSKRKLRELVK+V                
Sbjct: 386 TITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVE 445

Query: 418 XXXXXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRK 477
                    F++NVT FACRLAKHRKSDNL+ RDIQLHLERNWNIRIPGYSADEIRSTRK
Sbjct: 446 ELLLDLADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRK 505

Query: 478 WNSTTNYTQKLQGIN 492
           WN + +Y QKLQ IN
Sbjct: 506 WNPSQSYNQKLQNIN 520

 Score = 95.1 bits (235), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 104/218 (47%), Gaps = 9/218 (4%)

Query: 19  PQPLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNXXXXXX 78
           PQ    +    + ++ ++F AL  EA  +G  T  G+EL+ QAAKIK++YDA+N      
Sbjct: 27  PQQNMMLQQKQLLEMTVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNRRRQQA 86

Query: 79  XXXF-----GQTXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSE 130
              +     G T                                     I+ +LT E+++
Sbjct: 87  AQAYKNASVGNTTPNAGNPVSLPTEKPPSLSQQQQQQQARSNSNKFSNMIKQVLTSEENQ 146

Query: 131 AYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRG 190
            Y KL + F   A +++ +  +L++NI+ L  E+ N++++    ++LE  K EL+   + 
Sbjct: 147 QYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEV-NKQTDEATKKQLEDKKNELLNNRKV 205

Query: 191 LDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
           L   +  L + F  +KK FY+ECA  NP L++FLQ ST
Sbjct: 206 LGIEYNNLLKGFQNSKKTFYVECARHNPALQKFLQEST 243

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  236 bits (602), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 117/196 (59%), Positives = 134/196 (68%), Gaps = 2/196 (1%)

Query: 297 STSTSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNR 356
           + S   SP QVT+V              R  IFKQPNPS+P+SENVT     +V+YRSNR
Sbjct: 306 TASDKSSPMQVTTVNAAANQTAQSNT--RPPIFKQPNPSIPISENVTASPTVSVSYRSNR 363

Query: 357 PTITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXX 416
           PTITGGS MNA AL TPVMTKLPPYEVD+ERVMSKRKLRELVK+V               
Sbjct: 364 PTITGGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETTIDGDV 423

Query: 417 XXXXXXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTR 476
                     FI+NVT FAC+LAKHRKSD+LDVRDIQ+HLERNWNIRIPG++ DEIRST+
Sbjct: 424 EELLLDLADDFITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIRSTK 483

Query: 477 KWNSTTNYTQKLQGIN 492
           KWN T +Y Q +  IN
Sbjct: 484 KWNPTPSYNQMVNAIN 499

 Score =  159 bits (401), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 118/208 (56%), Gaps = 5/208 (2%)

Query: 22  LQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNXXXXXXXXX 81
           LQ +T AS+QQLA R  +L  EA RIGV+T EG+ELL+QAA+IKA+Y+AY+         
Sbjct: 10  LQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRQQQAQA 69

Query: 82  FGQTXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSEAYNKLT 136
                                                      I+ LLTP+Q EAYN+L 
Sbjct: 70  QAGAQGAVNNNATNVKSMDQQQQQQQQQQQQQATASSNNVTNNIKVLLTPQQREAYNRLV 129

Query: 137 KTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQ 196
           + + D  +NI+GE  +L++NI VLD EI+NR    L+V++LE  + EL+ K+R L A + 
Sbjct: 130 QKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYS 189

Query: 197 ALPQKFHEAKKKFYIECAASNPNLKRFL 224
            L QK+ E ++KFYIEC+ +N +L+R+L
Sbjct: 190 TLQQKYQEDRRKFYIECSQTNADLRRYL 217

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  234 bits (597), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 139/195 (71%), Gaps = 1/195 (0%)

Query: 298 TSTSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRP 357
           ++TS + +QVT+V              + AIFKQ +PS+P+SE++T K P AV+Y SNRP
Sbjct: 368 SATSANRSQVTNVNATASSANKNIQS-KSAIFKQSDPSVPISESITVKAPEAVSYISNRP 426

Query: 358 TITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXXXXX 417
           ++TGG+AMNA+ LNTP +TKLPPYE+D+ERVMSKRKLREL+KSV                
Sbjct: 427 SLTGGTAMNASVLNTPTITKLPPYEIDTERVMSKRKLRELIKSVGIDEGDGETVIDGDVE 486

Query: 418 XXXXXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRK 477
                    F++NVT FACRLAKHRKSD+L+ RDIQLHLERNWNIRIPGYS DEIRSTRK
Sbjct: 487 ELLLDLADDFVTNVTSFACRLAKHRKSDSLEARDIQLHLERNWNIRIPGYSGDEIRSTRK 546

Query: 478 WNSTTNYTQKLQGIN 492
           W  T +Y+QK+Q IN
Sbjct: 547 WIPTQSYSQKMQSIN 561

 Score = 85.5 bits (210), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 70/108 (64%), Gaps = 1/108 (0%)

Query: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179
           I+ +LTPE+++ Y+KL + F   A +I+ +  +L+++I+ L  EI N++++  A ++LE 
Sbjct: 135 IKQVLTPEENQQYDKLLQNFQSRASSIKDQHTFLKQHIDRLSQEI-NQQTDEAAKKQLEV 193

Query: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAS 227
            +AEL+T LR L+  +  L +     KK FY+ECA  NP L+R LQ S
Sbjct: 194 NRAELLTNLRTLNTEYSNLYEDIKNKKKAFYVECARQNPELQRLLQKS 241

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%)

Query: 36 RFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYN 72
          +F  L  EA R+G NT  G+ELL QA+ +KA+YD YN
Sbjct: 33 KFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNYN 69

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  224 bits (571), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 124/168 (73%)

Query: 325 RQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVD 384
           + +IFK  +P++P+++ V+ K P  +A+RSNRPTI+ GSAMNAAALNTPVMT LPPYE+D
Sbjct: 383 KSSIFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEID 442

Query: 385 SERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFISNVTGFACRLAKHRKS 444
           ++RVMSKRKLRELVKS+                         F++NVTGFACRLAKHRKS
Sbjct: 443 TDRVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKS 502

Query: 445 DNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGIN 492
           DNL+  DIQLHLERNWNIRIPGYSADEIRS  KWN++  Y QKL  IN
Sbjct: 503 DNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSIN 550

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 67/109 (61%), Gaps = 1/109 (0%)

Query: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179
           I+ +LTPEQ++ Y +L + F   A  I+ +  ++++NI+ L  EI N++++  A ++L  
Sbjct: 137 IKQVLTPEQNQQYEQLLQNFQVRASAIKDKHTFIKQNIDRLVVEI-NKQTDEEAKKQLNE 195

Query: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
            K EL+  ++ +    QAL Q+    KK FY+ECA  NP L+R LQ ST
Sbjct: 196 KKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNPALQRLLQRST 244

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%)

Query: 30 IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAY 71
          IQ+L  RF  L  EA ++G  T  G+ELL QAAK+KA+Y+ Y
Sbjct: 35 IQELTARFKQLVTEAKKVGETTPRGKELLLQAAKLKAVYENY 76

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  213 bits (543), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 123/168 (73%)

Query: 325 RQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVD 384
           +  IFKQ +P++P+S+NVT +    + Y+SNRP++TGG+AM+AAALN P +T LPPYE+D
Sbjct: 351 KSVIFKQSDPTVPISDNVTLEPTELIPYKSNRPSLTGGAAMSAAALNVPPLTTLPPYEID 410

Query: 385 SERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFISNVTGFACRLAKHRKS 444
           +ERVM+KRKLREL+K+V                         F++NVT FACRLAKHRKS
Sbjct: 411 TERVMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKS 470

Query: 445 DNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGIN 492
           +NL+ RDIQLHLERNWNIRIPGYS DEIRSTRKW  T  ++QKLQ IN
Sbjct: 471 ENLESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQKLQSIN 518

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVER--L 177
           I+ +LT EQ++ Y+ L K F     +I+ +  +L++NI+ L  EI N  +      +  L
Sbjct: 152 IKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNNDVNVKKNL 211

Query: 178 ESTKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFL 224
           E  + EL+T L+ L   F  + ++F   KK FY+ECA  NP L++ L
Sbjct: 212 EIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNPALQKLL 258

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 37/70 (52%), Gaps = 12/70 (17%)

Query: 14 SQGNTPQPLQQVTSASIQQ--LAL----------RFTALFKEATRIGVNTSEGEELLKQA 61
          S  +TP P    T AS  Q  LAL          +F  L  EA  +G NT  G+ELL QA
Sbjct: 2  SSNSTPTPNANATPASSAQAKLALQQKQLIELTNKFKQLVNEAKAVGENTPRGKELLIQA 61

Query: 62 AKIKAIYDAY 71
          +K+KAIY+ +
Sbjct: 62 SKLKAIYENF 71

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  213 bits (543), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 100/168 (59%), Positives = 120/168 (71%)

Query: 325 RQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVD 384
           +  +FK   P + +S+ ++ K P +V YRSNRP++TGGSAMNA+AL TPV TKLPPYE+D
Sbjct: 436 KSIMFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMNASALTTPVATKLPPYEID 495

Query: 385 SERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFISNVTGFACRLAKHRKS 444
           +ERVMSKRKLRELVKS+                         F++NVT FACRLAKHR S
Sbjct: 496 TERVMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRNS 555

Query: 445 DNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGIN 492
           D+L+ RDIQLHLE+NWNIRIPGYSADEIRS RKW+   NY QKLQ IN
Sbjct: 556 DSLEPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQKLQHIN 603

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 59/102 (57%)

Query: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179
           ++ +LTPEQ++ Y+KL  TF   A  I+ +  ++++NIE L  E+     +P    +LE+
Sbjct: 167 MKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNKPNLDPNLKTQLEN 226

Query: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLK 221
            K EL   +R +      L Q+F   +K FY+ECA +NP L+
Sbjct: 227 KKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPALQ 268

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 15 QGNTPQPLQQVTSASIQQLALRFTALFKEATRIGVNTSE-GEELLKQAAKIKAIYDAYN 72
          QG  P  LQ      + +L+ +F AL  EA ++G + S+ G+ELL QA+KIKAIYD YN
Sbjct: 29 QGGPPITLQ---PNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYN 84

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  206 bits (523), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 115/167 (68%)

Query: 325 RQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVD 384
           +  IFK+  PS+P+ E++    P  VAY+ NRPTITGGS MNA ALNTPV  K+P YE D
Sbjct: 320 KHKIFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEAD 379

Query: 385 SERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFISNVTGFACRLAKHRKS 444
           ++RV+SKRKLRELV++V                         F+S+VT FACRLAKHR S
Sbjct: 380 TDRVLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGS 439

Query: 445 DNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGI 491
           D+L+ RD+QLHLERNWNIR+PGY+ DEIRSTRKWN T+ Y QKL  I
Sbjct: 440 DSLEARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAI 486

 Score = 95.9 bits (237), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 98/210 (46%), Gaps = 7/210 (3%)

Query: 16  GNTPQPLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNXXX 75
           G+   P QQ+      +LA RF     EA R+G  T  G++LL +AAKIKA+YD+     
Sbjct: 21  GSASTPQQQLV-----ELAQRFKLFVGEAKRVGETTEAGKQLLVRAAKIKAVYDSVRGAS 75

Query: 76  XXXXXXFGQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSEAYNKL 135
                   Q                                   +R  LTPEQ + Y+K+
Sbjct: 76  AGAAAQS-QQRTADGATGNVATAPAAAGGGGGAGNTAATQLAMAMRQALTPEQVQQYDKI 134

Query: 136 TKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASF 195
              F + AK+IR +  YL++NI+ L  EI N++ +  A ++L   + EL+  +R L    
Sbjct: 135 ATNFQNKAKSIRDKHNYLKQNIDKLTAEI-NKQQDRSAKQQLAEKRNELLRSVRQLTVEH 193

Query: 196 QALPQKFHEAKKKFYIECAASNPNLKRFLQ 225
            +L   F  ++K FY+ECA  NP L++ LQ
Sbjct: 194 NSLKVNFQLSRKNFYVECAKLNPKLQQILQ 223

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  210 bits (534), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 130/198 (65%), Gaps = 1/198 (0%)

Query: 295 GNSTSTSRSPTQVTSVXXXXXXXXXXXXXXRQAIFKQPNPSLPVSENVTPKNPTAVAYRS 354
           G S S +R  + +T+V                 IFKQ  P LP+SE++T K P A+ YR+
Sbjct: 534 GQSNSQNRQQSAITNVNAAASTSSKSLTKTMN-IFKQTEPLLPISEHLTTKIPEAIPYRN 592

Query: 355 NRPTITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXX 414
           NRPT+TGG+AMN + LNTPV+TKLPPYE+D++RVM KRKL+E+V+SV             
Sbjct: 593 NRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQRVMLKRKLKEVVRSVGVDDGDGETVIGG 652

Query: 415 XXXXXXXXXXXXFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRS 474
                       F+++VT FAC++AKHRKSD+LDV DIQLHLE+NWNIRIP YS D IRS
Sbjct: 653 DVEEALLDLADNFVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRS 712

Query: 475 TRKWNSTTNYTQKLQGIN 492
           +RKWN T +Y QKL  +N
Sbjct: 713 SRKWNPTASYNQKLNSLN 730

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 63/109 (57%)

Query: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179
           I+ LLTPEQ++ Y++L   F   A NI+ + ++L+++I     E+       L   +LE 
Sbjct: 234 IKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRVKLEK 293

Query: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228
            K EL++ L+ +   +  L Q+F   KK FYI CA  NPNL+R LQ ++
Sbjct: 294 KKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%)

Query: 18  TPQPLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYN 72
           TP     +    + +L  +F  L  EA ++G NT+ G+ELL QA KIK IYD +N
Sbjct: 49  TPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFN 103

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  120 bits (300), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 381 YEVDSERVMSKRKLRELVKSVXXXXXXXXXXXXX-XXXXXXXXXXXXFISNVTGFACRLA 439
           YE++SERV+SKRKLRELV+SV                          F+SN+T F+CRL+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 440 KHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGIN 492
           +HR S+ ++ RDIQLH+ERNWNIR+PG++ADEI+S +KW S+  Y   L  +N
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVN 386

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 89/208 (42%), Gaps = 17/208 (8%)

Query: 30  IQQLALRFTALFKEATRIGVNTSE-GEELLKQAAKIKAIY----DAY-NXXXXXXXXXFG 83
           + +LA  F  L K+A   G +T+E G+ELL +A K+K ++    + Y N           
Sbjct: 15  LNELAENFKNLIKDAKLNGGDTTEKGKELLIKATKVKKLFTQLSNKYKNDSSSNDSTLSR 74

Query: 84  QTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRTLLTPEQSEAYNKLTKTFGDSA 143
                                               I+  LTPEQ+E+Y  L K F   A
Sbjct: 75  SNSNSSLKNMNTPPSTSSNNSSSTPMVRSNSNLSMMIKNALTPEQNESYETLLKDFQIRA 134

Query: 144 KNIRGESEYLRKNIE----VLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALP 199
             I+ E   +++ I+    +L+++  N+E+       L + + E + +L+ L   +  L 
Sbjct: 135 AKIKREHSDVKEKIDNISKLLNSKTNNQEA-------LTAKRNEYLFQLKKLSKDYTELH 187

Query: 200 QKFHEAKKKFYIECAASNPNLKRFLQAS 227
           Q+F   KK FY++ A  N  L++ LQ S
Sbjct: 188 QQFQNEKKNFYLKSAKQNSELQKVLQES 215

>Kwal_33.14525 s33 complement(706024..706926) [903 bp, 300 aa] {ON}
           YNL166C (BNI5) - bud neck protein [contig 102] FULL
          Length = 300

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 328 IFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAA 369
           ++++P PS P S + TPK PT  +     P + GG A ++AA
Sbjct: 147 LYQEPAPSAPSSVSTTPKAPTPPSPAVTLPKVRGGPAASSAA 188

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.125    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,109,012
Number of extensions: 1053416
Number of successful extensions: 3402
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3477
Number of HSP's successfully gapped: 72
Length of query: 536
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 422
Effective length of database: 40,409,475
Effective search space: 17052798450
Effective search space used: 17052798450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)