Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H15532g8.324ON94194149150.0
NCAS0C032608.324ON98395838000.0
Suva_10.2228.324ON94394737790.0
KLTH0G12276g8.324ON93794137560.0
NDAI0G025808.324ON95896437360.0
Kwal_56.239208.324ON93794137300.0
Smik_12.1928.324ON94394737210.0
Skud_12.1988.324ON94394737120.0
TDEL0F045008.324ON93894136850.0
YLR129W (DIP2)8.324ON94394736510.0
Kpol_1036.698.324ON93694336140.0
TPHA0C008108.324ON93794335990.0
ZYRO0F10406g8.324ON93894235460.0
TBLA0A039508.324ON93693735290.0
Ecym_42558.324ON93794135170.0
CAGL0M04279g8.324ON94094535040.0
KAFR0H022608.324ON93894634850.0
KNAG0G024508.324ON94294834780.0
AGL196C8.324ON93594034280.0
KLLA0D16390g8.324ON93694232360.0
Skud_12.2858.435ON8176403497e-33
Suva_10.3168.435ON8186393452e-32
TDEL0B020108.435ON8056343416e-32
YLR222C (UTP13)8.435ON8177123363e-31
Ecym_41348.435ON8106293353e-31
TBLA0I025708.435ON8486513353e-31
CAGL0C00737g8.435ON8166363192e-29
KNAG0A025108.435ON8496453184e-29
Smik_12.2798.435ON8176393184e-29
AGR180W8.435ON8066353159e-29
SAKL0H12760g8.435ON8416542997e-27
ZYRO0A09636g8.435ON8086422962e-26
NCAS0C027108.435ON8156332952e-26
NDAI0E034408.435ON8576512925e-26
KAFR0H017508.435ON7836492891e-25
Kwal_27.115858.435ON8236432891e-25
Kpol_1031.498.435ON7605582721e-23
TBLA0F042406.363ON7273352569e-22
CAGL0C03608g6.363ON6433492399e-20
Ecym_25236.363ON6463532343e-19
KLTH0E10120g8.435ON8262002336e-19
KNAG0D002506.363ON6553822309e-19
KLLA0F13244g8.435ON8142752301e-18
TPHA0M020006.363ON6993562291e-18
AGL234W6.363ON6292742282e-18
NCAS0D047806.363ON6213402282e-18
KNAG0A037008.544ON8172942282e-18
TPHA0L010808.435ON8352022273e-18
SAKL0A00660g6.363ON6603572255e-18
YCR084C (TUP1)6.363ON7132862238e-18
NCAS0A151707.534ON4742782209e-18
SAKL0F15972g7.534ON4702712199e-18
TDEL0A075506.340ON5154392209e-18
CAGL0E00561g6.363ON8363462231e-17
Skud_3.1566.363ON7132862211e-17
AEL269C7.534ON4553202181e-17
KAFR0B003707.534ON4612742172e-17
KLLA0F10263g6.363ON6822742192e-17
TDEL0A077806.363ON6572792182e-17
Kpol_1013.377.534ON4682742153e-17
ZYRO0D01122g7.534ON4663132153e-17
Kwal_23.64296.363ON7503142183e-17
Ecym_70388.544ON8001782183e-17
Smik_3.1836.363ON7092812174e-17
Kpol_1028.236.363ON7442782174e-17
Suva_3.1216.363ON7002632165e-17
AEL246C8.544ON8152932166e-17
NCAS0A055206.363ON6713442157e-17
ZYRO0D17292g6.363ON7182802148e-17
TBLA0H036208.544ON8124072159e-17
NDAI0C054908.544ON8593072131e-16
NDAI0K023506.363ON7933682132e-16
TDEL0B059701.399ON3032812042e-16
KLTH0A07282g6.363ON7253542112e-16
KNAG0H016901.399ON3032522023e-16
ZYRO0E04620g1.399ON3032522023e-16
Suva_13.2952.431ON3192352014e-16
Skud_13.2752.431ON3192352014e-16
Smik_13.3052.431ON3192352014e-16
YMR116C (ASC1)2.431ON3192352014e-16
KAFR0E031808.544ON8142942094e-16
Smik_2.3388.544ON8003052095e-16
NCAS0F018502.431ON3182282006e-16
KAFR0C047406.363ON6653742076e-16
TBLA0F005206.363ON6632962068e-16
Ecym_24986.340ON5424542058e-16
TPHA0I032407.534ON4772162049e-16
KAFR0A005102.431ON3192351981e-15
KLLA0E23453g8.544ON8261782051e-15
CAGL0M05335g8.544ON8062962042e-15
KLTH0H12122g1.399ON3032491952e-15
NDAI0H027102.431ON3182341953e-15
NCAS0A042702.431ON3182281953e-15
KAFR0H031401.399ON3032521943e-15
TDEL0B030208.544ON8312942023e-15
ZYRO0A12980g8.544ON8242542004e-15
TPHA0L016908.544ON8322162005e-15
TDEL0H003707.534ON4652991975e-15
CAGL0H03729g1.399ON3032431925e-15
SAKL0H09988g8.544ON7492931997e-15
TPHA0G023802.431ON3182291927e-15
Suva_16.5107.534ON4653351968e-15
SAKL0A01276g6.340ON5154431968e-15
Skud_2.3248.544ON8023051989e-15
YBR198C (TAF5)8.544ON7982151989e-15
SAKL0D08756g1.399ON3032571901e-14
Kpol_487.71.399ON3033261891e-14
KLTH0D04466g2.431ON3192031901e-14
TPHA0M018306.340ON5154311941e-14
Kwal_0.2121.399ON3032491882e-14
KLLA0C08547g6.340ON5154351932e-14
TPHA0I018808.544ON10342141952e-14
NCAS0A139407.322ON12051631952e-14
KAFR0L013907.322ON12061911952e-14
CAGL0I03718g7.322ON12011631934e-14
Skud_3.1456.340ON5154351914e-14
TBLA0B091002.431ON3172291864e-14
Suva_4.4528.544ON8002151925e-14
NDAI0A020907.322ON12001591925e-14
TPHA0O007101.399ON3042841855e-14
Ecym_80727.322ON12011631925e-14
AER263C6.340ON5134351896e-14
KNAG0B027207.322ON12041631917e-14
NDAI0C026001.399ON3032511837e-14
KAFR0F043506.340ON5154351888e-14
KLTH0A00880g7.534ON4712451871e-13
Smik_3.1726.340ON5154281871e-13
Skud_4.1097.322ON12011631891e-13
Kpol_1028.416.340ON5124351871e-13
NCAS0B022008.544ON8222831891e-13
Kpol_297.72.431ON3182291821e-13
Kwal_23.63246.340ON5144371871e-13
Suva_4.997.322ON12011631891e-13
YCR072C (RSA4)6.340ON5154281861e-13
Smik_4.907.322ON12011631881e-13
YDL145C (COP1)7.322ON12011631881e-13
KNAG0E023102.431ON3192351821e-13
Kwal_23.53517.534ON4742451852e-13
TDEL0C022407.322ON12011631872e-13
CAGL0J03476g6.340ON5174351852e-13
NCAS0G036001.399ON3272521812e-13
Kwal_27.120538.544ON7552151853e-13
Kpol_1024.428.544ON8432151853e-13
KLTH0E12606g8.544ON7552151853e-13
AFR199C2.431ON3342271803e-13
TPHA0D045007.322ON12081761853e-13
SAKL0E03960g2.431ON3202031784e-13
TBLA0F022307.322ON12161881844e-13
ZYRO0D08206g6.340ON5154271815e-13
TDEL0A020702.431ON3192291776e-13
SAKL0F10648g7.322ON12031631837e-13
Kpol_2001.657.322ON12061761828e-13
KLTH0H01892g7.322ON12091631829e-13
KLLA0D04840g1.399ON3032481759e-13
Ecym_12931.399ON3032501751e-12
Kwal_56.245267.322ON12101631811e-12
Suva_3.1096.340ON5154271791e-12
ZYRO0F11110g7.322ON12011621811e-12
SAKL0A03872g6.239ON8783051801e-12
ADR077C7.322ON12041631811e-12
TPHA0B011201.247ON7191271791e-12
Ecym_43437.231ON5833961781e-12
YPR178W (PRP4)7.534ON4652051762e-12
ADL082C7.231ON5691901772e-12
Smik_14.3221.399ON3032921722e-12
YNL006W (LST8)1.399ON3032921722e-12
KLLA0F27511g7.231ON6232831762e-12
Skud_14.3211.399ON3032921713e-12
SAKL0F08404g7.231ON6432921763e-12
ZYRO0G20152g2.431ON3192291723e-12
KLLA0F04884g7.322ON12121631773e-12
Suva_14.3421.399ON3032931703e-12
Kpol_1028.546.325ON9051511764e-12
KAFR0A033801.247ON6661231754e-12
TPHA0G016108.672ON4141431734e-12
Kpol_1048.598.544ON8502151764e-12
Ecym_60982.431ON3182021704e-12
AAL009C1.399ON3032511704e-12
NCAS0D046106.340ON5152831744e-12
KNAG0I028406.340ON5192881745e-12
Ecym_28087.534ON4651521735e-12
KLTH0A06754g6.340ON5144351735e-12
KNAG0F018406.239ON9112841746e-12
ZYRO0F07282g8.672ON4271431716e-12
Smik_16.4427.534ON4702051727e-12
AFL118W6.239ON8322871738e-12
TBLA0I022806.325ON9271511721e-11
TBLA0D041307.231ON5741451711e-11
TBLA0F041306.340ON5142211701e-11
TPHA0C011507.231ON6871901711e-11
NDAI0J003307.534ON4722191692e-11
TDEL0H021307.231ON5841901702e-11
NDAI0I003506.340ON5152901692e-11
KAFR0I018807.231ON5911191692e-11
KLTH0A04114g7.231ON6582621683e-11
Ecym_24018.672ON4261531663e-11
Smik_9.1447.231ON6301821683e-11
KNAG0J016808.672ON3981431663e-11
Skud_11.2711.247ON6461851683e-11
YCR057C (PWP2)6.325ON9231511683e-11
KLTH0H03608g6.239ON8753041683e-11
Suva_9.1547.231ON6381821673e-11
NDAI0G038303.25ON5102531664e-11
YIL046W (MET30)7.231ON6401821674e-11
Ecym_80901.247ON7162431674e-11
KLTH0D11132g8.672ON4371851654e-11
Kpol_1070.117.231ON6661821664e-11
Skud_9.1237.231ON6391821665e-11
KLTH0A06380g6.325ON9151511675e-11
Smik_11.2981.247ON6622281665e-11
ZYRO0D16742g7.231ON6081821655e-11
NCAS0B078401.247ON5891611656e-11
KNAG0D016907.231ON6541731656e-11
CAGL0L00781g7.231ON6731821656e-11
TDEL0A061808.672ON4341861637e-11
Skud_3.1336.325ON9161511657e-11
Kwal_26.87768.672ON4331831637e-11
KLLA0E12277g2.431ON3262091608e-11
KNAG0C062405.631ON3552401618e-11
TBLA0A060606.239ON8882671658e-11
TBLA0E007607.534ON3841591619e-11
Suva_11.2681.247ON6452271649e-11
KNAG0H001802.663ON3893341619e-11
TBLA0B043908.585ON3361601601e-10
Smik_2.1124.106ON8412261631e-10
Smik_3.1576.325ON9241511631e-10
Skud_16.4827.534ON4652051611e-10
SAKL0H06666g8.672ON4412451611e-10
Suva_14.223.25ON4692091611e-10
TBLA0D055601.247ON5892221621e-10
Kwal_23.57697.231ON6271831612e-10
SAKL0A01738g6.325ON9091491612e-10
Skud_14.223.25ON4672091592e-10
Skud_2.1034.106ON8402261612e-10
YBL008W (HIR1)4.106ON8402261612e-10
Kpol_1016.111.247ON6691281602e-10
Suva_3.936.325ON9201511612e-10
KLLA0F21406g1.247ON7052811602e-10
Suva_2.1174.106ON8402261612e-10
NCAS0I011703.344ON5462061593e-10
NDAI0A026107.231ON7671161603e-10
NDAI0B051901.247ON6681761603e-10
ZYRO0D08558g6.325ON9121511603e-10
TBLA0D048701.399ON3273061563e-10
KAFR0H024508.672ON4171041583e-10
CAGL0M02277g8.672ON4271871583e-10
ZYRO0D03828g1.247ON7261271593e-10
CAGL0M08646g5.631ON3372311563e-10
TPHA0P014903.25ON4592091583e-10
YKR036C (CAF4)1.247ON6432271594e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H15532g
         (941 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1897   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1468   0.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1460   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1451   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1443   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1441   0.0  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1437   0.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1434   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1424   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1410   0.0  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1396   0.0  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1390   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1370   0.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1363   0.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1359   0.0  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1354   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1347   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1344   0.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1325   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1251   0.0  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   139   7e-33
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   137   2e-32
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   135   6e-32
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   134   3e-31
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...   133   3e-31
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   133   3e-31
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...   127   2e-29
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   127   4e-29
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   127   4e-29
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   125   9e-29
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   119   7e-27
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   118   2e-26
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   118   2e-26
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   117   5e-26
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   115   1e-25
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...   115   1e-25
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...   109   1e-23
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...   103   9e-22
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    97   9e-20
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    95   3e-19
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    94   6e-19
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    93   9e-19
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    93   1e-18
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    93   1e-18
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    92   2e-18
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     92   2e-18
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    92   2e-18
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    92   3e-18
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    91   5e-18
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    91   8e-18
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    89   9e-18
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    89   9e-18
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    89   9e-18
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    91   1e-17
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    90   1e-17
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    89   1e-17
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    88   2e-17
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    89   2e-17
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    89   2e-17
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    87   3e-17
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    87   3e-17
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    89   3e-17
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    89   3e-17
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    88   4e-17
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    88   4e-17
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    88   5e-17
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    88   6e-17
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    87   7e-17
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    87   8e-17
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    87   9e-17
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             87   1e-16
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    87   2e-16
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    83   2e-16
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    86   2e-16
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    82   3e-16
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    82   3e-16
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    82   4e-16
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    82   4e-16
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    82   4e-16
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    82   4e-16
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    85   4e-16
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    85   5e-16
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    82   6e-16
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    84   6e-16
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    84   8e-16
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    84   8e-16
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    83   9e-16
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    81   1e-15
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    84   1e-15
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    83   2e-15
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    80   2e-15
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    80   3e-15
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    80   3e-15
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    79   3e-15
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    82   3e-15
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    82   4e-15
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    82   5e-15
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    80   5e-15
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    79   5e-15
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    81   7e-15
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    79   7e-15
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    80   8e-15
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    80   8e-15
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    81   9e-15
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    81   9e-15
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    78   1e-14
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    77   1e-14
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    78   1e-14
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    79   1e-14
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    77   2e-14
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    79   2e-14
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    80   2e-14
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    80   2e-14
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    80   2e-14
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    79   4e-14
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    78   4e-14
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    76   4e-14
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    79   5e-14
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    79   5e-14
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    76   5e-14
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    79   5e-14
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    77   6e-14
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    78   7e-14
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      75   7e-14
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    77   8e-14
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    77   1e-13
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    77   1e-13
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    77   1e-13
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    77   1e-13
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    77   1e-13
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    75   1e-13
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    77   1e-13
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    77   1e-13
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    76   1e-13
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    77   1e-13
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    77   1e-13
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    75   1e-13
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    76   2e-13
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    77   2e-13
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    76   2e-13
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    74   2e-13
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    76   3e-13
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    76   3e-13
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    76   3e-13
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    74   3e-13
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    76   3e-13
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    73   4e-13
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    75   4e-13
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    74   5e-13
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    73   6e-13
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    75   7e-13
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    75   8e-13
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    75   9e-13
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    72   9e-13
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    72   1e-12
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    74   1e-12
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    74   1e-12
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    74   1e-12
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    74   1e-12
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    74   1e-12
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    74   1e-12
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    73   1e-12
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    72   2e-12
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    73   2e-12
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    71   2e-12
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    71   2e-12
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    72   2e-12
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    70   3e-12
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    72   3e-12
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    71   3e-12
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    73   3e-12
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    70   3e-12
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    72   4e-12
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    72   4e-12
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    71   4e-12
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    72   4e-12
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    70   4e-12
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    70   4e-12
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     72   4e-12
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    72   5e-12
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    71   5e-12
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    71   5e-12
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    72   6e-12
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    70   6e-12
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    71   7e-12
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    71   8e-12
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    71   1e-11
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    70   1e-11
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    70   1e-11
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    70   1e-11
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      70   2e-11
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    70   2e-11
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       70   2e-11
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    70   2e-11
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    69   3e-11
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    69   3e-11
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    69   3e-11
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    69   3e-11
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    69   3e-11
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    69   3e-11
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    69   3e-11
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    69   3e-11
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      69   4e-11
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    69   4e-11
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    69   4e-11
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    68   4e-11
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    69   4e-11
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    69   5e-11
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    69   5e-11
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    69   5e-11
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    68   5e-11
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    68   6e-11
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    68   6e-11
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    68   6e-11
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    67   7e-11
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    68   7e-11
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    67   7e-11
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    66   8e-11
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    67   8e-11
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    68   8e-11
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               67   9e-11
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    68   9e-11
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    67   9e-11
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    66   1e-10
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    67   1e-10
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    67   1e-10
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    67   1e-10
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    67   1e-10
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    67   1e-10
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    67   1e-10
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    67   2e-10
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    67   2e-10
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    66   2e-10
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    67   2e-10
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    67   2e-10
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    66   2e-10
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    67   2e-10
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    66   2e-10
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    67   2e-10
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    66   3e-10
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     66   3e-10
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    66   3e-10
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    66   3e-10
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    65   3e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    65   3e-10
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    65   3e-10
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    66   3e-10
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    65   3e-10
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    65   3e-10
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    66   4e-10
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    66   4e-10
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    65   4e-10
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    66   4e-10
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    66   4e-10
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    65   4e-10
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    65   5e-10
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    65   5e-10
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    65   5e-10
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    65   5e-10
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    65   6e-10
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    65   6e-10
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    65   6e-10
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    65   6e-10
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    65   7e-10
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    65   7e-10
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    65   7e-10
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    65   7e-10
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    64   7e-10
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    61   8e-10
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    64   8e-10
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    65   8e-10
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    65   9e-10
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      63   9e-10
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    64   1e-09
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    64   1e-09
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    64   1e-09
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    64   1e-09
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    64   1e-09
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    64   1e-09
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    63   1e-09
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    64   1e-09
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    62   2e-09
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    62   2e-09
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    62   2e-09
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    64   2e-09
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    63   2e-09
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    63   2e-09
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    63   2e-09
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    63   2e-09
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    63   2e-09
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    63   2e-09
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    63   2e-09
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    62   3e-09
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    63   3e-09
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      63   3e-09
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    62   3e-09
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    63   3e-09
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    62   3e-09
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    62   3e-09
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    63   3e-09
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    63   3e-09
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    62   4e-09
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    63   4e-09
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    62   4e-09
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    61   4e-09
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    62   5e-09
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     62   5e-09
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    62   5e-09
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     61   6e-09
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    61   7e-09
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    60   8e-09
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    61   8e-09
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    61   9e-09
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    61   9e-09
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    62   9e-09
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    61   9e-09
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    60   1e-08
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     60   1e-08
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     61   1e-08
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    60   1e-08
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    61   1e-08
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    60   1e-08
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    58   2e-08
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    59   2e-08
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    59   2e-08
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    60   2e-08
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    60   2e-08
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    59   2e-08
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    60   2e-08
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    60   2e-08
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    59   2e-08
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    59   3e-08
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    60   3e-08
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    59   3e-08
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    60   3e-08
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    59   3e-08
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    59   4e-08
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    59   4e-08
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    59   4e-08
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    59   4e-08
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    59   4e-08
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    59   4e-08
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    59   4e-08
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    59   4e-08
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    59   5e-08
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    59   5e-08
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    58   5e-08
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    59   5e-08
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    58   5e-08
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    58   5e-08
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    58   6e-08
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    58   6e-08
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    59   6e-08
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    57   6e-08
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    59   6e-08
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    59   7e-08
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    58   7e-08
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    59   7e-08
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    57   8e-08
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       59   8e-08
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    57   8e-08
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    58   9e-08
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    57   9e-08
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    57   1e-07
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    58   1e-07
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    58   1e-07
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    57   1e-07
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    57   1e-07
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    57   1e-07
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     57   1e-07
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    57   1e-07
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    57   1e-07
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    57   1e-07
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    57   2e-07
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    57   2e-07
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    57   2e-07
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    56   2e-07
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    57   2e-07
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    57   2e-07
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    57   2e-07
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    57   2e-07
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    56   2e-07
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    57   2e-07
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    56   2e-07
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    56   2e-07
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    57   2e-07
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    56   2e-07
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    55   2e-07
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    55   2e-07
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      56   2e-07
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    57   2e-07
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    55   3e-07
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    57   3e-07
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    56   3e-07
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    55   3e-07
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    56   3e-07
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    56   3e-07
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    57   3e-07
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    56   3e-07
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    55   3e-07
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    56   3e-07
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    56   3e-07
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    55   3e-07
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              56   4e-07
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    55   4e-07
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    56   4e-07
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    56   4e-07
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    56   4e-07
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    56   4e-07
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    56   4e-07
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    56   4e-07
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    56   4e-07
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    56   4e-07
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    56   4e-07
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    55   5e-07
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    55   5e-07
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    56   5e-07
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    55   5e-07
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    55   5e-07
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    55   5e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    55   5e-07
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       55   5e-07
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    55   6e-07
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    55   6e-07
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    55   6e-07
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    55   6e-07
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    55   7e-07
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    55   7e-07
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    55   7e-07
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    54   7e-07
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    54   8e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    55   8e-07
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    55   8e-07
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    55   8e-07
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    55   9e-07
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    54   9e-07
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    54   1e-06
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    55   1e-06
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    55   1e-06
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    54   1e-06
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    54   1e-06
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    54   1e-06
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    54   1e-06
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    54   1e-06
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    54   1e-06
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    54   1e-06
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    54   1e-06
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    54   2e-06
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    54   2e-06
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    53   2e-06
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    54   2e-06
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    54   2e-06
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    54   2e-06
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    54   2e-06
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    54   2e-06
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    53   2e-06
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    54   2e-06
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    53   2e-06
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    54   2e-06
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    54   2e-06
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    54   2e-06
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    54   2e-06
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    53   2e-06
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    54   2e-06
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    53   2e-06
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    53   2e-06
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    54   3e-06
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    53   3e-06
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    54   3e-06
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    53   3e-06
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    53   3e-06
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    53   3e-06
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    53   3e-06
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    53   3e-06
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    52   3e-06
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    53   3e-06
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    53   3e-06
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    53   3e-06
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    53   3e-06
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    52   4e-06
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    53   4e-06
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    53   4e-06
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    53   4e-06
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    52   4e-06
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    52   4e-06
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    53   4e-06
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    53   4e-06
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    52   4e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    52   4e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    52   4e-06
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    52   5e-06
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    52   5e-06
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    52   5e-06
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    52   5e-06
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    52   5e-06
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    52   6e-06
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    52   6e-06
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    52   6e-06
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    52   6e-06
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    51   6e-06
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    52   6e-06
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    52   6e-06
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    52   7e-06
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    52   7e-06
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    51   7e-06
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    51   7e-06
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    51   7e-06
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    52   7e-06
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    52   8e-06
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    52   8e-06
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    52   8e-06
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    52   8e-06
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    51   8e-06
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    51   9e-06
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    52   9e-06
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    51   9e-06
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    51   9e-06
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    51   9e-06
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    51   9e-06
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    52   9e-06
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    51   1e-05
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    51   1e-05
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    51   1e-05
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    51   1e-05
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    51   1e-05
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    51   1e-05
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    51   1e-05
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    51   1e-05
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    51   1e-05
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    51   1e-05
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    51   1e-05
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    50   1e-05
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    51   1e-05
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    51   1e-05
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    51   1e-05
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    50   1e-05
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    50   2e-05
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    50   2e-05
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    50   2e-05
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    50   2e-05
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    51   2e-05
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    50   2e-05
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    50   2e-05
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    50   2e-05
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    50   2e-05
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    50   2e-05
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    50   2e-05
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    50   2e-05
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    50   2e-05
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    50   2e-05
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    50   2e-05
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    50   3e-05
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    50   3e-05
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    50   3e-05
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    50   3e-05
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    50   3e-05
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    49   3e-05
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    49   3e-05
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    50   3e-05
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    49   3e-05
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    50   3e-05
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    50   3e-05
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    49   3e-05
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    49   4e-05
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    49   4e-05
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    50   4e-05
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    49   4e-05
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    49   4e-05
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    49   4e-05
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    49   5e-05
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    49   5e-05
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    49   5e-05
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    49   5e-05
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    48   5e-05
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     49   6e-05
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    49   6e-05
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    49   6e-05
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    48   6e-05
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    49   6e-05
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    49   6e-05
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    48   6e-05
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    48   6e-05
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    48   7e-05
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    48   7e-05
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    49   7e-05
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    48   7e-05
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    49   7e-05
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    49   8e-05
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    48   8e-05
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    48   8e-05
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    49   8e-05
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    48   9e-05
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    48   9e-05
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    48   9e-05
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    47   1e-04
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    48   1e-04
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    47   1e-04
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    48   1e-04
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    48   1e-04
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    48   1e-04
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    48   1e-04
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    47   1e-04
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    48   1e-04
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    48   1e-04
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    48   1e-04
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    48   1e-04
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    47   1e-04
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    48   1e-04
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    47   1e-04
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    47   1e-04
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    48   1e-04
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    47   1e-04
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    47   1e-04
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    48   1e-04
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    47   2e-04
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    47   2e-04
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    48   2e-04
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    47   2e-04
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    47   2e-04
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    47   2e-04
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    47   2e-04
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    47   2e-04
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    47   2e-04
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    47   2e-04
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    47   2e-04
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    47   2e-04
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    47   2e-04
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    47   2e-04
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    47   2e-04
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    47   2e-04
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    47   2e-04
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    47   2e-04
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    47   2e-04
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    47   2e-04
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    47   2e-04
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    47   2e-04
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    47   2e-04
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    47   2e-04
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    47   2e-04
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    47   2e-04
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    46   3e-04
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    47   3e-04
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    47   3e-04
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    46   3e-04
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    46   3e-04
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    45   3e-04
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    46   3e-04
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    47   3e-04
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    47   3e-04
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    46   3e-04
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    46   3e-04
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    46   3e-04
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    47   3e-04
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    46   3e-04
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    46   4e-04
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    46   4e-04
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    46   4e-04
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    46   4e-04
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    47   4e-04
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    46   4e-04
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    46   4e-04
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    46   4e-04
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    46   4e-04
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    45   4e-04
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    46   4e-04
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    46   4e-04
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    46   4e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    46   4e-04
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    46   5e-04
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    45   5e-04
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    46   5e-04
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    46   5e-04
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    46   5e-04
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    45   5e-04
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    46   5e-04
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    45   5e-04
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    45   5e-04
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    46   5e-04
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    46   5e-04
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    45   6e-04
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    45   6e-04
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    45   6e-04
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               45   6e-04
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    45   6e-04
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    45   7e-04
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    45   7e-04
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    45   7e-04
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    45   7e-04
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    45   8e-04
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    45   8e-04
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    45   8e-04
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    45   8e-04
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    45   8e-04
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    45   9e-04
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    45   9e-04
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    45   9e-04
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    45   9e-04
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    45   0.001
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    45   0.001
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    45   0.001
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    45   0.001
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    45   0.001
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    44   0.001
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    45   0.001
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    44   0.001
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    44   0.001
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    45   0.001
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    44   0.001
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    44   0.001
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    44   0.001
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    44   0.001
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    44   0.001
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    44   0.001
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    44   0.001
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    44   0.001
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    44   0.001
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    44   0.001
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    45   0.001
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    44   0.002
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    44   0.002
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    44   0.002
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    44   0.002
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    44   0.002
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    44   0.002
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    44   0.002
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    44   0.002
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    44   0.002
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    44   0.002
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    44   0.002
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    44   0.002
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    44   0.002
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    44   0.002
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    44   0.002
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    44   0.002
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    44   0.002
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    44   0.002
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    44   0.002
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    44   0.002
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    44   0.002
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    44   0.002
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    44   0.002
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    43   0.002
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    44   0.002
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    44   0.002
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    43   0.003
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    43   0.003
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    44   0.003
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    44   0.003
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    43   0.003
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    43   0.003
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    43   0.003
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    44   0.003
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    43   0.003
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    44   0.003
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    43   0.003
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    44   0.003
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    43   0.003
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    44   0.003
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    43   0.003
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    43   0.003
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    43   0.003
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    43   0.003
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    44   0.003
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    43   0.003
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    43   0.003
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    43   0.003
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    43   0.003
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    43   0.003
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    43   0.004
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    43   0.004
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    43   0.004
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    43   0.004
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    43   0.004
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    43   0.004
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    43   0.004
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    43   0.004
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    42   0.004
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    42   0.004
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    42   0.004
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    43   0.004
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    43   0.004
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    42   0.004
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    42   0.004
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    43   0.004
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    43   0.005
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    43   0.005
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    42   0.005
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    43   0.005
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    43   0.005
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    43   0.005
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    42   0.005
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    42   0.005
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    42   0.005
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    42   0.005
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    42   0.005
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    42   0.005
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    42   0.005
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    42   0.006
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    42   0.006
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    42   0.006
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    42   0.006
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    42   0.006
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    42   0.006
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    42   0.006
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    42   0.006
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    42   0.006
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    42   0.007
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    42   0.007
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    42   0.007
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    42   0.007
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    42   0.007
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    42   0.007
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    42   0.007
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    42   0.007
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    42   0.007
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    42   0.007
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    42   0.008
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    42   0.008
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    42   0.008
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    42   0.008
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    42   0.008
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      42   0.009
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    42   0.009
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    41   0.009
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    42   0.009
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    42   0.009
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    42   0.009
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    41   0.010
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    42   0.010
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    41   0.010
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    42   0.010
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    41   0.010
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    41   0.011
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    42   0.011
NCAS0H03450 Chr8 complement(653985..654968) [984 bp, 327 aa] {ON...    41   0.011
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    42   0.012
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    41   0.012
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    41   0.012
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    41   0.012
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    41   0.012
KLLA0F16038g Chr6 complement(1487475..1490063) [2589 bp, 862 aa]...    41   0.013
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    41   0.013
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    41   0.014
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    40   0.014
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    41   0.014
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    41   0.014
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    41   0.014
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    41   0.015
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    41   0.015
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    41   0.015
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    41   0.015
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    41   0.016
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    41   0.016
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    40   0.016
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    41   0.016
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    40   0.016
TBLA0E03320 Chr5 complement(831986..832945) [960 bp, 319 aa] {ON...    40   0.016
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    41   0.017
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    40   0.017
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    41   0.017
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    40   0.017
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    41   0.018
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    41   0.018
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    40   0.019
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    40   0.019
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    40   0.020
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    40   0.020
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    41   0.020
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    40   0.020
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    40   0.021
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    40   0.021
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    40   0.021
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    40   0.021
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    40   0.022
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    40   0.024
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    40   0.025
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    40   0.025
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    40   0.025
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    40   0.026
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    40   0.026
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    40   0.027
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    40   0.027
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    40   0.027
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    40   0.028
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    40   0.028
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    40   0.028
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    40   0.029
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    40   0.029
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    40   0.029
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    40   0.029
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    40   0.029
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    40   0.030
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    40   0.030
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    40   0.031
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    40   0.031
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    40   0.031
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    40   0.032
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    40   0.033
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    40   0.033
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    40   0.033
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    40   0.034
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    40   0.034
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    40   0.034
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    40   0.034
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    40   0.034
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    40   0.034
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    40   0.034
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    40   0.035
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    40   0.035
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    40   0.036
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    40   0.036
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    39   0.037
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    40   0.037
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    40   0.037
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    40   0.039
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    39   0.039
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    40   0.040
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    40   0.040
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    39   0.040
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    39   0.040
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    39   0.042
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    39   0.043
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     39   0.043
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    40   0.044
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    39   0.044
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    39   0.045
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    39   0.045
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    39   0.046
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    39   0.048
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    39   0.049
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    39   0.049
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    39   0.050
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    39   0.051
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    39   0.051
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    39   0.052
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    39   0.053
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    39   0.053
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    39   0.053
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    39   0.056
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    39   0.056
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    39   0.056
KLTH0H11000g Chr8 complement(943669..946260) [2592 bp, 863 aa] {...    39   0.056
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    39   0.056
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    39   0.056
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    39   0.058
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    39   0.059
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    39   0.059
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    39   0.060
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    39   0.061
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    39   0.061
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    39   0.069
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    39   0.070
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    39   0.076
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    38   0.076
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    39   0.076
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    39   0.077
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    39   0.077
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    38   0.078
KNAG0B00900 Chr2 (164610..165698) [1089 bp, 362 aa] {ON} Anc_3.4...    39   0.078
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    39   0.085
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    38   0.086
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    39   0.088
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    39   0.089
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    39   0.091
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    39   0.092
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    39   0.093
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    38   0.094
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    38   0.095
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    38   0.096
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    39   0.099
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    38   0.10 
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    38   0.10 
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    38   0.10 
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    38   0.10 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    38   0.11 
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    38   0.11 
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    39   0.11 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    38   0.11 
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    38   0.11 
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    38   0.11 
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    38   0.12 
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    38   0.12 
CAGL0H08217g Chr8 complement(806660..807637) [978 bp, 325 aa] {O...    38   0.12 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    38   0.12 
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    38   0.12 
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    38   0.12 
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    38   0.12 
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    38   0.13 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    38   0.13 
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    38   0.13 
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    38   0.14 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    38   0.14 
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    38   0.14 
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    38   0.14 
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    38   0.14 
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    38   0.15 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    38   0.15 
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    38   0.15 
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    38   0.15 
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    38   0.16 
Kpol_1050.56 s1050 (126134..127528,127531..127563,127565..128245...    38   0.16 
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    37   0.16 
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    37   0.17 
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    37   0.17 
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    38   0.17 
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    37   0.17 
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    37   0.17 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    38   0.17 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    37   0.17 
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    37   0.18 
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    37   0.18 
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    37   0.19 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    37   0.19 
NDAI0C00230 Chr3 (35404..36426) [1023 bp, 340 aa] {ON} Anc_2.657...    37   0.19 
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    37   0.19 
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    37   0.20 
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    37   0.20 
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    37   0.20 
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    37   0.20 
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    37   0.21 
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    37   0.21 
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    37   0.22 
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    37   0.22 
AER439W Chr5 (1476148..1476150,1476201..1477442) [1245 bp, 414 a...    37   0.22 
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    37   0.22 
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    37   0.23 
CAGL0M01430g Chr13 (164428..166683) [2256 bp, 751 aa] {ON} highl...    37   0.23 
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    37   0.23 
TDEL0B03950 Chr2 complement(709272..710306) [1035 bp, 344 aa] {O...    37   0.24 
KAFR0C02420 Chr3 (471045..472484) [1440 bp, 479 aa] {ON} Anc_1.3...    37   0.24 
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    37   0.24 
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    37   0.24 
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    37   0.25 
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             37   0.25 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    37   0.25 
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    37   0.25 
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    37   0.25 
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    37   0.26 
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    37   0.26 
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    37   0.26 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    37   0.27 
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    37   0.27 
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    37   0.27 
Ecym_5584 Chr5 complement(1199282..1200238) [957 bp, 318 aa] {ON...    37   0.28 
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    37   0.28 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    37   0.29 
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    37   0.29 
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    37   0.30 
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    37   0.32 
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    37   0.32 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    37   0.33 
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    37   0.33 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    37   0.33 
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    36   0.33 
KNAG0A07770 Chr1 complement(1234601..1237447) [2847 bp, 948 aa] ...    37   0.33 
KLTH0A05082g Chr1 complement(424327..425985) [1659 bp, 552 aa] {...    37   0.33 
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    37   0.33 
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    37   0.34 
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    36   0.34 
NDAI0G05990 Chr7 complement(1480864..1482261) [1398 bp, 465 aa] ...    37   0.35 
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    37   0.35 
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    36   0.36 
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    37   0.36 
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    37   0.36 
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    37   0.37 
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    37   0.37 
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    37   0.37 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    36   0.37 
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    37   0.38 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    37   0.39 
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    37   0.39 
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    37   0.39 
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    36   0.39 
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    36   0.39 
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    37   0.40 
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    36   0.40 
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    36   0.40 
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    36   0.42 
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    36   0.42 
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    36   0.42 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    37   0.42 
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    36   0.42 
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    36   0.44 
KNAG0E03050 Chr5 (611036..612922) [1887 bp, 628 aa] {ON} Anc_8.1...    36   0.46 
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    36   0.46 
NDAI0B04880 Chr2 complement(1193217..1195928) [2712 bp, 903 aa] ...    36   0.48 
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    36   0.48 
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    36   0.48 
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    36   0.48 
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    36   0.49 
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    36   0.49 
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    36   0.52 
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    36   0.52 
CAGL0L09647g Chr12 (1034737..1036026) [1290 bp, 429 aa] {ON} hig...    36   0.53 
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    36   0.53 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    36   0.54 
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    36   0.54 
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    36   0.54 
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    35   0.56 
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    36   0.57 
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    36   0.57 
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    36   0.57 
NDAI0G02390 Chr7 complement(547355..550252) [2898 bp, 965 aa] {O...    36   0.57 
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    35   0.59 
Skud_15.66 Chr15 complement(114566..117898) [3333 bp, 1110 aa] {...    36   0.59 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    36   0.59 
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    36   0.60 
ZYRO0G09372g Chr7 (747001..749052) [2052 bp, 683 aa] {ON} simila...    36   0.61 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    36   0.61 
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    35   0.64 
CAGL0J11286g Chr10 (1097912..1099498) [1587 bp, 528 aa] {ON} sim...    35   0.64 
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    35   0.65 
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    36   0.66 
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    36   0.66 
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    35   0.66 
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    35   0.67 
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    35   0.68 
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    36   0.68 
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    35   0.71 
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    35   0.73 
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    35   0.74 
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    35   0.76 
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    35   0.77 
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    35   0.78 
TBLA0D04920 Chr4 complement(1202907..1204853) [1947 bp, 648 aa] ...    35   0.78 
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    35   0.78 
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    35   0.79 
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    35   0.79 
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    35   0.80 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    35   0.81 
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    35   0.81 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   0.82 
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    35   0.83 
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    35   0.83 
KNAG0B02990 Chr2 (577427..579097) [1671 bp, 556 aa] {ON} Anc_7.2...    35   0.85 
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    35   0.86 
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    35   0.87 
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    35   0.88 
TDEL0F03510 Chr6 complement(647165..648505) [1341 bp, 446 aa] {O...    35   0.90 
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    35   0.91 
Kpol_1072.46 s1072 (103226..105850) [2625 bp, 874 aa] {ON} (1032...    35   0.91 
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    35   0.91 
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    35   0.92 
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    35   0.92 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    35   0.93 
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    35   0.94 
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    35   0.94 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    35   0.96 
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    35   0.98 
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    35   1.0  
KNAG0H00450 Chr8 (70320..72755) [2436 bp, 811 aa] {ON} Anc_2.613...    35   1.0  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    35   1.0  
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    35   1.0  
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    35   1.0  
KLTH0D10054g Chr4 complement(835206..837818) [2613 bp, 870 aa] {...    35   1.0  
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    35   1.1  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    35   1.1  
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    35   1.1  
KLLA0E13553g Chr5 complement(1195444..1197186) [1743 bp, 580 aa]...    35   1.1  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    35   1.1  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    35   1.2  
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    35   1.2  
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    35   1.2  
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    34   1.3  
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    35   1.3  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    35   1.3  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    35   1.3  
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    35   1.3  
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    35   1.4  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    35   1.4  
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    34   1.4  
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    34   1.4  
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    34   1.5  
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    34   1.5  
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    34   1.5  
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    35   1.5  
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    34   1.5  
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    34   1.7  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    34   1.9  
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    34   1.9  
KAFR0C04445 Chr3 (882595..884274) [1680 bp, 559 aa] {ON}               34   1.9  
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    34   1.9  
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    34   1.9  
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    34   2.0  
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    34   2.0  
NCAS0B07540 Chr2 complement(1422115..1424745) [2631 bp, 876 aa] ...    34   2.0  
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    34   2.0  
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    34   2.1  
KAFR0H02680 Chr8 (507660..510239) [2580 bp, 859 aa] {ON} Anc_8.6...    34   2.2  
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    34   2.2  
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    34   2.3  
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    33   2.3  
KLLA0A07106g Chr1 complement(640536..641468) [933 bp, 310 aa] {O...    33   2.3  
YNL253W Chr14 (170018..171286) [1269 bp, 422 aa] {ON}  TEX1Prote...    34   2.3  
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    34   2.3  
Ecym_2240 Chr2 (470406..473900) [3495 bp, 1164 aa] {ON} similar ...    34   2.3  
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    33   2.4  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    34   2.4  
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    33   2.4  
Kpol_1008.20 s1008 (39393..41141) [1749 bp, 582 aa] {ON} (39393....    34   2.4  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    34   2.4  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    34   2.4  
NCAS0A08960 Chr1 (1774232..1775620) [1389 bp, 462 aa] {ON} Anc_1...    33   2.5  
Kwal_23.4327 s23 (670568..675208) [4641 bp, 1546 aa] {ON} YHR186...    34   2.5  
SAKL0A05962g Chr1 complement(543144..544184) [1041 bp, 346 aa] {...    33   2.6  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    34   2.6  
AFR634W Chr6 (1594214..1595686) [1473 bp, 490 aa] {ON} Syntenic ...    33   2.6  
Skud_2.412 Chr2 complement(733900..736536) [2637 bp, 878 aa] {ON...    34   2.7  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    34   2.7  
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    34   2.8  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   2.8  
KNAG0K00850 Chr11 complement(159329..162832) [3504 bp, 1167 aa] ...    34   2.8  
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    33   2.9  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    33   2.9  
KLTH0E03872g Chr5 (353271..355511) [2241 bp, 746 aa] {ON} simila...    33   2.9  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    33   3.0  
NCAS0D00540 Chr4 complement(85322..86953) [1632 bp, 543 aa] {ON}...    33   3.0  
SAKL0H07832g Chr8 (669398..671995) [2598 bp, 865 aa] {ON} simila...    33   3.2  
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    33   3.2  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    33   3.3  
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    33   3.3  
KNAG0C01680 Chr3 (335056..337689) [2634 bp, 877 aa] {ON} Anc_1.3...    33   3.3  
TDEL0D01740 Chr4 (346288..348957) [2670 bp, 889 aa] {ON} Anc_1.3...    33   3.4  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    33   3.5  
Suva_16.463 Chr16 (801619..804411) [2793 bp, 930 aa] {ON} YPR135...    33   3.6  
Smik_6.325 Chr6 complement(511278..513968) [2691 bp, 896 aa] {ON...    33   3.6  
KLTH0H12870g Chr8 (1098531..1100117) [1587 bp, 528 aa] {ON} simi...    33   3.8  
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    33   3.8  
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    33   3.8  
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    33   4.0  
KLLA0C12771g Chr3 (1081988..1085017) [3030 bp, 1009 aa] {ON} sim...    33   4.1  
Suva_16.415 Chr16 complement(715808..717157) [1350 bp, 449 aa] {...    33   4.1  
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    33   4.2  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    33   4.4  
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    33   4.5  
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    33   4.5  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    33   4.5  
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    33   4.6  
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    33   4.6  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    33   4.6  
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    32   4.7  
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    33   4.7  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    32   4.7  
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    33   4.8  
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    33   4.9  
TBLA0D04560 Chr4 (1130244..1131584) [1341 bp, 446 aa] {ON} Anc_7...    33   5.3  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    33   5.3  
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    33   5.3  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    33   5.3  
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    33   5.3  
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    33   5.4  
ACL034W Chr3 (302396..304048) [1653 bp, 550 aa] {ON} Syntenic ho...    33   5.4  
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    32   5.5  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    33   5.5  
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    32   5.5  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    32   5.6  
TBLA0E03460 Chr5 (859536..863192) [3657 bp, 1218 aa] {ON} Anc_3....    33   5.8  
KAFR0G00260 Chr7 complement(84327..90686) [6360 bp, 2119 aa] {ON...    33   6.0  
KLLA0F06754g Chr6 complement(650475..651509) [1035 bp, 344 aa] {...    32   6.0  
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    32   6.0  
TBLA0B04120 Chr2 (941318..943987) [2670 bp, 889 aa] {ON} Anc_8.6...    33   6.1  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    33   6.1  
CAGL0M02805g Chr13 (317204..319822) [2619 bp, 872 aa] {ON} simil...    33   6.1  
NDAI0B02760 Chr2 complement(694100..697327) [3228 bp, 1075 aa] {...    33   6.1  
Ecym_6179 Chr6 complement(330143..333823) [3681 bp, 1226 aa] {ON...    33   6.2  
NDAI0D02490 Chr4 (575553..577499) [1947 bp, 648 aa] {ON} Anc_5.104     32   6.3  
YOL087C Chr15 complement(155287..158637) [3351 bp, 1116 aa] {ON}...    32   6.5  
KNAG0A07390 Chr1 complement(1156310..1157542) [1233 bp, 410 aa] ...    32   6.6  
AFR620W Chr6 (1553963..1560286) [6324 bp, 2107 aa] {ON} Syntenic...    33   6.7  
Kwal_0.356 s0 (169040..170620) [1581 bp, 526 aa] {ON} YFR021W (A...    32   6.8  
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    32   6.9  
ZYRO0G00946g Chr7 complement(72544..74184) [1641 bp, 546 aa] {ON...    32   7.0  
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    32   7.0  
SAKL0H01628g Chr8 (168606..173270) [4665 bp, 1554 aa] {ON} simil...    32   7.3  
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    32   7.3  
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    32   7.7  
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    32   7.8  
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    32   7.9  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    32   7.9  
TPHA0N01070 Chr14 complement(224464..225525) [1062 bp, 353 aa] {...    32   8.0  
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    32   8.3  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    32   8.3  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   8.3  
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    32   8.3  
Skud_16.426 Chr16 (758551..761340) [2790 bp, 929 aa] {ON} YPR135...    32   8.4  
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    32   9.0  
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    32   9.1  
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    32   9.1  
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    32   9.3  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    32   9.3  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    32   9.3  
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    32   9.4  
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    32   9.9  
TBLA0B08220 Chr2 complement(1962086..1963405) [1320 bp, 439 aa] ...    32   10.0 

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1897 bits (4915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 925/941 (98%), Positives = 925/941 (98%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT 60
           MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT 60

Query: 61  DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI 120
           DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI
Sbjct: 61  DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI 120

Query: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDG 180
           TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDG
Sbjct: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDG 180

Query: 181 LIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEK 240
           LIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEK
Sbjct: 181 LIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEK 240

Query: 241 GIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDK 300
           GIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDK
Sbjct: 241 GIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDK 300

Query: 301 GMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYS 360
           GMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYS
Sbjct: 301 GMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYS 360

Query: 361 IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIR 420
           IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIR
Sbjct: 361 IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIR 420

Query: 421 TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480
           TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK
Sbjct: 421 TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540
           RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL
Sbjct: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540

Query: 541 AVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600
           AVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD
Sbjct: 541 AVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600

Query: 601 CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS 660
           CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS
Sbjct: 601 CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS 660

Query: 661 NDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQRDI 720
           NDARFVVSTSHDHSIRVW                MDEQYENTLLHSLEAGSGDDNFQRDI
Sbjct: 661 NDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDDNFQRDI 720

Query: 721 EGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKSG 780
           EGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKSG
Sbjct: 721 EGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKSG 780

Query: 781 EPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKD 840
           EPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKD
Sbjct: 781 EPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKD 840

Query: 841 KKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNV 900
           KKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNV
Sbjct: 841 KKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNV 900

Query: 901 QGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           QGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV
Sbjct: 901 QGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1468 bits (3800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/958 (73%), Positives = 826/958 (86%), Gaps = 19/958 (1%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRN--RGSAGQILTGALENVNCWDIKTGELSKI 58
           MVKSYQRFEQ S FGVISSN+NCVW+ S +  +   GQI+TGALENVN WD+KTGEL+  
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTSSKKSHPGQIITGALENVNIWDLKTGELASF 87

Query: 59  LTDGL--PPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116
           L DGL  PPG+VDAKS+K AE+T+LQ+H ETNLLAVGY DGV+K+WDL SKTVL N NGH
Sbjct: 88  LNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLNGH 147

Query: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWC--------- 167
            SAIT L+FD +GTRLISGS+DS+II+WDLV EVGLYKLRSHKD+ITGIWC         
Sbjct: 148 SSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQE 207

Query: 168 ENE-DWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWN 226
           ENE DWLISTSKDGLIKIWDLK QQCVETH+AHT ECW LA+ NDLVITTS++SQ+K W 
Sbjct: 208 ENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQ 267

Query: 227 LDLDKDM---GSKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQ 283
           L L  D    GSKLIEKGIYEKQSKQRG++VEFI + DGV FF IQNAD+TVEIFR+R +
Sbjct: 268 LSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFIDSIDGVGFFLIQNADRTVEIFRLRKE 327

Query: 284 EEISKALRKREKRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTS 343
           EEISKAL+KREKRL +KGM  ++I+++++DS+VS++MHPFQ IRS +K+KAATW + T++
Sbjct: 328 EEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIATST 387

Query: 344 KLEMVLTTSNNTVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATA 403
           KLE+ +TT+NNT+EYYSIPY+KREPT+P  NKLY +ELQG RTD+RSIDISDDNKLLATA
Sbjct: 388 KLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLLATA 447

Query: 404 SNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKE 463
           SNG+LKIWN+KT  CIRTFECGYALTCKFLPGG LV++G R G+LQLFDLASST + N E
Sbjct: 448 SNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIANIE 507

Query: 464 DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLE 523
           +AH AAIWSLDLTSDGKRL+TGSADK+VKFW+F+++QEL+PGT DKFVPKL + HDTTLE
Sbjct: 508 EAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLE 567

Query: 524 LNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLI 583
           L+DDIL+V++S ++KFLAVSLLDNTVKVFFL+SMKFFLSLYGHKLPVLSIDISFDSK++I
Sbjct: 568 LSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMII 627

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFEC 643
           TSSADKNIKIWGLDFGDCHKSLFAHQDSIM+VKFVPESHNFFSCSKDG++KYWDGDKFEC
Sbjct: 628 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFEC 687

Query: 644 VQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTL 703
           +QKLAAHQSEVWALAI+NDA FVVS+SHDHSIR+W                M+EQYE+TL
Sbjct: 688 IQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYEDTL 747

Query: 704 LHSLEAGSGDDNFQRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEE 763
           L SLE G+GDD F+ D +G   + E  D+ATDVHKQT+ESLKAGER++EA DLG+A IE 
Sbjct: 748 LASLEEGNGDDAFKGDTKG-ATNVEF-DEATDVHKQTMESLKAGERLMEAFDLGMAEIES 805

Query: 764 NETYEKNLKDWQKKKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLP 823
            E Y+KNLK WQ+KK+GEPP KPQ NAIL+A+KK PE+YIM+TL++I+PSQLEDALLVLP
Sbjct: 806 FEEYDKNLKLWQRKKTGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVLP 865

Query: 824 FSYVLSFLKFIDVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQ 883
           FSYVL FLKFI++VI +KKM NNHL LICK LFFI+KSN++ELV+QKNE LKLQI +VK 
Sbjct: 866 FSYVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVKN 925

Query: 884 ELRTALKGNADDLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           ELR ALK N DDLGFN+QG+KFI+QQWNLRHNLEFVD+YDQ+  E+K  KKR F TLV
Sbjct: 926 ELRNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTLV 983

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1460 bits (3779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/947 (72%), Positives = 821/947 (86%), Gaps = 10/947 (1%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNR---GSA-GQILTGALENVNCWDIKTGELS 56
           MVKSYQRFEQ +AFGVI+SN NCVWI + +R   GS  GQ++T ALENVN WDIKTG+L 
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60

Query: 57  KILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116
             L+DGLPPGA DAK +K AE TYL+ H +TNLLAVGYADGVIK+WDL+SKTVL+NFNGH
Sbjct: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120

Query: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST 176
           K+AIT+++FD TGTRLISGSKDS+II+WDLVGEVGLYKLRSHKD+ITG WC+ EDWL+ST
Sbjct: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180

Query: 177 SKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKD-MGS 235
           SKDGLIKIWDLKTQQC+ETH+AHT ECWGLA+ +DL+ITTST+SQ+KIW L+++ + MG 
Sbjct: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240

Query: 236 KLIEKGIYEKQSKQRGVSVEFIT-TSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKRE 294
           KL E GI+EKQSKQRG+ +EFIT  SDGV+FFYIQNADKT+E +R+R +EEI++ L+KRE
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKRE 300

Query: 295 KRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNN 354
           KRLR+KG+ DE+I ++IKDSY S+I+HPFQT+RS +KIK+A+W   T+SKLE+V+TTSNN
Sbjct: 301 KRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360

Query: 355 TVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIK 414
           T+EYYSIPY+KR+PT PAP K +TIELQG RTDVRSID+SDDNKLLATASNG+LKIWN+K
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420

Query: 415 THACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLD 474
           TH CIRTFECGYALTCKFLPGG LV++G R G+LQLFDLASS+LL+  EDAH AAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LTSDGKRLVTGSADKTVKFWDF+V++ L+PGT DKFVP LK+ HDTTLELNDDIL+V+IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594
            D+++LA+SLLDNTVKVFFL+SMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 595 GLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654
           GLDFGDCHKSLFAHQDSIMSVKF+PESHNFFSCSKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 655 WALAISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDD 714
           WALAIS D  FVVS+SHDHSIR+W                ++EQYE+TLL SLE G+GDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 715 NFQRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDW 774
            F+ D  G      + D+A+ VHKQT+ESLKAGE+++EALDLGIA IE  E Y K++K W
Sbjct: 721 AFKGDATGEN----VEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLW 776

Query: 775 QKKKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFI 834
           Q+KK GE P KPQ N++L+A+KK PEQYIM+TL +IR SQLEDAL+V+PFSYVL FLKF 
Sbjct: 777 QRKKLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFT 836

Query: 835 DVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNAD 894
           D V+++K + +NHL LICK LFFIIK N++EL++QKNEELKLQINRVK ELR ALK   D
Sbjct: 837 DAVMQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTED 896

Query: 895 DLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           DLGFNVQGLKFIRQQWNL+HN EFVD+YDQ+++E  + +KR+FE ++
Sbjct: 897 DLGFNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1451 bits (3756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/941 (72%), Positives = 804/941 (85%), Gaps = 4/941 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT 60
           MVKSYQRFEQ S  GVISSN+NC+WI +  R ++GQ+LTGALENVNCW +K+G+L   L+
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAETRNASGQVLTGALENVNCWSMKSGDLLSTLS 60

Query: 61  DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI 120
           DGLPPGAVDAKS+K AE+T+LQYHPET LLA GY DGV+KIWDL+SK+VLINFNGHKSAI
Sbjct: 61  DGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGHKSAI 120

Query: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDG 180
           TVL+FD TGTRLISGSKDSDII+WDLVGEVGL+KLRSHKDSITG+WCE EDWL+STSKDG
Sbjct: 121 TVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVSTSKDG 180

Query: 181 LIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEK 240
           LIK+WDLKTQQCVETH+AH  ECW + +H DLV+T   ++QIK+W++D +K +GS L E+
Sbjct: 181 LIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEKPVGSMLTER 240

Query: 241 GIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDK 300
           G +EKQSKQRGVSVEF T SDGV FF++QNAD+TVE FR+RT++EISKAL+KREKRL DK
Sbjct: 241 GTHEKQSKQRGVSVEFTTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKREKRLSDK 300

Query: 301 GMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYS 360
           G+  E+IQ N+K+SY S IMHPFQ +RSP+KIK+A WAVTTTSKLE+V++TSNNTV+YYS
Sbjct: 301 GLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNNTVDYYS 360

Query: 361 IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIR 420
           IPY K+EP  P+P K+Y+I+++GHRTDVR+IDISDDNKLLATASNG+LKIWNIKT +CIR
Sbjct: 361 IPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTKSCIR 420

Query: 421 TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480
           TFECGYAL CKFLPGGALVV+G + GDL LFDLASSTLL + E AH  AIWSLDLT+DGK
Sbjct: 421 TFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTADGK 480

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540
           RLVTGSADK+V+FWDF+V+QEL+PGT DKFVPKLK+FHDTTLELNDD+LAVKIS DN+ L
Sbjct: 481 RLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNRLL 540

Query: 541 AVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600
           A+SLLDNTVKVFFL+SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIK+WGLDFGD
Sbjct: 541 AISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDFGD 600

Query: 601 CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS 660
           CHKSLFAH DSIM V F+PESHNFFSC KDGLVKYWDGDKFEC+QKLAAHQ EVW +AIS
Sbjct: 601 CHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTIAIS 660

Query: 661 NDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQRDI 720
           +D  FVVS SHD SIRVW                MDEQYE TLL+SLE G+GD  F  D 
Sbjct: 661 HDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDAMFHGDG 720

Query: 721 EGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKSG 780
            G     EI D+ATDVHKQT ESLKA ER++EA+D+G+A I  +  YE+ LK+WQKKKSG
Sbjct: 721 NG---GAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKKKSG 777

Query: 781 EPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKD 840
             P +PQ N+IL+A+ K P +YIM+ L +I+PSQLEDALLVLPFSYVL FL FI++VI+D
Sbjct: 778 PHPGRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELVIED 837

Query: 841 KKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNV 900
           K +   HL L+CK LFFIIK+N+REL +QKNE+LK+QI+R+K  LR ++K  ADDLGFN+
Sbjct: 838 KSLVRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLGFNI 897

Query: 901 QGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           QGLKFI+QQWNL+HN EF DD    KQ++K VKKR+FET+V
Sbjct: 898 QGLKFIKQQWNLKHNFEFSDDVIISKQDKK-VKKRVFETVV 937

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1443 bits (3736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/964 (72%), Positives = 813/964 (84%), Gaps = 29/964 (3%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSA--GQILTGALENVNCWDIKTGELSKI 58
           MVKSYQRFEQ S FGVI+SN+NC+W+ S +  S   GQI+T ALEN+N WDIKTGELS  
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWLPSDSNPSTSPGQIITSALENINIWDIKTGELSSH 60

Query: 59  LTDGL--PPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116
           L D L  PPG++DAKSTK AE+TYLQ+H +TNLLAVGY DGVIK+WDL SKTVL N NGH
Sbjct: 61  LIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLNGH 120

Query: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWC--------- 167
            SAITVL+FD TGTRLISGS+DS+II+WDLV EVGLYKLRSHKD+ITGIWC         
Sbjct: 121 SSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNGED 180

Query: 168 -ENE-DWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIW 225
            ENE DWLISTSKDGLIKIWDLK QQC+ETH+AHT ECW +A+ NDL+ITTS++SQIKIW
Sbjct: 181 DENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIKIW 240

Query: 226 NLDLDKD---MGSKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRT 282
            L+LD D      KLIEKGIYEKQSKQRG+S+EFI T+D   FFYIQNADKTVEIFR+R 
Sbjct: 241 ELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFIDTADETGFFYIQNADKTVEIFRLRK 300

Query: 283 QEEISKALRKREKRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTT 342
           Q+EI+KA++KR KRL +KGM  E I+QNIKDSY+S+IMHPFQ +RS +KIKA TW + T 
Sbjct: 301 QDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTIATP 360

Query: 343 SKLEMVLTTSNNTVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLAT 402
           SKLE+ LTTSNNT+EYYS PY+KREPT+P PNKL+TIELQG RTD+RSIDISDDNKLLAT
Sbjct: 361 SKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKLLAT 420

Query: 403 ASNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENK 462
           ASNG LKIWNIKT +CIRTFECGY+LTCKFLPGG LV+VG RGG+LQLFDLASSTLLE  
Sbjct: 421 ASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLLETI 480

Query: 463 EDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTL 522
           EDAH AAIWSLDLTSDGKRLVTGSADK+VKFWDF+++QEL+ GTVDK++PKLK+FHDTTL
Sbjct: 481 EDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHDTTL 540

Query: 523 ELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLL 582
           ELNDDIL+VKIS ++KFLAVSLLDNTVKVFF+++MKFFLSLYGHKLPVLSIDISFDSKL+
Sbjct: 541 ELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDSKLI 600

Query: 583 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFE 642
           ITSSADKNIKIWGLDFGDCHKSLFAHQDSIM+VKFVPESHNFFSCSKDGL+KYWDGDKFE
Sbjct: 601 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGDKFE 660

Query: 643 CVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENT 702
           C+QKLA HQSEVW++AI+NDA F+VS+SHDHSIR+W                ++E YE+T
Sbjct: 661 CIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELYEDT 720

Query: 703 LLHSLEAGSGDDNFQRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIE 762
           LL SLE  +GDD F++D       GE  D+ATDVHKQT+ESLKA ER++EA DLG+  IE
Sbjct: 721 LLTSLEEDNGDDAFKKD------GGEDKDEATDVHKQTMESLKASERLMEAFDLGMKEIE 774

Query: 763 ENETYEKNLKDWQKKKSGEP-----PSKPQENAILVALKKAPEQYIMETLVKIRPSQLED 817
             E YE+ LK+WQ+K S        P KPQ NAIL+A+KK PE+YIM+TLV+I+PSQLED
Sbjct: 775 AMEEYERELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLED 834

Query: 818 ALLVLPFSYVLSFLKFIDVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQ 877
           ALLVLPFSY++ FLKFID+VI  KK+ NNHL LIC++LFFI+KSN++ELV+QKNEELK Q
Sbjct: 835 ALLVLPFSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQ 894

Query: 878 INRVKQELRTALKGNADDLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIF 937
           I RVK  LR ALK N DDLGFN+QGLKFI+QQW L+HN E+VDD DQ+ QE K  KKR F
Sbjct: 895 ITRVKDNLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTF 954

Query: 938 ETLV 941
            T++
Sbjct: 955 GTII 958

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1441 bits (3730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/941 (72%), Positives = 798/941 (84%), Gaps = 4/941 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT 60
           MVKSYQRFEQ S FGVISSN+NC+W+ + NR S GQ+LTGALENVNCW +K+GEL   LT
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWLPAENRNSTGQVLTGALENVNCWSMKSGELIGTLT 60

Query: 61  DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI 120
           DGLPPGAVDAKSTK AE++YLQYHPET LLAVGY DG IKIWDL+SK+VLI+FNGHKSAI
Sbjct: 61  DGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAI 120

Query: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDG 180
           T+L FD TGTRLISGS+DSDII+WDLVGEVGLYKLRSHKDSITG+WCE E+WLISTSKDG
Sbjct: 121 TILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSKDG 180

Query: 181 LIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEK 240
           LIK+WDLK QQCVETH+AH  ECW + +H DLVIT   ++QIK+WNL+ ++  GS LIEK
Sbjct: 181 LIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSMLIEK 240

Query: 241 GIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDK 300
           G +EKQS+QRGV+++F T SD   FF+IQNAD++VE FR+R Q+EI+KAL+KREKRL +K
Sbjct: 241 GTHEKQSRQRGVAIQFTTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKREKRLTEK 300

Query: 301 GMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYS 360
           G+++++IQQN+KDS+ S IMHPFQ +RS +K+++  WA TTTSKL++V+TT+NNTV+YYS
Sbjct: 301 GLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTVDYYS 360

Query: 361 IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIR 420
           I YQKREPT P+P KL++I+++GHR+DVR+IDIS DNKLLATASNGTLKIWNIKT++CIR
Sbjct: 361 IKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIR 420

Query: 421 TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480
           TFECGYAL CKFLPGGALVV+G + GDL L+DLASSTLL   E AH  AIWSLD+T+DGK
Sbjct: 421 TFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGK 480

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540
           RLVTGSADKTV FWDF+V+QE +PGT DKF PKLK+FHDTTLELNDD+LAVKIS DN+ L
Sbjct: 481 RLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLL 540

Query: 541 AVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600
           AVSLLDNTVKVFF++SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD
Sbjct: 541 AVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600

Query: 601 CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS 660
           CH+SLFAH DSIM V FVPESHNFFSCSKD LVKYWDGDKFEC+QKLAAHQ EVW LAIS
Sbjct: 601 CHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAIS 660

Query: 661 NDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQRDI 720
           +D RFVVS SHD SIRVW                 DEQYE TLL+SLE G+GDD F++D 
Sbjct: 661 SDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMFEKDG 720

Query: 721 EGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKSG 780
            G   DGEITDQATDVHKQT ESLKA E+++EALDLG++ I     YEK LK W+KK+SG
Sbjct: 721 NG---DGEITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKKRSG 777

Query: 781 EPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKD 840
             P KP  N+ILVA+ K P +YIM+ LVKI+PSQLEDALLVLPF+YVL+FL FID+V+K+
Sbjct: 778 PHPGKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLVLKE 837

Query: 841 KKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNV 900
           K++    L LIC+ LFFIIKSN+REL +QKNEELK+Q+NR+K  LR ++K  +DDLGFN+
Sbjct: 838 KELARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLGFNI 897

Query: 901 QGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           QGL FI+QQWN++HN EF DD    K  EK  KKR+FETLV
Sbjct: 898 QGLTFIKQQWNMKHNFEFSDDITVNKTNEK-AKKRVFETLV 937

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1437 bits (3721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/947 (71%), Positives = 816/947 (86%), Gaps = 10/947 (1%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNR---GSA-GQILTGALENVNCWDIKTGELS 56
           MVKSYQRFEQ ++FGVI+SN NCVW+ + +R   GS  GQ++T ALENVN WDIKTG+L 
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60

Query: 57  KILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116
             L+DGLPPGA DA+  K AE TYL+ H +T+LLAVGYADGVIK+WDL+SKTVL+NFNGH
Sbjct: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST 176
           K+AIT+L+FD TGTRLISGSKDS+II+WDLVGEVGLYKLRSHKDSITG WC+ EDWLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 177 SKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKD-MGS 235
           SKDG+IK+WDLKTQQC+ETH+AHT ECWGL++ +DL+ITT T+SQ+K+W L+++ D +G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240

Query: 236 KLIEKGIYEKQSKQRGVSVEFIT-TSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKRE 294
           KL E G +EKQSKQRG+ +EFIT TSDG +FFYIQNADKT+EIFR+R +EEI++ L+KRE
Sbjct: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKRE 300

Query: 295 KRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNN 354
           KRLR+KG+ DE+I ++IKDSY S+I+HPFQT+RS +KIK+A+W   T+SKLE+VLTTSNN
Sbjct: 301 KRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360

Query: 355 TVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIK 414
           T+EYYSIPY+KREPT PAP K +TIELQG RTD+RSIDISDDN+LLATASNG+LKIWN+K
Sbjct: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420

Query: 415 THACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLD 474
           TH CIRTFECGYALTCKFLPGG LV++G R G+LQLFDLASS+LL+  EDAH AAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LTSDGKRLVTGSADKTVKFWDF+V+  L+PGT DKF+P LK+ HDTTLELNDDIL+++IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594
            D+++LA+SLLDNTVKVFFL+SMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 595 GLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654
           GLDFGDCHKSLFAHQDSIMSVKF+PESHNFFSCSKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 655 WALAISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDD 714
           WALAIS D  FVVS+SHDHSIR+W                ++EQYE+TLL SLE G+GDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 715 NFQRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDW 774
            F+ D  G   D    D+ + VHKQT+ESLKAGER++EALDLGIA IE  E Y +++K W
Sbjct: 721 AFKGDATGESVD----DEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLW 776

Query: 775 QKKKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFI 834
           Q+KK GE P KPQ N++L+A+ K PEQYIM+TL++IR SQLEDAL+V+PFSYVL FLKFI
Sbjct: 777 QRKKLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFI 836

Query: 835 DVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNAD 894
           D ++++K + ++HL LICK LFFIIK N++ELV+QKNEELK Q++RVK ELR ALK   D
Sbjct: 837 DSIMQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTED 896

Query: 895 DLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           DLGFNVQGLKFI+QQWNLRHN EFVD+YDQ+++E    +KR FET+V
Sbjct: 897 DLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1434 bits (3712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/947 (71%), Positives = 820/947 (86%), Gaps = 10/947 (1%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWI--ASR-NRGSA-GQILTGALENVNCWDIKTGELS 56
           MVKSYQRFEQ + FGVI+SN NCVW+  +SR N+GS  GQ++T ALENVN WDIKTG+L 
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60

Query: 57  KILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116
             L+DGLPPGA DA+ +K AE TYL+ H +T+LLAVGYADGVIK+WDL+SKTVL+NFNGH
Sbjct: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST 176
           K+AIT+L+FD TGTRLISGS+DS+II+WDLVGEVGLYKLRSHKD ITGIWC+ EDWLIST
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180

Query: 177 SKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKD-MGS 235
           SKDG+IK+WDLKTQQC+ETH+AHT ECW L++ +DL+ITT T+SQ+KIW L+++ D MG 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240

Query: 236 KLIEKGIYEKQSKQRGVSVEFIT-TSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKRE 294
           KL E G++EKQSKQRG+ VEFIT  SDGV+FFYIQNADKT+E FR+R +EEI++ L+KRE
Sbjct: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 295 KRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNN 354
           KRLR+KG+ DE+I ++IK SY S+++HPFQTIRS +K+K+A+W   T+SKLE+VLTTSNN
Sbjct: 301 KRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360

Query: 355 TVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIK 414
           T+EYYSIPY+KRE T PAP K +TIELQG RTDVRSIDISDDNKLLATASNG+LKIWN+K
Sbjct: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420

Query: 415 THACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLD 474
           TH CIRTFECGYAL+CKFLPGG LV++G R G+LQLFDLASS+LL+  EDAH AAIWSLD
Sbjct: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LTSDGKRLVTGSADKTVKFWDF+V+  L+PGT DK +P LK+ HDTTLELNDDIL+V+IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594
            D+++LA+SLLDNTVKVFFL+SMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 595 GLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654
           GLDFGDCHKSLFAHQDSIMSVKF+PESHNFFSCSKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 655 WALAISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDD 714
           WALAI+++  FVVS+SHDHSIR+W                ++EQYE+TLL SLE G+ DD
Sbjct: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADD 720

Query: 715 NFQRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDW 774
            F+ D    GED E  D+A+ VHKQT+ESLKAGER++EALD+GIA IE  ETY K+++ W
Sbjct: 721 AFKGD--AAGEDVE--DEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELW 776

Query: 775 QKKKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFI 834
           Q+KK GE P KPQ N++L+A+ K PEQYI++TL +IR SQLEDAL+V+PFSYVL FLKFI
Sbjct: 777 QRKKLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFI 836

Query: 835 DVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNAD 894
           D V+++K + ++HL L+C+ LFFIIK N++ELV+QKNEELKLQINRVK ELR ALK   D
Sbjct: 837 DTVMQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTED 896

Query: 895 DLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           DLGFNVQGLKFI+QQWNLRHN EFVD+YDQ+++E  + +KR+FET++
Sbjct: 897 DLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1424 bits (3685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/941 (70%), Positives = 800/941 (85%), Gaps = 3/941 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT 60
           MVKSYQRFEQ ++FGVISSN+NCV+I   NR   GQ+LTG LE VN WD+KTG+L   L+
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPPANRKGLGQVLTGGLEKVNLWDLKTGDLVSCLS 60

Query: 61  DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI 120
           DGLPPG++DAKSTK AE+TYL+YH ETNLLAVGYA+GVIK+WDL+SKTVL+  NGHKSA+
Sbjct: 61  DGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGHKSAV 120

Query: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDG 180
           T+L+FD TGTRLISGS+DS+II+WDL+GEVGLYKLRSHK +I+G+W E ++WLISTS+DG
Sbjct: 121 TILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLISTSRDG 180

Query: 181 LIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEK 240
           LIK+WDLKTQQCVETH+AHT ECW L +H DL IT S +SQ+KIW+L+ + + GSKLIEK
Sbjct: 181 LIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEAGSKLIEK 240

Query: 241 GIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDK 300
           GIYEKQS QRG S+EF+TT+D   FFYIQNADK++EIFR+R +EEI KA RKREKRL++K
Sbjct: 241 GIYEKQSNQRGSSIEFVTTTDETTFFYIQNADKSIEIFRIRKEEEILKATRKREKRLKEK 300

Query: 301 GMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYS 360
           G++DE+I+QNI+D Y+S+IMHPFQ +RS FK+KAA W   T SKL++V+TT++NTVEYY+
Sbjct: 301 GLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASNTVEYYT 360

Query: 361 IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIR 420
           IPY+KREP  PAPN+L+++ELQGHRTDVR++DIS+D+ LLATASNGTLK+WN+KT  C+R
Sbjct: 361 IPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTRMCLR 420

Query: 421 TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480
           TF+CGYAL C+FLPGG L+VVG R GDLQLFDLASST+L+NKE AH AAIWSLD+TSDGK
Sbjct: 421 TFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDITSDGK 480

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540
           +LVTGSADK+VKFW F+V+++LI GTVDKF P +K+ HDTTLELNDD+L+V+IS ++K+ 
Sbjct: 481 KLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPEDKYF 540

Query: 541 AVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600
           A+SLLDNTVKVFFL+SMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIWGLDFGD
Sbjct: 541 AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGLDFGD 600

Query: 601 CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS 660
           CHKSLFAHQDSIMSVKF+PESHNFFSCSKDGLVKYWDGDKFEC+QKLA HQSEVWALAIS
Sbjct: 601 CHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWALAIS 660

Query: 661 NDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQRDI 720
           N+ ++VVS SHD SIR+W                ++EQ E  LL SLE GSGD  F++D+
Sbjct: 661 NNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDAAFRKDV 720

Query: 721 EGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKSG 780
            G   D    D+A DV KQTIESLKAGER++EALDLGI  IE  E YEK LK W K K  
Sbjct: 721 GGDEAD---QDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKHKGD 777

Query: 781 EPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKD 840
             P KP  NAIL A+ K PE+YI+ETL +I+PSQLEDALLVLPFSYVL F +FID  + D
Sbjct: 778 AKPVKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAALLD 837

Query: 841 KKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNV 900
            ++  ++L LICK LFFI+KSN+RELV+QKNEELKL+I +VK  LR ALK N DDLGFN+
Sbjct: 838 NRILQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLGFNI 897

Query: 901 QGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           +GLKFIR+QW+LRH LEFVDDY QR+QE+KT KKR+FET+V
Sbjct: 898 EGLKFIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETIV 938

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1410 bits (3651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/947 (71%), Positives = 813/947 (85%), Gaps = 10/947 (1%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWI----ASRNRGSAGQILTGALENVNCWDIKTGELS 56
           MVKSYQRFEQ +AFGVI+SN NCVWI     + N    GQ++T ALE+VN WDIKTG+L 
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 57  KILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116
             L+DGLPPGA DA+  K AE TYL+ H +T+LLAVGYADGVIK+WDL+SKTVL+NFNGH
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST 176
           K+AIT+L+FD TGTRLISGSKDS+II+WDLVGEVGLYKLRSHKDSITG WC+ EDWLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 177 SKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKD-MGS 235
           SKDG+IK+WDLKT QC+ETH+AHT ECWGLA+ +DL+ITT T+SQ+KIW LD++ D MG 
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 236 KLIEKGIYEKQSKQRGVSVEFIT-TSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKRE 294
           KL E GI+EKQSKQRG+ +EFIT +SD  +FFYIQNADKT+E FR+R +EEI++ L+KRE
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 295 KRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNN 354
           KRL++KG+ +E+I ++IK+SY S I+HPFQTIRS +KIK+A+W   ++SKLE+VLTTS+N
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 355 TVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIK 414
           T+EYYSIPY+KR+PT PAP K +TIELQG RTDVRSIDISDDNKLLATASNG+LKIWNIK
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 415 THACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLD 474
           TH CIRTFECGYALTCKFLPGG LV++G R G+LQLFDLASS+LL+  EDAH AAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LTSDGKRLVTGSADKTVKFWDFKV+  L+PGT +KF+P LK+ HDTTLEL DDIL V++S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594
            D+++LA+SLLDNTVKVFFL+SMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 595 GLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654
           GLDFGDCHKSLFAHQDSIM+VKF+P+SHNFFSCSKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 655 WALAISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDD 714
           WALA++ D  FVVS+SHDHSIR+W                ++EQYE+TLL SLE G+GDD
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 715 NFQRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDW 774
            F+ D  G G    + D+A+ VHKQT+ESLKAGER++EALDLGIA IE  E Y +++K W
Sbjct: 721 AFKADASGEG----VEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLW 776

Query: 775 QKKKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFI 834
           Q+KK GE P KPQ NA+L+A+ K PEQYIM+TL++IR SQLEDAL+V+PFSYVL FLKFI
Sbjct: 777 QRKKLGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFI 836

Query: 835 DVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNAD 894
           D V+++K + ++HL LICK LFFIIK N++ELV+QKNEELKLQINRVK ELR+ALK   D
Sbjct: 837 DTVMQNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTED 896

Query: 895 DLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           DLGFNVQGLKF++QQWNLRHN EFVD+YDQ+++E  + +KR+F T++
Sbjct: 897 DLGFNVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTVI 943

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1396 bits (3614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/943 (69%), Positives = 803/943 (85%), Gaps = 11/943 (1%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIA--SRNRGSAGQILTGALENVNCWDIKTGELSKI 58
           MVKSYQRFEQ S FGVIS+N NCVW++  S+   S G ++T ALEN+N WDIKTGEL  +
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60

Query: 59  LTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKS 118
           L+DGLP G++D KS+K AE +YL YH ETNLLA GY DG IK+WDL+SK+VL+ FNGHKS
Sbjct: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120

Query: 119 AITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSK 178
           AITV++FD TGTRLISGS+DS+II+WDLV EVGLYKLRSHKD+I+GIWCE EDWL+STSK
Sbjct: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180

Query: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLI 238
           DGLIKIWDLK QQC+ETH+AHT ECW + +H DL+IT+  ++Q+K+WNLD  K+ GSKLI
Sbjct: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240

Query: 239 EKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLR 298
           EKG+Y+KQSKQRG+ ++F    +G  FFYIQNADKT E+FR+R +EEISKAL+KREKRL+
Sbjct: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKREKRLK 300

Query: 299 DKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEY 358
           +KGM DE+IQQNIK+SY S+IMHPFQ I+S +KIK+ ++   + +KLE V+TTS+N++EY
Sbjct: 301 EKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360

Query: 359 YSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHAC 418
           YSIPY+KR+PT PAP +LYTIEL GHRTD+RS+DISDD+KLLATASNG LK+WN+KT AC
Sbjct: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420

Query: 419 IRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSD 478
           IR F+CGYALTCKFLPGG LV+VG R G LQLFDLASSTLLENKEDAH  AIWSLD+TSD
Sbjct: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480

Query: 479 GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNK 538
           G+RLVTGSADKT+KFW+F+V+++L+PGT DK++P +K+ HDTT+E+N+D+L+V+IS ++K
Sbjct: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540

Query: 539 FLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598
           FLA+SLLDNTVKVF+L+SMKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658
           GDCHKSLFAHQDSIM+VKF+PESHNFFS SKDGLVKYWDGDKFEC+QKLAAHQSEVW++A
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660

Query: 659 ISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQR 718
           I++D   V+S SHDHS+RVW                ++EQYE+TLL SLE GSGDD F+ 
Sbjct: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDDAFKG 720

Query: 719 DIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK 778
           D E      ++ D++T V  QT+ESLKAGER++EALDLG++ IE NE Y+ ++K W+KKK
Sbjct: 721 DAE------KVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774

Query: 779 -SGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVV 837
            SGEPP KPQ NAIL+A+KK P +YIMETLVKI+PSQLEDALLVLPFSYVL  LKFID+V
Sbjct: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834

Query: 838 IKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLG 897
           +KDKKM  N+L LICK LFF+I+SN++EL++Q+NE LK QI  VK  LR +L+ N DDLG
Sbjct: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894

Query: 898 FNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETL 940
           FN+QGLKFI+QQWNL+HN +F DD+D  K+EE + KKRIF TL
Sbjct: 895 FNIQGLKFIKQQWNLKHNFDFTDDFD--KKEESSGKKRIFGTL 935

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1390 bits (3599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/943 (70%), Positives = 800/943 (84%), Gaps = 8/943 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRN--RGSAGQILTGALENVNCWDIKTGELSKI 58
           MVKSYQRFEQ S FGVI++N NCVW+ S +  + + GQ+LTGALEN+N WDIKTGEL  +
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60

Query: 59  LTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKS 118
           L+DGLPPG++D KS+K AE TYL+YH ETNLLA GYADGVIKIWDL+SKTVL++F+GHKS
Sbjct: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120

Query: 119 AITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSK 178
            +T+L+FD TGTRL+SGS+DSDIIIWDLV EVG++KLRSHKD+ITGIWCE EDWL+ST+K
Sbjct: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180

Query: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLI 238
           DGLIK+WDLKTQQCVETH+A T ECW L +H DLV+TT T+SQIKIWNLD  K+ GSK++
Sbjct: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240

Query: 239 EKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLR 298
           EKG YEKQSKQRG+SV F TT+D   F YIQN+DKTVEIFR+R Q+EIS+AL+KREKR++
Sbjct: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300

Query: 299 DKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEY 358
           +KG  DE+IQQ   D+YVS+++ PFQ I+S +KIKA +W V   SK+E+V+TTS+NT+EY
Sbjct: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360

Query: 359 YSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHAC 418
           YSIPY+KR P  P+P+KLYTIE +GHRTD+RSIDISDDNKLLA+ASNG LKIWN+KT +C
Sbjct: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLKTKSC 420

Query: 419 IRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSD 478
           IRTF+CGYALTCKFLP G L V+G R G +QLFDL +STL+E+ + AH AAIWSLD+T D
Sbjct: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480

Query: 479 GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNK 538
           GKRLVTGSADK++KFW+F ++Q+L+PGT DKFVP +K+ HDTTLELNDDIL+VKIS ++K
Sbjct: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540

Query: 539 FLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598
           +LAVSLLDNTVKVFFL+SMKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIKIWGLDF
Sbjct: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658
           GDCHKSLFAHQDSIM+V F+PESHNFFS SKDGLVKYWDGDKFECVQKLAAHQSEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660

Query: 659 ISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQR 718
           I++D   VVS+SHDHS+RVW                ++EQYE+TLL SLE GSGD  F+ 
Sbjct: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDSAFKA 720

Query: 719 DIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK 778
           DI    EDG   D++T V  QT+ESLK+GER++EAL+LG + IE  E Y K+ K W+KKK
Sbjct: 721 DI----EDG--MDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK 774

Query: 779 SGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVI 838
           +GEPP KPQ NAIL+A+ + P+QYIM+TL+KI+PSQLEDALLVLPFSYVL FLKFID+V+
Sbjct: 775 AGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVM 834

Query: 839 KDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGF 898
            D ++  N L LICK LF I+K+N++EL++Q+N+ LK QI  VK +LRT+L+ N DDLGF
Sbjct: 835 DDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGF 894

Query: 899 NVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           N+QGLKFI+QQWNL+HN EF+D+ DQ+KQEEK  KKRIF TL 
Sbjct: 895 NIQGLKFIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTLA 937

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1370 bits (3546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/942 (70%), Positives = 792/942 (84%), Gaps = 7/942 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNR--GSAGQILTGALENVNCWDIKTGELSKI 58
           MVKSYQRFEQ S FGV+SS  N +WI + N+     GQI+TGALENVN WDIKTGEL   
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWIPAENKRTNGPGQIITGALENVNIWDIKTGELVSH 60

Query: 59  LTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKS 118
           L+DGLPPGA+DA++TK AE TY+QY+ +T+LLAVGYADGVIKIWD+ SKTVL++FNGH+S
Sbjct: 61  LSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGHRS 120

Query: 119 AITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSK 178
           A+T L FD TGTRLISGS+DS+II+WDLV EVGLYKLRSHKDSITG+   +E+WL+S SK
Sbjct: 121 AVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMSVSK 180

Query: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLI 238
           DGLIK+WDLK QQCVETH+AH  ECW L +  D+V+TTS++SQIKIW+LDLD D G K+ 
Sbjct: 181 DGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADAGVKVT 240

Query: 239 EKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLR 298
           EKGI+EKQSKQRGV+V FIT SDG  FFY+QNADKT+EI R+R +EEIS+AL+KREKR +
Sbjct: 241 EKGIFEKQSKQRGVAVSFITVSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKREKRFK 300

Query: 299 DKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEY 358
           +KGM DE+IQQN K+SY+S+IMH FQ +RS FKI+AA+WAVTT+SKLE+ +TTS NT+EY
Sbjct: 301 EKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGNTIEY 360

Query: 359 YSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHAC 418
           YSIPY+KREP  P P ++++IELQGHRTDVR+IDISDD KLLATASNG LKIWNI+T  C
Sbjct: 361 YSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIRTKTC 420

Query: 419 IRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSD 478
           +RTFECGYALTCKFLPGG LV+VG R G LQLFDLASST+LEN E+AH AAIWSLD+TSD
Sbjct: 421 LRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDITSD 480

Query: 479 GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNK 538
           G+RLVTGSADKTVKFW+F V+++ +PGT DK +P + + HDTTLE++DDIL+VKIS +NK
Sbjct: 481 GRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENK 540

Query: 539 FLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598
            LAVSLLDNTVKVF+L +MKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIKIWGLDF
Sbjct: 541 LLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658
           GDCHKSLFAHQDSIM+VKF+PESHNFFSCSKD  VKYWDGDKFE +QKLA HQSEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWALA 660

Query: 659 ISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQR 718
           ++     V+S SHD SIRVW                ++EQ E  LL SLE GSGD  F++
Sbjct: 661 VARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAFKQ 720

Query: 719 DIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK 778
           D +         D A DVHKQT+ESLKAGER++EA+DLGI  IE  E YEK L+ W+KKK
Sbjct: 721 DEKDD-----DHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKK 775

Query: 779 SGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVI 838
            G  P +PQ+NAIL+A+ K PE+YIM+TLV+I+PSQLEDALL LPFSYVL FLKF+D V+
Sbjct: 776 QGVEPERPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVL 835

Query: 839 KDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGF 898
           +DKK+ +NHL+LICK LFFI++SN+RELV+QKNEELK +I RVK ELR ALK N DDLGF
Sbjct: 836 QDKKLLHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGF 895

Query: 899 NVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETL 940
           N++GLKFI+QQWNL+HN EFVD++DQRKQ EKT KKR+FETL
Sbjct: 896 NIEGLKFIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETL 937

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1363 bits (3529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/937 (68%), Positives = 786/937 (83%), Gaps = 7/937 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSA--GQILTGALENVNCWDIKTGELSKI 58
           MVKSYQRFEQ S FGVISSN+NCVW+   ++ S   G+++TGALEN++ WD+KT EL  +
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKSKSLGKVITGALENISVWDLKTSELEYV 60

Query: 59  LTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKS 118
           L+DGLPPG+VD KS+K AE +YLQ+H ET L+A GYADGVIK+WDL+SKTVL++FNGHKS
Sbjct: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120

Query: 119 AITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSK 178
            IT+L+FD TGT+LISGS+DS+II+WDLV EVGLYKLRSHK +ITG+WC++++WLISTSK
Sbjct: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180

Query: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLI 238
           DGLIK+WDLKTQQC+ETH+AHT ECW L I  D V+T+S +SQ+KIW +DL+ + GSKLI
Sbjct: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240

Query: 239 EKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLR 298
           EKG +EKQSKQRG+S+EF TTSDGV+FFY+QNADKTVEIFR+R   EI+KA+++REKRL 
Sbjct: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300

Query: 299 DKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEY 358
           +KGM +E I+ NI +SYVS +MHPFQ +RS +KIK+  W ++ ++KLE+V+TT++NT+EY
Sbjct: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360

Query: 359 YSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHAC 418
           YS+PY+KR+PT P P K +TIELQG RTDVRSIDISDDN LLATASNG LKIWN+ T +C
Sbjct: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420

Query: 419 IRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSD 478
           IRTFECGYALTCKFLPGG LVVVG R G+LQLFDLASS LL   E AH  AIWSLD+T+D
Sbjct: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480

Query: 479 GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNK 538
           GKRLVTGSADK++KFWDF+V QELI GT DK+VP++ I HD+TLEL DDIL++KIS D+K
Sbjct: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540

Query: 539 FLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598
           FLA+SLLDNTVKVFFL+SMKFFLSLYGHKLPVLS+DIS D+K++ITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600

Query: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658
           GDCHKSLFAHQDSIM VKF+P SHNFFS SKDG VKYWDGDKFEC+QKLAAHQSEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660

Query: 659 ISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQR 718
           +S++   VVS SHDHSIR+W                ++EQYE+TLL SLE G+ DD F+ 
Sbjct: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADDTFKG 720

Query: 719 DIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK 778
           D++   ED    D+AT V KQTIESLKAGER+++ALDLGI  IEE E YE  +  ++KK+
Sbjct: 721 DVK-NDED----DEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQ 775

Query: 779 SGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVI 838
             + P KP  NAIL+A++K P +YIM+TL+ I+PSQLED+LLVLPFSYVL FLKF D V+
Sbjct: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835

Query: 839 KDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGF 898
           K   + NN L LICK LFFI+KSN +ELV+QKNEELKLQI+RVK +LR+AL+ N DDLGF
Sbjct: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895

Query: 899 NVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKR 935
           N+QGLKFI+QQWN++HN EFVDDYDQ+ Q EK+ KK 
Sbjct: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKKE 932

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1359 bits (3517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/941 (69%), Positives = 793/941 (84%), Gaps = 5/941 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASR-NRGSAGQILTGALENVNCWDIKTGELSKIL 59
           MV SYQRFEQ S FGVI+SN+NCVWI +  +R S GQI+T +LEN+NCWDIKTG L K L
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60

Query: 60  TDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSA 119
           +D +PPG++DAK  K AE  YL+YH ETNLLA GYADGVIKIWD+ ++TVLI FN H +A
Sbjct: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120

Query: 120 ITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKD 179
           IT L+FDP+GTRLISGS+DS+IIIWDLVGEVGL KLRSHKDSITGIW EN+DWLISTSKD
Sbjct: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD 180

Query: 180 GLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIE 239
           GLIK+WD+K+QQCVETHMAHT+ECW LAI +DLV+T + +S++KIW LDL+++ GSKL E
Sbjct: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE 240

Query: 240 KGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRD 299
           KGIYEKQS+QR V V+ +T  D V FFY+QNADKT E+FR+RT  E+SKAL+KREKRL++
Sbjct: 241 KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTSSELSKALKKREKRLKE 300

Query: 300 KGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYY 359
           KG+++++IQ+ IK S+V+ I+ PFQ +RS FK K+A W   + SKLE+V TTSNNT+EYY
Sbjct: 301 KGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY 360

Query: 360 SIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACI 419
           SIPY+ ++PT+ A +KLYTIELQGHRTDVRSIDIS+DNKLLA ASNG LKIWNI T +CI
Sbjct: 361 SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI 420

Query: 420 RTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDG 479
           RTF+CGYAL CKFLPGG LVVVG RGG+LQLFDLASS +LENKE AH AAIWSLDLTSDG
Sbjct: 421 RTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480

Query: 480 KRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKF 539
           +RL+TGSADKTVKFW+F+V++ELI  + DK+  +L++ HDTTLEL +DIL+VKIS +++F
Sbjct: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540

Query: 540 LAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG 599
           LAVSLLDNTVKVFFL+SMKFFLSLYGHKLPVLSIDIS+DSKL+ITSSADKNIKIWGLDFG
Sbjct: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600

Query: 600 DCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAI 659
           DCH+SLFAHQD+IM+VKFVP+SHNFFSC KDG++KYWDG KF+C+QKL AH+SEVWALA+
Sbjct: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660

Query: 660 SNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQRD 719
           S+D +F VS SHD SIRVW                MDEQYE  LL +LE  + D+ F R+
Sbjct: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARN 720

Query: 720 IEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKS 779
            E   ED ++T + TDVHKQTIESLKAGER++EALDLGI+ +E  E Y +NL  W K KS
Sbjct: 721 SE---EDTDVT-EVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKS 776

Query: 780 GEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIK 839
           G+ P KPQ N+IL+A+ K PE+YIM+TLV+I+P+QLEDALLVLPFSYVL FLKFID  I+
Sbjct: 777 GDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIE 836

Query: 840 DKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFN 899
            K++ NNHL LIC+ L +++K N++EL+AQKNEELKLQIN+VK +LR ALKGN DDLGFN
Sbjct: 837 KKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFN 896

Query: 900 VQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETL 940
           ++GLKFI+QQWN++HN EFVD+YDQR  E K+ KKR+F T+
Sbjct: 897 IEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1354 bits (3504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/945 (68%), Positives = 778/945 (82%), Gaps = 9/945 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWI----ASRNRGSAGQILTGALENVNCWDIKTGELS 56
           MVKSYQRFEQ + FGVISSN+N VWI    + R  G+ GQ++ G LEN+  WDIKTGE  
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60

Query: 57  KILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116
             LTDGLPPGA DAK +K AE+T+L+YHPETNLLA GYADGVIKIWDLISKTVLI+FNGH
Sbjct: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120

Query: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST 176
           KSAITVL FD TGTRLIS SKDSDII+WDLVGE GLYKLRSHKD+ITG+WCE+E+WLIST
Sbjct: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180

Query: 177 SKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSK 236
           SKDGL+KIWDLK+QQCVETH+AHT ECW L I  D+ +T S +SQ+K+W LDL  + GSK
Sbjct: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240

Query: 237 LIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKR 296
           L EKGI EKQSKQRGV ++F    DGV FFYIQNADKT+EI+R+R +EEIS+AL+KREKR
Sbjct: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300

Query: 297 LRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTV 356
           L+DKGM++E+I++ +  S VS++ H FQ +RSP+KIK+A W V + SKLE+V+TTSNN++
Sbjct: 301 LQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359

Query: 357 EYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTH 416
           EYYSIPY KREPT+PAP KL+TI+L G RTD+RS  ISDDNKLLATASNG+LKIWNIKT 
Sbjct: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419

Query: 417 ACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLT 476
            CIR+FECGYALTCKFLPGGALVVVG R G+LQLFD+ASST+L+NKE AH AAIWSLDLT
Sbjct: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479

Query: 477 SDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSD 536
           SDG++LVTGSADKTV+FW F+V +  +    +K +P L++FHDTTLEL+DDIL+V IS D
Sbjct: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539

Query: 537 NKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGL 596
           +KF+AVSLLDNTVKVFFL+SMKFFLSLYGHKLPVLS+DIS+DSKL++T SADKNIKIWGL
Sbjct: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599

Query: 597 DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWA 656
           DFGDCHKSLFAHQDSIM+VKF+PES+NFFSCSKD  VKYWDG KFEC+QKLAAHQSEVW+
Sbjct: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659

Query: 657 LAISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNF 716
           +++SND  FV+ST HDHSIRVW                MDEQYE+TLL SLE G+GD+  
Sbjct: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEM- 718

Query: 717 QRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQK 776
              +  +  D E +++   VHKQT+ESLKAGER++EAL++G+  I   E + + L  W+K
Sbjct: 719 ---LSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKK 775

Query: 777 KKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDV 836
            K G  P +PQEN +LVALKK PE+YI+ETLVKI+PSQ+EDAL+V+PFSY+L FLKFIDV
Sbjct: 776 SKKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDV 835

Query: 837 VIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDL 896
           V     +   H++L+CK LFF+I+ NY+ELVAQKN  LKLQI RVK  LR +LK N D+L
Sbjct: 836 VTTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDEL 895

Query: 897 GFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           GFN++G+KFI+QQW L H+LEF D+Y+++  EEK  KKR+F TL 
Sbjct: 896 GFNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1347 bits (3485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/946 (70%), Positives = 799/946 (84%), Gaps = 13/946 (1%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT 60
           MVKSYQRFEQ S FGVISSN+N VWI + N    G I+T ALEN+N WDIKTGEL   LT
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWIPNGN--GPGNIITSALENINIWDIKTGELVNQLT 58

Query: 61  DGLPP-GAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSA 119
           DGLPP G++D+K +K A  TY +YH +TNLLA GY+DGVIK+WDLISKT+L+ FNGHKSA
Sbjct: 59  DGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNGHKSA 118

Query: 120 ITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWC-ENEDWLISTSK 178
           IT+L FD TGTRLISGS DSDII+WDLV EVGLYKLRSHKD+ITGIWC ++E+WLISTSK
Sbjct: 119 ITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLISTSK 178

Query: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLD-KDMGSKL 237
           DGLIK+WDLK QQCVETH+AHT ECW L IHNDLV+TTS ESQ+K W LDL+ +  GSKL
Sbjct: 179 DGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPNGSKL 238

Query: 238 IEKGIYEKQSKQRGVSVEFITT-SDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKR 296
           +EKGI+EKQSKQRG+SVEFIT+  D V+FF+IQNADKTVEIFR+R ++EI KAL+KREKR
Sbjct: 239 VEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKKREKR 298

Query: 297 LRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTV 356
           L++KGM D++I QN+ +++VS +MHPFQT+RS +KIK+  W   T+SKLE+V+TTS+NT+
Sbjct: 299 LKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTSSNTI 358

Query: 357 EYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTH 416
           EYYS+ Y KR P +P P+K++TIEL G RTD+RSI ISDDNKLLATASNG LKIWN+KTH
Sbjct: 359 EYYSVTYAKRIP-QP-PSKIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWNLKTH 416

Query: 417 ACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLT 476
            CIRTFECGYAL CKFLPGG LV+VG R G+LQLFDLASST LEN EDAH AAIWSLD+T
Sbjct: 417 KCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWSLDIT 476

Query: 477 SDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSD 536
           SDGKRL+TGSADKTVKFWDFK+DQ+ + GT D ++P LK+FHDTTLE+ +DIL V++S D
Sbjct: 477 SDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVRLSPD 536

Query: 537 NKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGL 596
           +KFLAVSLLD TVK+FFL+SMKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIKIWGL
Sbjct: 537 DKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 596

Query: 597 DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWA 656
           DFGDCHKSLFAH DSIM+VKF+  SHNFFSCSKDG +KYWDGDKFEC+QKL AHQ+EVW+
Sbjct: 597 DFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQNEVWS 656

Query: 657 LAISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNF 716
           +AI++D+ FVVS+SHDHS+R+W                M+EQYENTLL+SLE G+GD  F
Sbjct: 657 IAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTGDSAF 716

Query: 717 QRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQK 776
           + D +G     E  D+ATDVHKQT ESLKAGER++EALDLGI  IE+NETY K+L+ W+K
Sbjct: 717 KSDTKG----SEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKK 772

Query: 777 KK-SGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFID 835
           KK  G+ P KPQ NAIL A+ K PEQYI+ETL+KI+PSQLEDA+LV PFSYVL FLKFID
Sbjct: 773 KKIGGDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFID 832

Query: 836 VVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADD 895
           +V+ D K+ NNHLTLICK LFF+IKSN++EL++QKNE+LKLQ++RVK  LR AL+ N DD
Sbjct: 833 IVLNDPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDD 892

Query: 896 LGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           LG+N+QGLKFI+QQWNL HN EF D+ DQ  QE K+ KKR+F T+V
Sbjct: 893 LGYNIQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTIV 938

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1344 bits (3478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/948 (70%), Positives = 792/948 (83%), Gaps = 13/948 (1%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIA---SRNRGSAGQILTGALENVNCWDIKTGELSK 57
           MVKSYQRFEQ + FGVISS  N VW+     R+ GS GQI+T ALENVN WDIKTGEL  
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPPLKGRSSGSPGQIITSALENVNIWDIKTGELIA 60

Query: 58  ILTDGLPPGAVDAK-STKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116
            L DG+ PG+ D+K +TK AE T+LQYHP+++LLAVGY DG IK+WDL+SKTVLIN NGH
Sbjct: 61  QLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNGH 120

Query: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE-DWLIS 175
           KS+ITVL+FD   TRL+SGS DS+IIIWDLV EVG+ KLRSHKD I+ ++ +++ +WL+S
Sbjct: 121 KSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLLS 180

Query: 176 TSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGS 235
            SKDGLIK+WDLKT QCVETH+AHT ECW L I +D+VITTS  SQIK+W+LDLD ++GS
Sbjct: 181 VSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGEVGS 240

Query: 236 KLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREK 295
           KLIEKG+YEKQSKQRG SV+FI  S GV FF I NADKT+EIFR+R QEEI++AL+KREK
Sbjct: 241 KLIEKGVYEKQSKQRGTSVKFIENSSGVAFFAIGNADKTIEIFRIRPQEEITRALKKREK 300

Query: 296 RLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNT 355
           RL++KGM DE IQQNIK+S+VS +MH FQT+RS FK+K+ +W   T SKLE+V TTS+NT
Sbjct: 301 RLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTSSNT 360

Query: 356 VEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKT 415
           +EYY+I Y+KREPT+PAPN+LYTIELQG RTD+R+ DISDDN LLATASNG LKIWN++T
Sbjct: 361 IEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWNLRT 420

Query: 416 HACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDL 475
             CIRTF+CGYALTCKFLPGG LV++G R G+LQLFDLASST +EN E AH AAIWSLDL
Sbjct: 421 KQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWSLDL 480

Query: 476 TSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISS 535
           TS+GKRLVTGSADKTVKFWDF+++Q  I GT  K   KL + HDTTLELNDD+L VKIS 
Sbjct: 481 TSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVKISP 540

Query: 536 DNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWG 595
           ++K LAVSLLDNTVK+FFL++MKFFLSLYGHKLPVLSIDISFDSK++ITSSADKNIKIWG
Sbjct: 541 EDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIWG 600

Query: 596 LDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVW 655
           LDFGDCHKSLFAHQDSIM+VKF+PESHNFFSCSKDG VKYWDGDKFECVQKL +HQSEVW
Sbjct: 601 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQSEVW 660

Query: 656 ALAISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDN 715
            LA+  D  FVVSTSHDHSIR+W                M+EQYE TLL+SLE G+GDD 
Sbjct: 661 CLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTGDDA 720

Query: 716 FQRD-IEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDW 774
           F++D ++G G      D+ATDVHKQTIESLKA E++++ALDLG+  IE  E Y  ++  W
Sbjct: 721 FKKDSVDGEG------DEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALW 774

Query: 775 QKKKSG-EPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKF 833
           +KKK G E P KP  NA+L+A+KK+PEQYIMETL +I+PSQLEDALL+LPFSYVL FLKF
Sbjct: 775 KKKKIGSEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKF 834

Query: 834 IDVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNA 893
           ID+V+K+KKM +N+L LICK LFFI+++N++EL++QKNEELKLQI RVKQELR  LK N 
Sbjct: 835 IDIVLKNKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNE 894

Query: 894 DDLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941
           D LGFN+QGLKFI+QQW+L+HN EFVD+YDQR QEEK  KKRIFETLV
Sbjct: 895 DALGFNIQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETLV 942

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1325 bits (3428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/940 (67%), Positives = 772/940 (82%), Gaps = 5/940 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT 60
           MVKSYQRFEQ   FGV+++N+NCVW+ S+ + S GQ++TGALE V CW+IKTGEL K + 
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR 60

Query: 61  DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI 120
           DGLPPGA+D K+ K AE+TYLQYH ET +LAVGYADG IKIWD+ ++TVLI F+ H SAI
Sbjct: 61  DGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI 120

Query: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDG 180
           T+LRFD TGTRLISGS+D+ II+WDLV E GL KLRSHKD+ITGIWCEN+DWLIS SKDG
Sbjct: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDG 180

Query: 181 LIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEK 240
           LIK+WD+K  QCVETHMAHT ECW LA+ +++VIT + ES+IK+W LDL++  GS L+EK
Sbjct: 181 LIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEK 240

Query: 241 GIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDK 300
           G YEKQSKQR   + F T +DG  FFY  N+DKT+EIFR+R++ EI+KAL+KREKR ++K
Sbjct: 241 GSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEK 300

Query: 301 GMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYS 360
           GM+DE+IQ++ ++SY ++++HPFQ +RS FK+KA++W V T SKLE+V+TT+NNT+EYYS
Sbjct: 301 GMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYS 360

Query: 361 IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIR 420
           IPY+K+EP +P   KL++IE  GHRTD+R+ DIS D+KLLATASNG LK+WNIKT  CIR
Sbjct: 361 IPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIR 420

Query: 421 TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480
             +CGYAL CKFLPGGALV++G R G LQLFDLASST+LEN E+AH AAIWSLDLTSDGK
Sbjct: 421 NLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGK 480

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540
           RLVT SADKTVKFWDFKV+QEL+ GT+DKFVPK+K+ HDTTL+L +D+  VKIS +++FL
Sbjct: 481 RLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFL 540

Query: 541 AVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600
           AVSLLDNTVKVFFL+SMKFFLSLYGHKLPVLS+DIS DSKL+ITSSADKNIKIWGLDFGD
Sbjct: 541 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD 600

Query: 601 CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS 660
           CHKSLFAHQDSIM+VKF+PESHNFFSCSKDG VKYWDG+ F+C+QKL  HQ EVWALA+S
Sbjct: 601 CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS 660

Query: 661 NDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQRDI 720
           +D + VVS SHD SIRVW                ++EQYE TLL SLE GSGDD F   I
Sbjct: 661 SDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDDAF---I 717

Query: 721 EGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKSG 780
              G++     ++T+VHKQTIESLKAGER++EALDLGI  I+  E YE+ +K W KK  G
Sbjct: 718 SNNGDETAGV-ESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKKL-G 775

Query: 781 EPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKD 840
           + P+KPQ NAIL AL K PE Y+METL KI+PSQLEDALLVLPFSYVL FLKFID+ IK+
Sbjct: 776 DQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKN 835

Query: 841 KKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNV 900
             + +  L L+CK+L F+++SN++ELV+QKNEELK+QINRVK +LR AL+ + DDLGFN+
Sbjct: 836 DVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNI 895

Query: 901 QGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETL 940
           QGLKF+R  WN+ HN +F D+YDQ  +E+   KKR+F T 
Sbjct: 896 QGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1251 bits (3236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/942 (65%), Positives = 757/942 (80%), Gaps = 9/942 (0%)

Query: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT 60
           MVKSYQRFEQ   FG+IS++   +++ + N  ++G+++TGALEN+  W +KT E+ ++LT
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLPATN-STSGKLITGALENIQIWTLKTNEV-EVLT 58

Query: 61  DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI 120
           DGLP GAV+   +K +  T + +H ET LL VGY DGVIK+WDL+SK+VL+ FNGHKS +
Sbjct: 59  DGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGV 118

Query: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCE-NEDWLISTSKD 179
           TVLR D  GTRL+SGSKDSD+IIWDLVGEVGL KLRSHKD+ITGIW + N DWLIS +KD
Sbjct: 119 TVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLISVAKD 178

Query: 180 GLIKIWDLKTQ-QCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLI 238
           GLIK+WDLK   QCVETHMAHT +CW +AI  +++ITTS +SQ KIW LDL+K  G K+ 
Sbjct: 179 GLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSNGEKIS 238

Query: 239 EKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLR 298
           E+G +E +SKQRGVS EFIT  +G  FFYIQN DKT+EIFR+R +EEI KAL +REKRLR
Sbjct: 239 ERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNRREKRLR 298

Query: 299 DKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEY 358
           DKG ++E+IQ+ +  + +SV+ H F T+RS +KIK++ W   + SKLE+VLTTSNNT+E 
Sbjct: 299 DKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTSNNTIES 358

Query: 359 YSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHAC 418
           Y IPY KR+   P   + Y +ELQGHRTD+RS+DISDD KLL+TASNG LK+WN+ T  C
Sbjct: 359 YQIPYSKRDAEPPV--RRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKC 416

Query: 419 IRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSD 478
           IRTF CGYAL  + LPGG LVVVG R G+LQLFDLASSTLL   E AH AAIWSLDLTS+
Sbjct: 417 IRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWSLDLTSN 475

Query: 479 GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNK 538
           GKRLVTGSADK+ KFWDF+V ++L+PGT DK++P+LK+ HDTTLEL DDILAVKISS+++
Sbjct: 476 GKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDR 535

Query: 539 FLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598
           +LAVSLLDNTVKVFF +S+KF+LSLYGHKLPVLSID S DSK+LITSSADKNIKIWG+DF
Sbjct: 536 YLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDF 595

Query: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658
           GDCHKS+FAHQDSIMSV+F  ++HNFFSC KDG VK WDGDKF+C+QKL  HQSEVW +A
Sbjct: 596 GDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIA 655

Query: 659 ISNDARFVVSTSHDHSIRVWXXXXXXXXXXXXXXXXMDEQYENTLLHSLEAGSGDDNFQR 718
           +S D R VVSTSHDHSIRVW                M+E+YE TLL SLE GSGDD F R
Sbjct: 656 VSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSGDDQFLR 715

Query: 719 DIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK 778
           D +  G+DG + D+ + V+KQT+ESLKAGE+++EALDLG+A IE  E YEK+LK W+KKK
Sbjct: 716 D-KNSGDDG-VIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSWKKKK 773

Query: 779 SGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVI 838
           SGEPP KPQ NAIL+A+K  PE+YIM+TL KI+PSQLED+LLVLPFSYV+ F KF DV++
Sbjct: 774 SGEPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFFDVIM 833

Query: 839 KDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGF 898
           K K +   HL+LICK+LFFI+++N +ELVAQKNEELK +I RVK  +RT L+ NADDLGF
Sbjct: 834 KQKDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNADDLGF 893

Query: 899 NVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETL 940
           N+ GL FI+QQWNLRHNLEF DDY Q + E+K  KKR+FET+
Sbjct: 894 NIAGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETV 935

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  139 bits (349), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 145/640 (22%), Positives = 268/640 (41%), Gaps = 96/640 (15%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           E T L+  P+   LA      ++KI+ L +  ++ +     S   +L  DPT T L  G 
Sbjct: 63  EITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLK-ISSPSYILDTDPTSTLLAVGG 121

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGI----WCENEDWLISTS-KDGLIKIWDLKTQQ 191
            D  I+I D+      + L+ H  +I+ +      ++E WL+++   +G++K+WDL  ++
Sbjct: 122 TDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRK 181

Query: 192 CVETHMAHTSECWGLAI--------HNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIY 243
           C+ T   H+S   GL I         +  +++   +  + +W+ D+ K    KL++    
Sbjct: 182 CLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDFDMKKK--CKLVKTLPV 239

Query: 244 EKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKR------- 296
            +Q +  G    F+   DG    Y    D   ++  + +   + +  +  E+        
Sbjct: 240 NQQVESCG----FLKNHDGKRIIYTAGGDAIFQLIDLESGTVLKRTNKPIEELFIIGVLP 295

Query: 297 -LRDKGM----ADEKIQQ-NIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKL----- 345
            + D  M    +D+ +Q  NI++    V+ +   TI +   I      +     +     
Sbjct: 296 IMNDSEMFLVMSDQTLQLINIEE----VLENENDTINARSTIAGNNGIIADMRFVGPELN 351

Query: 346 EMVLTTSNNTVEYYSIP-YQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS 404
           ++ L T++ ++    IP     + + P   ++Y    +GH   + S+D ++D   +ATAS
Sbjct: 352 KLALATNSPSLRIIPIPDLSGADASLPLDVEIY----EGHEDLLNSLDATEDGLWIATAS 407

Query: 405 -NGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKE 463
            + T  +W        RT +                           FD+ +  +     
Sbjct: 408 KDNTAILWKYNE----RTSK---------------------------FDIYAKYI----- 431

Query: 464 DAHGAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFH 518
             H +A+ ++ L +   +     L+T S D T+K W       ++   + K     +  H
Sbjct: 432 -GHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAH 490

Query: 519 DTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFD 578
           +       DI A+ +S ++   A +  D T K++ L + +   +L  HK  +  +     
Sbjct: 491 EK------DINALSVSPNDSIFATASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQY 544

Query: 579 SKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDG 638
            KLL TSS DK +KIW LD     K+L  H +++    F+ +     SC  DGL+K WD 
Sbjct: 545 DKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDC 604

Query: 639 DKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
              EC+  L  H + +WAL   ND   +VS   D   + W
Sbjct: 605 SSGECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFW 644

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 12/174 (6%)

Query: 64  PPGAVDAKSTKLAEST---------YLQYHPETNLLAVGYADGVIKIWDLISKTVLINFN 114
           P   +D +  K++E T          L   P  ++ A    D   KIW L +  +     
Sbjct: 471 PTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEATLA 530

Query: 115 GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWL 173
            HK  +  + F      L + S D  + IW L     +  L  H +++    +   +  L
Sbjct: 531 NHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQL 590

Query: 174 ISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHN--DLVITTSTESQIKIW 225
           +S   DGLIKIWD  + +C+ T   H +  W L   N  D++++   +   + W
Sbjct: 591 VSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFW 644

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 78/174 (44%), Gaps = 11/174 (6%)

Query: 515 KIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSID 574
           KI H  + E   +I A++++ D ++LA       +K+F L + +   SL     P   +D
Sbjct: 51  KILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISS-PSYILD 109

Query: 575 ISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE--SHNFFSCSKD-- 630
               S LL     D +I I  ++ G    SL  H  +I S+KF  +  S  +   S D  
Sbjct: 110 TDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTN 169

Query: 631 GLVKYWDGDKFECVQKLAAHQSEVWALAI----SNDARF--VVSTSHDHSIRVW 678
           G+VK WD  K +C+  L  H S V  L I    S D     ++S   D  + VW
Sbjct: 170 GMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVW 223

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 152/639 (23%), Positives = 266/639 (41%), Gaps = 93/639 (14%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           E T LQ  P+   L       ++KI+ L +  V+ +     S   +L  D T T L  G 
Sbjct: 63  EITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMK-ISSPSYILDTDSTSTLLAVGG 121

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGI----WCENEDWLISTS-KDGLIKIWDLKTQQ 191
            D  II+ D+      + L+ H  +I+ +      +++ WL+++   +G++K+WDL  ++
Sbjct: 122 TDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRK 181

Query: 192 CVETHMAHTSECWGLAI----HND-----LVITTSTESQIKIWNLDLDKDMGSKLIEKGI 242
           C+ T   HTS   GL I    +ND      +I+   +  +  W+ D+ K    KLI+   
Sbjct: 182 CLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDMKKK--CKLIKTLP 239

Query: 243 YEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKG- 301
             +Q +  G    F+ T DG +  Y    D   ++  + +   + +  +  E+ L   G 
Sbjct: 240 VNQQVESCG----FLNTRDGKHIIYTAGGDAIFQLIDLESGSMLKRTNKPIEE-LYIIGV 294

Query: 302 ---MADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKL------------E 346
              M+D K+   + D  + +I +  + + S  +I  A  ++     +            +
Sbjct: 295 LPIMSDSKMFLVMSDQTLQLI-NIEEALESKEEIIQAESSIAGNHGIIADMRFVGPELNK 353

Query: 347 MVLTTSNNTVEYYSIP-YQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASN 405
           + L T++  +    IP     E + P   ++Y    +GH   + S+D ++D   +ATAS 
Sbjct: 354 LALATNSPALRIIPIPDLTSTESSLPLDVEIY----EGHEDLLNSLDATEDGLWIATASK 409

Query: 406 GTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDA 465
               I                              V     D   FD+ +  +       
Sbjct: 410 DNSAI------------------------------VWKYNNDTSKFDIYAKYI------G 433

Query: 466 HGAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFKVDQELIP-GTVDKFVPKLKIFHD 519
           H +A+ ++ L +   +     L+T S D T+K W        IP  T    V  +K+   
Sbjct: 434 HSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWK-------IPKPTSTNDVQIIKVSEY 486

Query: 520 TTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDS 579
           T      DI A+ +S ++   A +  D T K++ L + +   +L  HK  +  +      
Sbjct: 487 TRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYD 546

Query: 580 KLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGD 639
           KLL T S DK +KIW L+     K+L  H +++    F+ +     SC  DGL+K WD  
Sbjct: 547 KLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCY 606

Query: 640 KFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             EC++ L  H + +WAL   ND   +VS   D   + W
Sbjct: 607 SGECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFW 645

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 68/150 (45%), Gaps = 5/150 (3%)

Query: 515 KIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSID 574
           KI H  + E   +I A++++ D ++L        +K+F L + K   S+     P   +D
Sbjct: 51  KILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISS-PSYILD 109

Query: 575 ISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN----FFSCSKD 630
               S LL     D +I +  ++ G    SL  H  +I S+KF  +  +      S   +
Sbjct: 110 TDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTN 169

Query: 631 GLVKYWDGDKFECVQKLAAHQSEVWALAIS 660
           G+VK WD  K +C+  L  H S V  L I+
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHTSAVRGLDIT 199

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 153/634 (24%), Positives = 267/634 (42%), Gaps = 116/634 (18%)

Query: 71  KSTKLAESTYLQYHPETN-LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRF--DP 127
           +S K++  +Y+     T+ L+A+G  DG I + D+ +  +  +F GH   I+ L+F  + 
Sbjct: 96  RSMKISSPSYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGEL 155

Query: 128 TGTRLISGSKDSDII--IWDLVGEVGLYKLRSHKDSITGI---WCENEDW--LISTSKDG 180
            G + +  S D++ +  +WDLV    L+ ++ H  +I G+     E ED   L+S  +D 
Sbjct: 156 NGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDD 215

Query: 181 LIKIWDL---KTQQCVETHMAHTS-ECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSK 236
           ++ +W+    K  + ++T   H   E  G    +DLV T   E+ +++ +L+       K
Sbjct: 216 IVNLWEFNMKKHSKLLKTVPVHQQVESCGFVRESDLVYTAGGEAVLQLISLE-----SQK 270

Query: 237 LIEKGIYEKQSKQRGVSVEFITTSDGV---NFFYIQNADKTVEIFRVRTQEEISKALRKR 293
           +I+K        Q+ +   FI     +     FY+  +D+T+++  +  +E IS      
Sbjct: 271 VIKK-------TQKPIEELFIVGVLPILSGREFYLVLSDQTLQL--INMEEAISN----- 316

Query: 294 EKRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSN 353
                     DE I      +  S I     TI        A   V      ++ L T++
Sbjct: 317 --------FDDELI------NVASSIAGNHGTI--------ADIRVVGPGLNKIALATNS 354

Query: 354 NTVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKI-WN 412
             +    IP Q  E + P   ++Y    +GH   + S+D ++D   LAT S  +  I W 
Sbjct: 355 PALRIIPIP-QTSENSLPLDVEVY----EGHEDLLNSLDATEDGLWLATCSKDSSAILWR 409

Query: 413 IKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWS 472
                           T KF P                           K   H A++ +
Sbjct: 410 FNVE------------TAKFFPYA-------------------------KFTGHSASVTA 432

Query: 473 LDLTSDGKR-----LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELN-- 525
           + L +   R     L+T S D TVK W        +P   ++ +  L     +    +  
Sbjct: 433 VALPNVMLRGWPEFLITASNDLTVKRWK-------VPKPANEDISDLLTIKQSEYTFHVH 485

Query: 526 -DDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLIT 584
             DI A+ ++ ++   A +  D T K++ + + +   +L GHK  +  +      KLL T
Sbjct: 486 AKDINALSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLAT 545

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECV 644
           SS DK IKIW LD   C K+L  H +++    F+ +     S   DGL+K WD    +C+
Sbjct: 546 SSGDKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCL 605

Query: 645 QKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           + L  H + +WA+ + ND   ++S   D   + W
Sbjct: 606 KTLDGHGNRIWAMNVCNDGDLIISADADGVFQFW 639

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 77/178 (43%), Gaps = 15/178 (8%)

Query: 512 PKLKIFHDTTLELNDD---ILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKL 568
           P  K+ H  T+E NDD   I A++++ D ++L        +K+F L+SMK   S+     
Sbjct: 47  PTQKLLH--TIE-NDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKITRSMKISS- 102

Query: 569 PVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN----F 624
           P   +D    S L+     D +I +  ++ G    S   H  +I S+KF  E +      
Sbjct: 103 PSYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLL 162

Query: 625 FSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAI----SNDARFVVSTSHDHSIRVW 678
            S   +G+ K WD  K  C+  +  H S +  L        D   ++S   D  + +W
Sbjct: 163 ASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLW 220

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 165/712 (23%), Positives = 288/712 (40%), Gaps = 118/712 (16%)

Query: 10  QGSAFGVISSNTNCVWIASRNRGSAGQIL-TGALENVNCWDIKTGELSKILTDGLPPGAV 68
           +G +   I + ++ V   S N    G+IL T  L+ +N  D+  G   KIL         
Sbjct: 8   KGISLNPIYAGSSAVATVSEN----GKILATPVLDEINIIDLTPGS-RKILHKISNEDEQ 62

Query: 69  DAKSTKLA-ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDP 127
           +  + KL  +  YL Y  +  LL         KI+ L +  V+ +     S   +L  D 
Sbjct: 63  EITALKLTPDGQYLTYVSQAQLL---------KIFHLKTGKVVRSMK-ISSPSYILDADS 112

Query: 128 TGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI----WCENEDWLISTS-KDGLI 182
           T T L  G  D  II+ D+      +  + H  +I+ +       ++ WL+++   +G++
Sbjct: 113 TSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMV 172

Query: 183 KIWDLKTQQCVETHMAHTSECWGLAI----HNDL----VITTSTESQIKIWNLDLDKDMG 234
           K+WDL  ++C+ T   HTS   GL I     ND     +++   +  I +W+ ++ K   
Sbjct: 173 KVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCK 232

Query: 235 SKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKRE 294
                         Q+  S  F+   DG    Y    D   ++       E    L++  
Sbjct: 233 LL------KTLPVNQQVESCGFLKDGDGKRIIYTAGGDAIFQLI----DSESGSVLKRTN 282

Query: 295 KRLRDKGMADEKIQQNIKDSYVSVIM--HPFQTIRSPFKIKAATWAVTTTSKL------- 345
           K + +  +    +   + +S + +++     Q I     +K     +  TS +       
Sbjct: 283 KPIEELFII--GVLPILSNSQMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGII 340

Query: 346 -----------EMVLTTSNNTVEYYSIP-YQKREPTRPAPNKLYTIELQGHRTDVRSIDI 393
                      ++ L T++ ++    +P     E + P   ++Y    +GH   + S+D 
Sbjct: 341 ADMRYVGPELNKLALATNSPSLRIIPVPDLSGPEASLPLDVEIY----EGHEDLLNSLDA 396

Query: 394 SDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFD 452
           ++D   +ATAS + T  +W    ++C                                FD
Sbjct: 397 TEDGLWIATASKDNTAIVWRYNENSC-------------------------------KFD 425

Query: 453 LASSTLLENKEDAHGAAIWSLDL---TSDG--KRLVTGSADKTVKFWDFKVDQELIP-GT 506
           + +  +       H AA+ ++ L    S G  + L+T S D T+K W       +IP  T
Sbjct: 426 IYAKYI------GHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKW-------IIPKPT 472

Query: 507 VDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH 566
               V  +K+   T      DI A+ +S ++   A +  D T K++ L + +   +L  H
Sbjct: 473 ASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANH 532

Query: 567 KLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFS 626
           K  +  +      KLL TSS DK +KIW LD     K+L  H +++    F+ +     S
Sbjct: 533 KRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLIS 592

Query: 627 CSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           C  DGL+K WD    EC++ L  H + +WAL+  ND   +VS   D   + W
Sbjct: 593 CGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 155/629 (24%), Positives = 275/629 (43%), Gaps = 77/629 (12%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           E T L+  P+ + L     + +++I+ L SK ++ +     S + V+  D T T L+ G 
Sbjct: 62  EITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKV-SSPVYVMDCDETSTLLVIGG 120

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE----DWLISTS-KDGLIKIWDLKTQQ 191
            D  + I+D+      +  + H   I+ +    E    +WL+++   +G++KIWDL  ++
Sbjct: 121 TDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDLVKRR 180

Query: 192 CVETHMAHTSECWGLAI----HNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQS 247
           C+ T   HT+   GL         L+I+   +  I + + D  K    KL++    ++Q 
Sbjct: 181 CMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINLHHFDYKKT--CKLLKTLPVKQQI 238

Query: 248 KQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMADEKI 307
           +  G    FI   + + +    NA    +I  +++ ++I  + + +E+      ++ E  
Sbjct: 239 EACG----FIANHESLIYHAGDNA--VYQIVCLQSGKQIKSSQKPQEELFIIGVLSIENG 292

Query: 308 QQN---IKDSYV------SVIMHPFQTIRSPFKIKAATWAVTTT------SKLEMV-LTT 351
            ++   + D  +        +M    TI  P K K A    T          L+M+ L T
Sbjct: 293 SKHYLVLSDQTLFLLDIEQALMEEDTTI--PIKSKIAGNHGTIADMKFVGPNLDMLALAT 350

Query: 352 SNNTVEYYSIPYQKREPTR-PAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLK 409
           ++ T+     P    E  + P    +Y     GH   + ++D S+D   +ATAS + T+ 
Sbjct: 351 NSPTLRIIKAPQASEEDGQFPVETNMYG----GHVDLLNALDASEDGLWIATASKDHTVL 406

Query: 410 IWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAA 469
           +W       +  F+  YA   KF        +G+ G         ++  L N  D H   
Sbjct: 407 LWRYSEQ--LGDFK-QYA---KF--------IGHAGS-------VTAVALPNIMDQHFPN 445

Query: 470 IWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDIL 529
                       L++ S D TVK W  KV +     T D+ +P +K    T      DI 
Sbjct: 446 F-----------LLSSSTDMTVKKW--KVPKPTQNPTEDE-IPVVKTSEYTRRAHEKDIN 491

Query: 530 AVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADK 589
           A+ IS ++   A +  D T K++ L + +   +L  HK  +  +      KL+ T S DK
Sbjct: 492 ALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDK 551

Query: 590 NIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAA 649
            IKIW L+  +   +L  H +++  + F+ ++    SC  DGLVK WD    EC++ L A
Sbjct: 552 TIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDA 611

Query: 650 HQSEVWALAISNDARFVVSTSHDHSIRVW 678
           H + +WAL +++D    V+   D   + W
Sbjct: 612 HDNRIWALEVADDGDRFVTADADGLFQFW 640

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 92/206 (44%), Gaps = 11/206 (5%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L   P  ++ A    D   KIWDL++  ++     HK  +  + F      + + S D  
Sbjct: 493 LSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKT 552

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAH 199
           I IW L        L  H +++  I   N++  L+S   DGL+KIWD  T +C+ T  AH
Sbjct: 553 IKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAH 612

Query: 200 TSECWGLAIHN--DLVITTSTESQIKIWNLDLDKDMGSKLIEK--GIYEKQSKQRGVSVE 255
            +  W L + +  D  +T   +   + W  + +++    L +K   + ++QS Q      
Sbjct: 613 DNRIWALEVADDGDRFVTADADGLFQFWKDNSEEEHEQDLEKKRLKVEQEQSLQN----- 667

Query: 256 FITTSDGVNFFYI-QNADKTVEIFRV 280
           +++  D VN F +    D  + ++ V
Sbjct: 668 YLSKGDWVNAFLLAMTLDHPMRLYNV 693

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 80/177 (45%), Gaps = 11/177 (6%)

Query: 511 VPKLKIFHDTTLELNDD----ILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH 566
           + +LK  H+   ++N+D    I A+K++ D  +L     +  ++++ L S K   S+   
Sbjct: 42  IVQLKERHEIVHKINNDDEQEITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKVS 101

Query: 567 KLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE--SHNF 624
             PV  +D    S LL+    D ++ I+ ++ G    S   H   I SVKF  E    N+
Sbjct: 102 S-PVYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANW 160

Query: 625 FSCSKD--GLVKYWDGDKFECVQKLAAHQSEVWAL--AISNDARFVVSTSHDHSIRV 677
              S D  G+VK WD  K  C+  +  H + V  L   + +    ++S   D  I +
Sbjct: 161 LLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 62/125 (49%), Gaps = 6/125 (4%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK---FLPGG 436
           L  H+  +  +     +KL+AT S + T+KIW+++ +    T E G+    +   F+   
Sbjct: 525 LANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLE-GHTNAVQRISFINKN 583

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
             +V     G ++++D ++   L    DAH   IW+L++  DG R VT  AD   +FW  
Sbjct: 584 KQLVSCGADGLVKIWDCSTGECLRTL-DAHDNRIWALEVADDGDRFVTADADGLFQFWKD 642

Query: 497 KVDQE 501
             ++E
Sbjct: 643 NSEEE 647

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 83/200 (41%), Gaps = 22/200 (11%)

Query: 105 ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITG 164
           + KT       H+  I  L   P  +   + S D    IWDLV    +  L +HK    G
Sbjct: 475 VVKTSEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHK---RG 531

Query: 165 IW----CENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAI--HNDLVITTST 218
           +W    C+++  + + S D  IKIW L+      T   HT+    ++    N  +++   
Sbjct: 532 LWDVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGA 591

Query: 219 ESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIF 278
           +  +KIW    D   G  L     ++ +       +  +  +D  + F   +AD   + +
Sbjct: 592 DGLVKIW----DCSTGECLRTLDAHDNR-------IWALEVADDGDRFVTADADGLFQFW 640

Query: 279 RVRTQEEISKALRKREKRLR 298
           +  ++EE  + L K  KRL+
Sbjct: 641 KDNSEEEHEQDLEK--KRLK 658

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 146/651 (22%), Positives = 270/651 (41%), Gaps = 93/651 (14%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           E T LQ  P+   L     + ++KI++++ K  + +     S   V+  D T T L  G 
Sbjct: 63  EITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLK-ISSPSYVMSIDQTSTLLAVGG 121

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWC-------ENEDWLI-STSKDGLIKIWDLK 188
            D  + + D+      +  + H  +I+ +          NE WL+ S    G+IK+ D+ 
Sbjct: 122 TDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMV 181

Query: 189 TQQCVETHMAHTSECWGLAIH-------ND----LVITTSTESQIKIWNLDLDKDMGSKL 237
            ++C+ T   HTS   GL I        ND     +++   +  + +W  +L +   SKL
Sbjct: 182 KRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLRR--KSKL 239

Query: 238 IEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKR- 296
           I+     +Q +  G         +  +  Y   +D   +I  + + + + K L+  E+  
Sbjct: 240 IKTIPVYQQVEACG-----FLNGNYEDLIYTGGSDAIFQILSISSNKILKKTLKPIEELF 294

Query: 297 ----------------LRDKGMADEKIQQNIKD--SYVSVIMHPFQTIRSPFKIKAATWA 338
                           L D+ +    +++N+ +  +    + H    I +       T A
Sbjct: 295 IIGVLPILDNSKFYLVLSDQTLLLVDVEENMAEDENPSEYVDHTIIKIENSIAGNHGTIA 354

Query: 339 ---VTTTSKLEMVLTTSNNTVEYYSIPYQKREPTRPAPNKLYTIEL-----QGHRTDVRS 390
              V   +  ++ L T++ T+    IP  +      + + L  I +     +GH   + S
Sbjct: 355 DMRVVDPTLSKLALATNSPTLRI--IPISEANEEADSKDALSRIPIDVDMYEGHTDLLNS 412

Query: 391 IDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCKFLP-GGALVVVGNRGGDL 448
           +D ++D+  +ATAS + +  +W  + +A +      Y +  KFL    ++  VG      
Sbjct: 413 LDSTEDSLWIATASKDNSCILW--RYNAVLEK----YQIYAKFLGHASSVTAVG------ 460

Query: 449 QLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVD 508
                  + L +N  D                 ++T S D T+K W      + +    D
Sbjct: 461 -----LPNVLTKNYPD----------------YVITASNDSTIKKWKVPKPTKNLDNN-D 498

Query: 509 KFVP-KLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK 567
            F P ++K+   T    + DI A+ IS ++   A +  D T K++ L S     +L  HK
Sbjct: 499 SFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHK 558

Query: 568 LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
             +  +      K ++T+S DK IK+W LD     K+   H +++   +F+ +     SC
Sbjct: 559 RGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSC 618

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             DGL+K WD    EC++ L  H + +WAL++ ND   ++S   D   + W
Sbjct: 619 GADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 90/206 (43%), Gaps = 11/206 (5%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L   P  ++ A    D   KIWDL S  +      HK  +  + F      +++ S D  
Sbjct: 522 LSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKT 581

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
           I +W L     +     H +++    +   +  L+S   DGLIKIWD  + +C++T   H
Sbjct: 582 IKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGH 641

Query: 200 TSECWGLAIHN--DLVITTSTESQIKIWNLDLDKDMGSKLIEK---GIYEKQSKQRGVSV 254
           ++  W L++ N  D++I+   +   + W  D   +   K +EK    + ++QS Q  ++ 
Sbjct: 642 SNRIWALSVINDGDVIISADADGVFQFWR-DCTGENREKDLEKERLKVEQEQSLQNYLAN 700

Query: 255 EFITTSDGVNFFYIQNADKTVEIFRV 280
           E  T +    F      D  + +F V
Sbjct: 701 EDWTNA----FLLAMTLDHPLRLFNV 722

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 64/146 (43%), Gaps = 13/146 (8%)

Query: 525 NDD---ILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSL-YGHKLPVLSIDISFDSK 580
           NDD   I A+++S D K+L  +  +  +K++ +   KF  SL       V+SID +  S 
Sbjct: 58  NDDEQEITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLKISSPSYVMSIDQT--ST 115

Query: 581 LLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN-------FFSCSKDGLV 633
           LL     D ++ +  ++      S   H  +I +VKF  ++          FS    G++
Sbjct: 116 LLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMI 175

Query: 634 KYWDGDKFECVQKLAAHQSEVWALAI 659
           K  D  K  C+     H S +  L I
Sbjct: 176 KVCDMVKRRCLYTFQEHTSAIRGLDI 201

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 146/636 (22%), Positives = 269/636 (42%), Gaps = 105/636 (16%)

Query: 67  AVDAKSTKLAESTY-LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRF 125
            V  +S K++  +Y +   P + L+A+G  DG I + D+ +  +  +F GH   I+ L+F
Sbjct: 94  GVITRSLKVSSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKF 153

Query: 126 -DPTGTRL-ISGSKDSDII--IWDLVGEVGLYKLRSHKDSITGI-WCENEDW----LIST 176
               GT + + GS D++ +  +WDLV     + ++ H  +I GI + +N+D     LI+ 
Sbjct: 154 YGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITG 213

Query: 177 SKDGLIKIWDL----KTQQCVETHMAHTS-ECWGLAIHNDLVITTSTESQIKIWNLDLDK 231
            +D ++ +W      K+ + V+T  AH   E  G   HND     +         +DL++
Sbjct: 214 GRDNVLNLWRFNIKGKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLNE 273

Query: 232 DMGSKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALR 291
               K  +K I E       + +  +   +  N FY   +D+T+++ +  ++   SK+  
Sbjct: 274 SSVVKCTKKPIEE-------LFITGVIPINQGNQFYAVLSDQTIQLLQPNSEIFSSKSEF 326

Query: 292 KREKRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTT 351
            +             IQ+ I  ++ +V                A   + T +K  + L T
Sbjct: 327 IQ-------------IQEYIAGNHGTV----------------ADLCLVTKNKDCIALAT 357

Query: 352 SNNTVEYYSIP---YQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTL 408
           ++ ++    +P      ++   P    LY    +GH   + S+  ++D + LATAS    
Sbjct: 358 NSPSLRIIPLPKIDADTQDTDLPIEVNLY----EGHSDLLNSLACTEDGQWLATASKDKT 413

Query: 409 KI---WNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDA 465
            I   WN  +          + +   F+   A V               S+  L N  + 
Sbjct: 414 AILWHWNNTSKR--------FYIYATFVGHAASV---------------SAVCLPNVMEK 450

Query: 466 HGAAIWSLDLTSDGKRLVTGSADKTVKFWD---FKVDQELIPGTVDKFVPKLKIFHDTTL 522
           +             K ++T S D TVK W+    K D   +P     F+ K  I+     
Sbjct: 451 NYP-----------KYIITASNDLTVKKWEIPPMKNDLNEVP-----FIVKSSIYTRHAH 494

Query: 523 ELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLL 582
           E   DI A+ ++ ++   A +  D T K++ +++ +   +L  HK  +  +      K +
Sbjct: 495 E--KDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWI 552

Query: 583 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFE 642
            T S DK +KIW L+     K+L  H +++    F+ +     S   DGL+K WD    +
Sbjct: 553 ATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGD 612

Query: 643 CVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           C++ L  H + +WAL++  D   ++S   D   + W
Sbjct: 613 CIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFW 648

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 84/175 (48%), Gaps = 11/175 (6%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFE--CGYALTCKFLPGGA 437
           L  H+  +  +   +  K +AT S + T+KIW++++   ++T E        C F+    
Sbjct: 533 LANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQK 592

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +V     G ++++D+AS   ++N  D H   IW+L +  DG  +++  AD   +FW   
Sbjct: 593 QLVSAGADGLIKVWDIASGDCIKNL-DGHSNRIWALSVLEDGDLIISADADSVFQFWKDC 651

Query: 498 VDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVF 552
            + E I G +++   +++     T  +N+   +      N FL    LD+ +++F
Sbjct: 652 TEAE-IQGALEENKVRVEQEQSLTNYMNNGEWS------NAFLLALQLDHPMRLF 699

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 87/201 (43%), Gaps = 20/201 (9%)

Query: 104 LISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSIT 163
            I K+ +   + H+  I  +   P  +   + S D    +W++     +  L +HK    
Sbjct: 482 FIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHK---R 538

Query: 164 GIW----CENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHN--DLVITTS 217
           G+W    CE+E W+ + S D  +KIW L++   ++T   HT+     +  N    +++  
Sbjct: 539 GLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAG 598

Query: 218 TESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEI 277
            +  IK+W      D+ S    K +    ++   +SV      DG +     +AD   + 
Sbjct: 599 ADGLIKVW------DIASGDCIKNLDGHSNRIWALSV----LEDG-DLIISADADSVFQF 647

Query: 278 FRVRTQEEISKALRKREKRLR 298
           ++  T+ EI  AL + + R+ 
Sbjct: 648 WKDCTEAEIQGALEENKVRVE 668

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 5/109 (4%)

Query: 90  LAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGE 149
           +A    D  +KIW L S TVL    GH +A+    F     +L+S   D  I +WD+   
Sbjct: 552 IATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASG 611

Query: 150 VGLYKLRSHKDSITGIWC-ENEDWLISTSKDGLIKIWDLKTQQCVETHM 197
             +  L  H + I  +   E+ D +IS   D + + W    + C E  +
Sbjct: 612 DCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFW----KDCTEAEI 656

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 71/178 (39%), Gaps = 9/178 (5%)

Query: 509 KFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKL 568
           + +P  K+ H        +I  + ++ D K+L        VK+  + +     SL     
Sbjct: 46  QLIPNRKLLHSIDNADEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSS- 104

Query: 569 PVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE-SHNFF-- 625
           P   +     S L+     D +I +  ++ G    S   H  +I S+KF  E   N +  
Sbjct: 105 PSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLL 164

Query: 626 -SCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS-NDARFV---VSTSHDHSIRVW 678
            S   +G+ K WD    +C   +  H S +  +  + ND + V   ++   D+ + +W
Sbjct: 165 GSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLW 222

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 150/645 (23%), Positives = 254/645 (39%), Gaps = 128/645 (19%)

Query: 71  KSTKLAESTYLQYHPETN-LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTG 129
           +S K++  +Y+     T+ L+AVG  DG I + D+ +  V  +F GH   I+ L+F    
Sbjct: 126 RSMKISSPSYIMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKF---- 181

Query: 130 TRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTS-KDGLIKIWDLK 188
                G  +S++                              WL+++   +G+IK+W+L 
Sbjct: 182 ----FGEANSNV------------------------------WLLASGDTNGMIKVWNLV 207

Query: 189 TQQCVETHMAHTSECWGL---AIHNDL------VITTSTESQIKIWNLDLDKDMGSKLIE 239
           T++C  T   HTS   G+   +I +D       +I+   +  +  W LD  K    KL++
Sbjct: 208 TRKCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWELDNKKK--CKLLQ 265

Query: 240 KGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLR- 298
                +Q +Q G    FI +    N  Y    D  ++   +     + K+ +  E+    
Sbjct: 266 TIPAHQQVEQCG----FIASPGHKNLIYTSGGDAIMQFISLEKGSIVKKSKKPIEELFII 321

Query: 299 -----DKG------MADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWA--VTTTSKL 345
                 +G      M+D+ +     +S +        T  S       T A  V    K 
Sbjct: 322 GVLPISQGEKLISVMSDQSLHYLDVESNLKATNEEELTYESALAGNHGTIADMVFVGPKF 381

Query: 346 E-MVLTTSNNTVEYYSIPYQKREPTRPAPNKLYTIEL---QGHRTDVRSIDISDDNKLLA 401
           + + L T++ T+     P    + +    N L  I++   +GH   + ++D ++D   LA
Sbjct: 382 QHLALATNSPTLRIIPTPL---DDSTVDTNNLLPIDVDMYEGHEDLLNAVDATEDGLWLA 438

Query: 402 TAS-NGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLE 460
           TAS + T  +W                 T KF P    +                     
Sbjct: 439 TASKDKTAIVWRYDDE------------TAKFKPYAKFI--------------------- 465

Query: 461 NKEDAHGAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFKVDQELIPGTVDKF--VPK 513
                H +++ ++ L +   R     L+T S D T+K W+       IP   DK   +  
Sbjct: 466 ----GHSSSVTAVGLPNVMLRHWPEFLLTASNDLTIKKWN-------IPKPSDKMEGIHL 514

Query: 514 LKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSI 573
           +K    T      DI A+ +S ++   A +  D T K++ L + +   +L  HK  +  +
Sbjct: 515 IKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELTATLANHKRGLWDV 574

Query: 574 DISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLV 633
                 KLL T S DK IKIW LD     ++L  H +++    F+ +     S   DGL+
Sbjct: 575 SFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLI 634

Query: 634 KYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           K WD    ECV+ L  H + +WAL I  D   + S   D   + W
Sbjct: 635 KIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQFW 679

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 9/208 (4%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L   P  ++ A    D   KIWDL +  +      HK  +  + F      L + S D  
Sbjct: 532 LSVSPNDSVFATASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKT 591

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
           I IW L     +  L  H +++    +   +  L+S+  DGLIKIWD  + +CV+T   H
Sbjct: 592 IKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGH 651

Query: 200 TSECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSVE-F 256
            +  W L I  D  L+ +   +   + W  D  +    + +E+   EK+  ++  S++ +
Sbjct: 652 ANRIWALTIQRDGELIASADADGVFQFWT-DCSEQQREQDLER---EKELVEQEQSLQNY 707

Query: 257 ITTSDGVNFFYIQ-NADKTVEIFRVRTQ 283
           +   D  N F +    D  + +F V  Q
Sbjct: 708 LANEDWANAFLLAITLDHPMRLFNVLRQ 735

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 67/146 (45%), Gaps = 14/146 (9%)

Query: 48  WDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISK 107
           WD++TGEL+  L +             L + ++ QY     LLA    D  IKIW L + 
Sbjct: 553 WDLETGELTATLAN---------HKRGLWDVSFCQY---DKLLATCSGDKTIKIWSLDTF 600

Query: 108 TVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWC 167
           +V+    GH +A+    F    T+L+S   D  I IWD      +  L  H + I  +  
Sbjct: 601 SVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTI 660

Query: 168 ENEDWLISTS-KDGLIKIW-DLKTQQ 191
           + +  LI+++  DG+ + W D   QQ
Sbjct: 661 QRDGELIASADADGVFQFWTDCSEQQ 686

 Score = 32.0 bits (71), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 80/196 (40%), Gaps = 31/196 (15%)

Query: 470 IWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDIL 529
           I +L LT+DGK L   S  + +K        E+  G V +           +++++    
Sbjct: 93  ITALKLTADGKYLCFTSQAQLLKI------VEVATGKVMR-----------SMKISSPSY 135

Query: 530 AVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH--KLPVLSIDISFDSKLLITSSA 587
            +   + +  +AV   D ++ V  + +     S  GH   +  L      +S + + +S 
Sbjct: 136 IMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASG 195

Query: 588 DKN--IKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN-------FFSCSKDGLVKYWDG 638
           D N  IK+W L    C  ++  H  ++  +     S +         S  +D +V YW+ 
Sbjct: 196 DTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWEL 255

Query: 639 D---KFECVQKLAAHQ 651
           D   K + +Q + AHQ
Sbjct: 256 DNKKKCKLLQTIPAHQ 271

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 148/639 (23%), Positives = 263/639 (41%), Gaps = 94/639 (14%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           E T L+  P+   L       ++KI+ L +  V+ +     S   +L  D T T L  G 
Sbjct: 63  EITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMK-ISSPSYILDADSTSTLLAVGG 121

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGI----WCENEDWLISTS-KDGLIKIWDLKTQQ 191
            D  II+ D+      +  + H  +I+ +      +++ WL+++   +G++K+WDL  ++
Sbjct: 122 TDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVKRK 181

Query: 192 CVETHMAHTSECWGLAI----HND----LVITTSTESQIKIWNLDLDKDMGSKLIEKGIY 243
           C+ T   H+S   GL I    ++D     +++   +  I IW+ ++ K    KLI+    
Sbjct: 182 CLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIWDFNMKKT--CKLIKTLPV 239

Query: 244 EKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKR------- 296
            +Q +  G    F+   D  +  Y    D   ++  + +   I K  +  E+        
Sbjct: 240 NQQVESCG----FLRYHDDKHLIYTAGGDAIFQLIDLESGIMIKKTNKPIEELFIIGVLP 295

Query: 297 ----------LRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLE 346
                     + D+ +    +++ IK    + I+    TI     I A    V      +
Sbjct: 296 IVSSSKMFLVMSDQTLQLINVEEVIKSE--NEIIEVSSTIAGNHGIIADMRFVGPELN-K 352

Query: 347 MVLTTSNNTVEYYSIP-YQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS- 404
           + L T++ ++    IP       + P   ++Y    +GH   + S+D ++D   +ATAS 
Sbjct: 353 LALATNSPSLRIIPIPDLAGTTASLPLDVEIY----EGHEDLLNSLDATEDGLWIATASK 408

Query: 405 NGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKED 464
           + +  +W  K +   R FE                                   + +K  
Sbjct: 409 DNSAIVW--KYNENTRKFE-----------------------------------VYSKYI 431

Query: 465 AHGAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHD 519
            H +A+ ++ L     +     L+T S D T+K W  K+ +   P  V      +K+   
Sbjct: 432 GHSSAVTAVGLPKIMPKGYPEFLLTASNDLTIKKW--KIPKPTFPFDVQT----IKVSEY 485

Query: 520 TTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDS 579
           T      DI A+ IS ++   A +  D T K++ L + +   +L  HK  +  +      
Sbjct: 486 TRHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYD 545

Query: 580 KLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGD 639
           KLL T S DK +KIW LD     K+L  H +++    F+ +     SC  DGL+K WD  
Sbjct: 546 KLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCS 605

Query: 640 KFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             EC++ L  H + +WAL   ND   +VS   D   + W
Sbjct: 606 SGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFW 644

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 111/271 (40%), Gaps = 33/271 (12%)

Query: 64  PPGAVDAKSTKLAEST---------YLQYHPETNLLAVGYADGVIKIWDLISKTVLINFN 114
           P    D ++ K++E T          L   P  ++ A    D   KIW+L +  +    +
Sbjct: 471 PTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLS 530

Query: 115 GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWL 173
            HK  +  + F      L + S D  + IW L     +  L  H +++    +   +  L
Sbjct: 531 NHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQL 590

Query: 174 ISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHN--DLVITTSTESQIKIWNLDLDK 231
           +S   DGLIKIWD  + +C++T   H +  W L   N  D++++   +   + W    D 
Sbjct: 591 VSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFWK---DC 647

Query: 232 DMGSKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYI-QNADKTVEIFRVRTQEEISKAL 290
               K  E+   + Q +Q      +I+  D  N F +    D  + +F V     + KAL
Sbjct: 648 TEQEKEEEQEKAKLQVEQEQSLQNYISQGDWTNAFLLAMTLDHPMRLFNV-----LKKAL 702

Query: 291 RKREKRLRDKGMADEKIQQNIKDSYVSVIMH 321
              E RLR          Q+IK+   SV+ +
Sbjct: 703 --GESRLR----------QDIKEGESSVVFN 721

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 82/188 (43%), Gaps = 18/188 (9%)

Query: 501 ELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFF 560
           +L PG+ +       I H  + E   +I A+K++ D ++L        +K+F L + K  
Sbjct: 44  DLTPGSRN-------IIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVV 96

Query: 561 LSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE 620
            S+     P   +D    S LL     D +I +  ++ G    S   H  +I S+KF  +
Sbjct: 97  RSMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQ 155

Query: 621 SHN----FFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAI----SNDARF--VVSTS 670
             +      S   +G+VK WD  K +C+  L  H S V  L I    ++D  F  ++S  
Sbjct: 156 LDSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGG 215

Query: 671 HDHSIRVW 678
            D  I +W
Sbjct: 216 RDDIINIW 223

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  125 bits (315), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 142/635 (22%), Positives = 258/635 (40%), Gaps = 92/635 (14%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKD 138
           T L+  P+   L     + +++ +DL +K    +      A  VL  D + T L  G  D
Sbjct: 64  TALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAY-VLDCDESSTLLAVGGTD 122

Query: 139 SDIIIWDLVGEVGLYKLRSHKDSITGIWCENE----DWLISTS-KDGLIKIWDLKTQQCV 193
             + ++D+      + L+ H  +I+ +    E     WL+++   +G++KIWDL  ++C+
Sbjct: 123 GSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRRCI 182

Query: 194 ETHMAHTSECWGLAIH-----NDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSK 248
            T   HT+   GL I        L+++   +  + + + D+ K    KL++    ++Q +
Sbjct: 183 HTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDMKKK--CKLLQTIPVKRQIE 240

Query: 249 QRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMADEKIQ 308
             G    FI   D  +  Y    D   +I  +    E  K++++  + + +  +      
Sbjct: 241 SCG----FI--GDNTSLIYTAGGDAVYQIISL----ESGKSIKQTAQPVEELFIVGVLPV 290

Query: 309 QNIKDSYVSV---------IMHPFQTIRSPFKI-KAATWAVTTTSKLEMVLTTSNNTVEY 358
           QN    Y+ +         +           +I K       T + + +V  + N     
Sbjct: 291 QNSTKCYLVLSDQTLFLIDVEKALSQTEKMIEIEKKIAGNHGTIADMRLVGPSLNRLALA 350

Query: 359 YSIPYQKREPTRPAPNKLYTIELQ-----GHRTDVRSIDISDDNKLLATASNGTLKIWNI 413
            + P  +  PT  A      +E++     GH   + S+D + D   LATAS         
Sbjct: 351 TNSPTLRIIPTPQASEDKEVMEIETEMYEGHTDLLNSLDATSDGLWLATAS--------- 401

Query: 414 KTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLE-NKEDAHGAAIWS 472
           K H+ I                            L  ++ ASS+     K   H   + +
Sbjct: 402 KDHSVI----------------------------LWRYNEASSSFEPFTKFLGHAGPVTA 433

Query: 473 LDLTSDGKR-----LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKL----KIFHDTTLE 523
           + L +   R     L+T S D T+K W        +P   D+   +L    K    T   
Sbjct: 434 IALPNVMNRNWPEFLLTASNDLTIKRWK-------VPNPNDRKAIELPHIVKASEYTRRA 486

Query: 524 LNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLI 583
              DI A+ +S ++   A +  D T K++ +++ +   +L  HK  +  +       LL 
Sbjct: 487 HEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLA 546

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFEC 643
           T S D++I +W L+     K+L  H +++  V F+  +    S   DGLVK WD    EC
Sbjct: 547 TCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGEC 606

Query: 644 VQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           V+ L AH + +WALA++ND + +++   D   + W
Sbjct: 607 VRTLDAHNNRIWALAVANDGQLIITADADGVFQFW 641

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 96/212 (45%), Gaps = 14/212 (6%)

Query: 85  PETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIW 144
           P  ++ A    D   KIW++ +  V      HK  +  + F      L + S D  I +W
Sbjct: 498 PNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLW 557

Query: 145 DLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSEC 203
            L     L  L  H +++  + +      L+ST  DGL+KIWD  T +CV T  AH +  
Sbjct: 558 SLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRI 617

Query: 204 WGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEK---GIYEKQSKQRGVSVEFIT 258
           W LA+ ND  L+IT   +   + W  D  ++   + IE+    + ++QS Q      +I+
Sbjct: 618 WALAVANDGQLIITADADGVFQFWE-DNSEEEHERNIEQEKLRVEQEQSLQN-----YIS 671

Query: 259 TSDGVNFFYI-QNADKTVEIFRVRTQEEISKA 289
             D  N F +    D  + ++ V  +  I+KA
Sbjct: 672 EGDWNNAFLLAMTLDHPMRLYHV-LERAIAKA 702

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 97/494 (19%), Positives = 189/494 (38%), Gaps = 87/494 (17%)

Query: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRF---DPTGTRLISGSKDSDIII-- 143
           LLA G  +G++KIWDL+ +  +     H +A+  L     +   + L+SG +D  + +  
Sbjct: 161 LLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHH 220

Query: 144 WDLVGEVGLYKLRSHKDSI--TGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS 201
           +D+  +  L +    K  I   G   +N   + +   D + +I  L++ + ++       
Sbjct: 221 FDMKKKCKLLQTIPVKRQIESCGFIGDNTSLIYTAGGDAVYQIISLESGKSIKQTAQPVE 280

Query: 202 ECWGLAIHNDLVITTSTESQI-----KIWNLDLDKDMGS--KLIEKGIYEKQSKQRGVSV 254
           E + + +   L +  ST+  +      ++ +D++K +    K+IE  I +K +   G   
Sbjct: 281 ELFIVGV---LPVQNSTKCYLVLSDQTLFLIDVEKALSQTEKMIE--IEKKIAGNHGTIA 335

Query: 255 EFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKR-------LRDKGMADEKI 307
           +       +N   +     T+ I       E  + +    +        L       + +
Sbjct: 336 DMRLVGPSLNRLALATNSPTLRIIPTPQASEDKEVMEIETEMYEGHTDLLNSLDATSDGL 395

Query: 308 QQNIKDSYVSVIMHPFQTIRSPFK------------IKAATWAVTTTSKLEMVLTTSNN- 354
                    SVI+  +    S F+               A   V   +  E +LT SN+ 
Sbjct: 396 WLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDL 455

Query: 355 TVEYYSIPYQKREPTRPAPNKLYTIEL--QGHRTDVRSIDISDDNKLLATAS-NGTLKIW 411
           T++ + +P          P+ +   E   + H  D+ +I +S ++ + ATAS + T KIW
Sbjct: 456 TIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIW 515

Query: 412 NIKTHACIRTFE-----------CGY---ALTCK-------------------------- 431
           N+ T     T             C Y     TC                           
Sbjct: 516 NVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAV 575

Query: 432 ----FLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSA 487
               F+ G   +V     G ++++D ++   +    DAH   IW+L + +DG+ ++T  A
Sbjct: 576 QRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTL-DAHNNRIWALAVANDGQLIITADA 634

Query: 488 DKTVKFWDFKVDQE 501
           D   +FW+   ++E
Sbjct: 635 DGVFQFWEDNSEEE 648

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 65/148 (43%), Gaps = 5/148 (3%)

Query: 516 IFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI 575
           I H    E   D+ A++++ D ++L  +  +  ++ + L + +   S+     P   +D 
Sbjct: 51  IIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISS-PAYVLDC 109

Query: 576 SFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN----FFSCSKDG 631
              S LL     D ++ ++ +  G    SL  H  +I SVKF  E  +      S   +G
Sbjct: 110 DESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNG 169

Query: 632 LVKYWDGDKFECVQKLAAHQSEVWALAI 659
           +VK WD  K  C+  +  H + V  L I
Sbjct: 170 MVKIWDLVKRRCIHTVQEHTAAVRGLDI 197

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 154/654 (23%), Positives = 253/654 (38%), Gaps = 110/654 (16%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           E T L+  P+   L       +++++ L SK ++ +     S + V+  D T T L  G 
Sbjct: 82  EITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKV-SSPVYVMECDVTSTLLAIGG 140

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE----DW-LISTSKDGLIKIWDLKTQQ 191
            D  + I D+      +  + H  +I+ +    E     W L S    G++KIWDL  ++
Sbjct: 141 TDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWDLVKRK 200

Query: 192 CVETHMAHTSECWGLAIHNDLVITTSTESQIK--------IWNL-DLDKDMGSKLIEKGI 242
           C+ T   HT    GL    D  +    E Q++        I NL   D     KL++   
Sbjct: 201 CLHTVQEHTMAVRGL----DFRVLDEDEDQMQLISGGRDNIINLYQFDSRKKCKLLKTLP 256

Query: 243 YEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKG- 301
             +Q +  G    FI T    N  Y   +D   +I  + T   I K  +  E+ L   G 
Sbjct: 257 IHQQVESCG----FINTGGVQNCVYTAGSDAVYQIVSLDTGSVIRKTAQPIEE-LFIIGV 311

Query: 302 ---MADEKIQQNIKDSYV------SVIMHPFQTIRSPFKIKAATWAVT----TTSKLE-M 347
              +   K+   + D  +      + I +  + I    KI      +        KL+ +
Sbjct: 312 LPILEGSKMFLILSDQTLFLIDVEAAIANEDEIIDIELKIAGNHGTIADMRFVGPKLDKL 371

Query: 348 VLTTSNNTVEYYSIPY---------------QKREPTRPAPNKLYTIELQGHRTDVRSID 392
            L T++ T+    +P                QK E   P   ++Y    +GH   + S+D
Sbjct: 372 ALATNSPTLRVIPVPVYGNEEEERDEEMEDDQKEEIQLPIEVEMY----EGHEDLLNSLD 427

Query: 393 ISDDNKLLATASNGTLKI-WNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLF 451
            ++D   LATAS     I W       +      +    KF+                  
Sbjct: 428 ATEDGMWLATASKDNFVILWRYDEQTEL------FKQYAKFV------------------ 463

Query: 452 DLASSTLLENKEDAHGAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFKVDQELIPGT 506
                         H   + ++ L +   R     L++ S D T+K W        +P  
Sbjct: 464 -------------GHAGPVTAVGLPNVMNRPWPEFLLSASNDLTIKKW-------AVPKP 503

Query: 507 VD--KFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLY 564
            D    V  +K    T      DI A+ +S ++   A +  D T K++ L++ +   +L 
Sbjct: 504 EDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLA 563

Query: 565 GHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNF 624
            HK  +  ++     KLL T S DK +KIW LD     K+L  H +++    F+ ++   
Sbjct: 564 NHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQL 623

Query: 625 FSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            S   DGLVK WD    ECV+ L AH + +WAL++  D   +V+   D   + W
Sbjct: 624 VSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 62/140 (44%), Gaps = 8/140 (5%)

Query: 525 NDD---ILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL 581
           NDD   I A++I+ D +FL        ++V+ L S K   S+     PV  ++    S L
Sbjct: 77  NDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSS-PVYVMECDVTSTL 135

Query: 582 LITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN----FFSCSKDGLVKYWD 637
           L     D ++ I  ++ G    S   H  +I SVKF  E ++      S    G+VK WD
Sbjct: 136 LAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWD 195

Query: 638 GDKFECVQKLAAHQSEVWAL 657
             K +C+  +  H   V  L
Sbjct: 196 LVKRKCLHTVQEHTMAVRGL 215

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 146/642 (22%), Positives = 259/642 (40%), Gaps = 112/642 (17%)

Query: 76  AESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISG 135
           A+  YL +  +  LL         KI+DL    ++ +     S   V+  D T T L  G
Sbjct: 70  ADGRYLCFASQAQLL---------KIFDLREGKIVRSMK-ISSPSYVVDSDSTSTLLAIG 119

Query: 136 SKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENED----WLISTS-KDGLIKIWDLKTQ 190
             D  I + D+      + L+ H  +I+ +    E     WL+++   +G++KIWDL  +
Sbjct: 120 GTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKR 179

Query: 191 QCVETHMAHTSECWGLAIH----ND----LVITTSTESQIKIWNLDLDKDMGSKLIEKGI 242
           +C+ T   HT+   G+  H    ND     +I+   +  I  W  +L K     L++   
Sbjct: 180 KCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLKKK--CTLLKTLP 237

Query: 243 YEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRD--- 299
             +Q +  G +             Y   +D  +++  +    E  KA+++  K + +   
Sbjct: 238 VSQQVESCGFA--------NSELIYTAGSDAFLQLISL----ESGKAVKRTHKPVEELFT 285

Query: 300 ----KGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVT---TTSKLEMV---- 348
                 +   K+   I D  +++I            I+  ++      T + +  V    
Sbjct: 286 VGVLSILGGSKLYMVISDQTLALINLEEALESESALIEVESYIAGNHGTIADMNFVGPEL 345

Query: 349 --LTTSNNTVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-N 405
             L  + N+     IP    E   P   +LY    +GH+  + ++D ++D   LATAS +
Sbjct: 346 DKLALATNSPTLRIIPV-SMEGGLPIDVELY----EGHKDLLNAVDATEDGLWLATASKD 400

Query: 406 GTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDA 465
            T  +W  +++            + KF+P                           K + 
Sbjct: 401 STAILWWYQSN------------SNKFVPYA-------------------------KFEG 423

Query: 466 HGAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFKVDQELIPGTV---DKF-VPKLKI 516
           H +A+ ++ L +   +     ++T S D TVK W        +P  V   + F +  +K+
Sbjct: 424 HSSAVTAVGLPNIMHKGWPEFILTASNDLTVKKW-------AVPKPVASNESFELQVVKV 476

Query: 517 FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDIS 576
              T      DI A+ ++ ++   A +  D T KV+ L S +   +L  H+  +  +   
Sbjct: 477 SEYTRRAHEKDINALSVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFC 536

Query: 577 FDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYW 636
              +L+ T S DK IKIW LD     K+   H +++    F+ +     S S DGLVK W
Sbjct: 537 QYERLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIW 596

Query: 637 DGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           D    ECV+ L  H + +WAL ++ D   +VS   D   + W
Sbjct: 597 DCSTGECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFW 638

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 109/499 (21%), Positives = 202/499 (40%), Gaps = 82/499 (16%)

Query: 80  YLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRF------DPTGTRLI 133
           Y + + E  LLA G  +G++KIWDL+ +  +     H +A+  + F      D +   LI
Sbjct: 152 YGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLI 211

Query: 134 SGSKDSDIIIW--DLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQ 191
           SG +D  I  W  +L  +  L K       +      N + + +   D  +++  L++ +
Sbjct: 212 SGGRDDVINYWQFNLKKKCTLLKTLPVSQQVESCGFANSELIYTAGSDAFLQLISLESGK 271

Query: 192 CVETHMAHTSECWGLAIHNDL----VITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQS 247
            V+       E + + + + L    +    ++  + + NL+   +  S LIE   Y   +
Sbjct: 272 AVKRTHKPVEELFTVGVLSILGGSKLYMVISDQTLALINLEEALESESALIEVESYIAGN 331

Query: 248 KQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQE--EISKALRKREKRLRDKGMADE 305
                 + F+     ++   +     T+ I  V  +    I   L +  K L +   A E
Sbjct: 332 HGTIADMNFVGPE--LDKLALATNSPTLRIIPVSMEGGLPIDVELYEGHKDLLNAVDATE 389

Query: 306 K---IQQNIKDSYVSVIMHPFQTIRSPF----KIKAATWAVTTTSKL--------EMVLT 350
               +    KDS  + I+  +Q+  + F    K +  + AVT             E +LT
Sbjct: 390 DGLWLATASKDS--TAILWWYQSNSNKFVPYAKFEGHSSAVTAVGLPNIMHKGWPEFILT 447

Query: 351 TSNN-TVEYYSIP------------------YQKREPTRP------APN----------- 374
            SN+ TV+ +++P                  Y +R   +       APN           
Sbjct: 448 ASNDLTVKKWAVPKPVASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFATASYDK 507

Query: 375 --KLYTIE-------LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFE- 423
             K++ +E       L  HR  +  +      +L+AT S + T+KIW++ T A ++TFE 
Sbjct: 508 TCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFEG 567

Query: 424 -CGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRL 482
                  C F+     +V  +  G ++++D ++   ++   D H   IW+L +  DG  +
Sbjct: 568 HTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTL-DGHTNRIWALCVAEDGDLI 626

Query: 483 VTGSADKTVKFWDFKVDQE 501
           V+  AD   +FW    +QE
Sbjct: 627 VSADADGVFQFWKDSTEQE 645

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 91/209 (43%), Gaps = 11/209 (5%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L   P  +  A    D   K+WDL S  V      H+  +  + F      + + S D  
Sbjct: 491 LSVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKT 550

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
           I IW L     +     H +++    +   +  L+S+S DGL+KIWD  T +CV+T   H
Sbjct: 551 IKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGH 610

Query: 200 TSECWGLAIH--NDLVITTSTESQIKIW--NLDLDKDMGSKLIEKGIYEKQSKQRGVSVE 255
           T+  W L +    DL+++   +   + W  + + ++   ++     + ++QS Q      
Sbjct: 611 TNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQEQSLQN----- 665

Query: 256 FITTSDGVNFFYIQ-NADKTVEIFRVRTQ 283
           +++  D  N F +    D  + +FRV  Q
Sbjct: 666 YLSQGDWTNAFLLAITLDHPLRLFRVLKQ 694

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 79/180 (43%), Gaps = 11/180 (6%)

Query: 509 KFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKL 568
           + VP+ K       +   DI A+K+++D ++L  +     +K+F L   K   S+     
Sbjct: 44  QLVPERKTLFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISS- 102

Query: 569 PVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN----F 624
           P   +D    S LL     D +I +  ++ G    SL  H  +I SVKF  E +      
Sbjct: 103 PSYVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLL 162

Query: 625 FSCSKDGLVKYWDGDKFECVQKLAAHQSEVWAL----AISNDAR--FVVSTSHDHSIRVW 678
            S   +G+VK WD  K +C+  +  H + V  +    + +ND    F++S   D  I  W
Sbjct: 163 ASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYW 222

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 140/633 (22%), Positives = 256/633 (40%), Gaps = 81/633 (12%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDL----ISKTVLINFNGHKSAITVLRFDPTGTRL 132
           E T L+  P+   L+    + ++KI+ L      +  +I      S   ++  D T T +
Sbjct: 62  EITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDSTSTLV 121

Query: 133 ISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI----WCENEDWLI-STSKDGLIKIWDL 187
             G  D  I + D+      + L+ H  +I+ +       +  WL+ S   +G++K+WDL
Sbjct: 122 ALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDL 181

Query: 188 KTQQCVETHMAHTSECWGLAIHND----LVITTSTESQIKIWNLDLDKDMGSKLIEKGIY 243
             ++C+ T   H++   GL +        +I+   ++   +WN +L K     L++    
Sbjct: 182 VKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKK--CTLLKTIPV 239

Query: 244 EKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKR------- 296
            +Q +  G    FI   +  +  Y    D  ++   +     I K  +  E+        
Sbjct: 240 HQQVESCG----FIN-HEHDDLIYTAGGDALLQFISLEKATMIKKTKKHIEELFIIGVLP 294

Query: 297 ----------LRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLE 346
                     + D+ +    I+ N+ +    +I    ++  +      A       +  +
Sbjct: 295 ILENDKMYLVMSDQTLELVDIKSNLLNESSDII--EIESCIAGNNGTIADMKFVGPNHDK 352

Query: 347 MVLTTSNNTVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-N 405
           + L T++ T+    +P  ++E   P   ++Y    +GH   + S+D +DD   +ATAS +
Sbjct: 353 LALATNSPTLRIIPVPSSEQEEL-PINVEMY----EGHEDLLNSLDTTDDGLWMATASKD 407

Query: 406 GTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDA 465
            T  +W  K ++ I  F+  Y    KF+   A V                          
Sbjct: 408 HTAIVW--KYNSIINKFQ-PYV---KFIGHSATVT------------------------- 436

Query: 466 HGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELN 525
               + ++ L    + L+T S D T+K W           TV++    +K+   T     
Sbjct: 437 -AVGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPST----TVEEDCQIVKVSEYTRRAHE 491

Query: 526 DDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585
            DI A+ IS ++   A +  D T K++ L + +   +L  HK  +  +      KL+ T 
Sbjct: 492 KDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATC 551

Query: 586 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQ 645
           S DK IKIW LD     K+L  H +++    F+ +     S   DGL+K WD    +C++
Sbjct: 552 SGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLK 611

Query: 646 KLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            L  H + +WAL   ND   +VS   D   + W
Sbjct: 612 TLDGHDNRIWALTEINDGDMIVSADADGVFQFW 644

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 93/207 (44%), Gaps = 15/207 (7%)

Query: 482 LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLA 541
           + T SAD TV       D E+I  T     P+ ++ H    +   +I A+K++ D ++L+
Sbjct: 22  IATVSADGTVLATPILDDIEIISLTT----PQRRL-HSIANDDEQEITALKLTPDAQYLS 76

Query: 542 VSLLDNTVKVFFLNSMKF----FLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD 597
               +  +K+F L+  K      +       P   +D    S L+     D +I +  ++
Sbjct: 77  FISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDSTSTLVALGGTDGSITVVDIE 136

Query: 598 FGDCHKSLFAHQDSIMSVKFVPESHN--FFSCSKD--GLVKYWDGDKFECVQKLAAHQSE 653
            G    SL  H  +I ++KF  ++++  +  CS D  G+VK WD  K +C+  +  H + 
Sbjct: 137 NGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNA 196

Query: 654 VWALAIS--NDARFVVSTSHDHSIRVW 678
           V  L +    D   ++S   D+   +W
Sbjct: 197 VRGLDVREVGDEWQLISGGRDNVCTLW 223

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 148/651 (22%), Positives = 269/651 (41%), Gaps = 121/651 (18%)

Query: 71  KSTKLAESTYLQYHPETN-LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRF---- 125
           K+ KL+  +Y+     T+ L+AVG  DG I + D+ +  +  +F GH   I+ ++F    
Sbjct: 113 KTLKLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNN 172

Query: 126 DPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITG-----IWCENED---WLISTS 177
           D     L SG  +  + IWDLV    ++ L+ H  ++ G     +  EN++    L+S S
Sbjct: 173 DTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGS 232

Query: 178 KDGLIKIWDLKTQQCVE----THMAHTSECWGLAIHN------DLVITTSTESQIKIWNL 227
           +D ++ +W+   ++  +      +    E  G  IH+      D++ T   E+  ++ +L
Sbjct: 233 RDNIVNLWEFNLRKLCKLLKTLPVNQQVESCGF-IHDHDNELQDIIYTAGGEAIFQLISL 291

Query: 228 DLDKDMGSKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEIS 287
                    +I++ +   +      ++ F  T++ +N  YI  +D+T+++        ++
Sbjct: 292 S-----KGSVIKRTVKPTEELFIIGTLPFTATNNDLN-SYIVMSDQTLQMIN------LT 339

Query: 288 KALRKREKRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWA---VTTTSK 344
           KAL   E                        + +P   I S       T A         
Sbjct: 340 KALSPTE------------------------LSNPIIEIESCIAGNHGTIADMKFVGQDL 375

Query: 345 LEMVLTTSNNTVEYYSIPYQKREPTRP--------APNKLYTIELQGHRTDVRSIDISDD 396
            ++ L T++ T+    +P   +E   P         P  + T E  GH   + S+  ++D
Sbjct: 376 NKLALATNSPTLRIIPVPSTMKEAADPNTQDNSADLPINMETYE--GHTDLLNSLAATED 433

Query: 397 NKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLAS 455
            + LATAS + T  +W   +    R F   YA   KF+                      
Sbjct: 434 GQWLATASKDHTSILWKYSSETS-RFF--AYA---KFI---------------------- 465

Query: 456 STLLENKEDAHGAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFKVDQELIPGTVDKF 510
                     H +++ ++ L +   R     L+T S D T+K W  K+       + D+ 
Sbjct: 466 ---------GHSSSVTAVGLPNVLLRGYPEFLITASNDLTIKKW--KIPTPSKERSDDES 514

Query: 511 VPK---LKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK 567
             K   +K+   T    + DI ++ IS ++  +A    D + K++ L+S +   +L  HK
Sbjct: 515 KDKTHIIKVSEYTRHAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHK 574

Query: 568 LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
             +  +      KL+ T S DK IK+W LD     K+   H +++    F+ +     S 
Sbjct: 575 RGIWDVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSS 634

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             DGL+K WD    +C++ L  H + +WAL   ND   +VS   D  ++ W
Sbjct: 635 GADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSADADGVLQFW 685

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 68/145 (46%), Gaps = 3/145 (2%)

Query: 85  PETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIW 144
           P  +L+A G  D   K+W+L S  ++   N HK  I  + F      + + S D  I +W
Sbjct: 542 PNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLW 601

Query: 145 DLVGEVGLYKLRSHKDSIT-GIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSEC 203
            L     L     H +++    +   +  L+S+  DGLIKIWD  T  C++T   H +  
Sbjct: 602 SLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRI 661

Query: 204 WGLAIHND--LVITTSTESQIKIWN 226
           W L   ND  L+++   +  ++ WN
Sbjct: 662 WALTTWNDGELIVSADADGVLQFWN 686

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 4/126 (3%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
           L  H+  +  +     +KL+AT S + T+K+W++ T A ++TF         C F+    
Sbjct: 570 LNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQK 629

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +V     G ++++D  +   L+   D H   IW+L   +DG+ +V+  AD  ++FW+  
Sbjct: 630 QLVSSGADGLIKIWDCTTGDCLKTL-DGHDNRIWALTTWNDGELIVSADADGVLQFWNDC 688

Query: 498 VDQELI 503
            + E++
Sbjct: 689 TELEIL 694

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 26/185 (14%)

Query: 520 TTLELNDD--ILAVKISSDNKFL-AVSLLDNTVKVFFLNSMKFFLSLYGHKL-------- 568
           TT+  ND+  I  +K++ D KFL +++L    +K++ L +++   ++   +         
Sbjct: 56  TTITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTL 115

Query: 569 ----PVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVP--ESH 622
               P   +D    S L+     D +I +  ++ G    S   H  +I SVKF    +++
Sbjct: 116 KLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTN 175

Query: 623 NFFSCSKD--GLVKYWDGDKFECVQKLAAHQSEVWAL---AISNDARFVV----STSHDH 673
            +  CS D  G+VK WD  K  C+  L  H S V  L   ++S +   VV    S S D+
Sbjct: 176 CWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDN 235

Query: 674 SIRVW 678
            + +W
Sbjct: 236 IVNLW 240

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 149/649 (22%), Positives = 260/649 (40%), Gaps = 110/649 (16%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           E T L+  P+   L       ++KI + +S   +I      S   ++  D T T +  G 
Sbjct: 31  EITALKVTPDGKYLIFVSQAQLLKIVN-VSTGKIIKSMKVSSPSYIIDCDKTSTLVTIGG 89

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE----DWLI-STSKDGLIKIWDLKTQQ 191
            D  +++ D+      + L+ H  +I+ +    E     WL+ S   +G++KIWDL  ++
Sbjct: 90  TDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSGDTNGMVKIWDLVKRK 149

Query: 192 CVETHMAHTSECWGLAI---HNDL----VITTSTESQIKIWNLDLDKDMGSKLIEKGIYE 244
           C+ T   HTS   G+ I    ND     ++T   ++ +  W  +L K     L++     
Sbjct: 150 CIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWEFNLKKK--CTLVKTIPAH 207

Query: 245 KQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKG--- 301
           +Q +  G    FI      +F Y   +D   ++  ++  + I K  RK  + L   G   
Sbjct: 208 QQIESSG----FINH----DFIYTAGSDAVFQVISLKNGQVI-KRTRKPIEELFIIGVLP 258

Query: 302 ----------MADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKL-----E 346
                     M+D+ +  N+ D   ++     + I S   I      +   + +      
Sbjct: 259 ILNGTEYYLVMSDQSL--NLIDVQGALEEEEDELISSKSCIAGNHGIIADMTFVGPDLKH 316

Query: 347 MVLTTSNNTVEYYSIPYQKR------EPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLL 400
           + L T++ T+    +P   +      E   P    +Y    +GH   + +ID ++D   +
Sbjct: 317 LALATNSPTLRLIPVPNTNKSDGNEDESFLPIDVDMY----EGHEDLLNAIDSTEDGLWI 372

Query: 401 ATASNGTLKIWNIKTHACI----RTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASS 456
           ATAS         K H+ I     T +  +    +F                        
Sbjct: 373 ATAS---------KDHSAIVWKYNTIKQKFTQYARF------------------------ 399

Query: 457 TLLENKEDAHGAAIWSLDLT-----SDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFV 511
                    H +++ ++ L      S  + L+T S D T+K W  K+ +   P   D+ V
Sbjct: 400 -------SGHSSSVTAVGLPNVMPKSYPEYLLTASNDLTIKKW--KIPK---PSAGDEEV 447

Query: 512 P--KLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLP 569
               +KI   T      DI A+ IS ++   A +  D T K++ L + +   +L  HK  
Sbjct: 448 EFHDVKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRG 507

Query: 570 VLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSK 629
           +  +      K++ T S DK IKIW LD     K+L  H +++    F+ + +   S   
Sbjct: 508 LWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGA 567

Query: 630 DGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           DGL+K WD    EC+  L  H + +WAL + ND   +VS   D   + W
Sbjct: 568 DGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFW 616

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 92/208 (44%), Gaps = 15/208 (7%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L   P  ++ A    D   KIWDL +   +   + HK  +  + F      + + S D  
Sbjct: 469 LSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKT 528

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
           I IW L     +  L  H +++    +   ++ L+ST  DGLIKIWD+   +C+ T   H
Sbjct: 529 IKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGH 588

Query: 200 TSECWGLAIHN--DLVITTSTESQIKIWNLDLD----KDMGSKLIEKGIYEKQSKQRGVS 253
            +  W L + N  DL+++   +   + W    D    +DM  +  ++ I ++QS Q    
Sbjct: 589 NNRIWALCVQNDGDLIVSADADGVFQFWRDCTDEQREEDMAKE--KERIEQEQSLQN--- 643

Query: 254 VEFITTSDGVNFFYIQ-NADKTVEIFRV 280
             ++   D  N F +  + D  + +F V
Sbjct: 644 --YLNERDWTNAFLLAISLDHPMRLFNV 669

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 78/176 (44%), Gaps = 10/176 (5%)

Query: 512 PKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVL 571
           P  KI H  +     +I A+K++ D K+L        +K+  +++ K   S+     P  
Sbjct: 16  PVKKILHTISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS-PSY 74

Query: 572 SIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE--SHNFFSCSK 629
            ID    S L+     D ++ +  ++ G    SL  H  +I S+KF  E  S+ +  CS 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 630 D--GLVKYWDGDKFECVQKLAAHQSEVWALAI-----SNDARFVVSTSHDHSIRVW 678
           D  G+VK WD  K +C+  +  H S V  + I       D   +V+   D+ +  W
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFW 190

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 62/124 (50%), Gaps = 4/124 (3%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFE--CGYALTCKFLPGGA 437
           L  H+  +  +     +K++AT S + T+KIW++ T + I+T E        C F+    
Sbjct: 501 LSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQN 560

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +V     G ++++D+++   +    D H   IW+L + +DG  +V+  AD   +FW   
Sbjct: 561 QLVSTGADGLIKIWDISNGECISTL-DGHNNRIWALCVQNDGDLIVSADADGVFQFWRDC 619

Query: 498 VDQE 501
            D++
Sbjct: 620 TDEQ 623

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 148/643 (23%), Positives = 255/643 (39%), Gaps = 88/643 (13%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           E T L+  P    L       +++I+ L SK ++ +     S + V+  D + T +  G 
Sbjct: 62  EITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKV-SSPVYVMDCDSSSTLVALGG 120

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENED----W-LISTSKDGLIKIWDLKTQQ 191
            D  + + D+      +  + H  +I+ +    E     W L S    G++K+WDL  + 
Sbjct: 121 TDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRN 180

Query: 192 CVETHMAHTSECWGLAIH----NDLVITTSTESQIKIWNL-DLDKDMGSKLIEKGIYEKQ 246
           C+ T   H +   GL       +D V+   T  +  I NL  L+    +KL+      +Q
Sbjct: 181 CIHTIQEHAAAVRGLDFRLSPADDGVLELLTGGRDDIVNLFQLNSTKKAKLMRTIPVHQQ 240

Query: 247 SKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKG----M 302
            +  G    FI  S   + FY    D   +I    T   ++K  +K  + L   G    M
Sbjct: 241 IEACG----FIRDSPDGSLFYTAGGDAVFQILSF-TSASVAKRTKKPIEELFIIGVLPIM 295

Query: 303 ADEKIQQNIKDSYV------SVIMHPFQTIRSPFKIKAATWAVTTTSKL-----EMVLTT 351
              K+   + D  +      + +      I    KI      V     +     ++ L T
Sbjct: 296 QGSKVYLVLSDQTLFLVNLSASLSKDGDEIVIEHKIAGNHGTVADMRFVGKELDKLALAT 355

Query: 352 SNNTVEYYSIPYQKR-------EPTR--------PAPNKLYTIELQGHRTDVRSIDISDD 396
           ++  +   + P  K        EPT         P   +LY    +GH   + S+D S++
Sbjct: 356 NSPALRVITAPVTKHNAAEKEDEPTSKVDIQNCLPLEVELY----EGHTDLLNSLDSSEN 411

Query: 397 NKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLAS 455
            + LAT S + T+ +W +             A + KF P           G +    L +
Sbjct: 412 GEWLATCSKDHTVILWKLN------------ADSEKFKPYARFT---GHAGPVTAVGLPN 456

Query: 456 STLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLK 515
             ++ N         W        + ++T S D T+K W         P + D  +  +K
Sbjct: 457 --VMRNT--------WP-------EFIITASNDLTIKKWSVPK-----PTSNDVDMHNIK 494

Query: 516 IFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI 575
           +   T      DI A+ IS ++   A +  D T K++ ++S +   +L  HK  +  +  
Sbjct: 495 VSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTF 554

Query: 576 SFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKY 635
               KLL T S DK IK+W L+     K+L  H +++    F+  +    S   DGL+K 
Sbjct: 555 CQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKV 614

Query: 636 WDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           WD    EC++ L AH + +WAL++ +D +  V+   D   + W
Sbjct: 615 WDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 68/153 (44%), Gaps = 11/153 (7%)

Query: 512 PKLKIFHDTTLELNDD---ILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKL 568
           P  ++ H  T+E NDD   I A+K++ + ++L        ++++ L+S K   S+     
Sbjct: 47  PTKRLIH--TIE-NDDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSS- 102

Query: 569 PVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN----F 624
           PV  +D    S L+     D ++ +  ++ G    S   H  +I SVKF  E        
Sbjct: 103 PVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRL 162

Query: 625 FSCSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 657
            S    G+VK WD  +  C+  +  H + V  L
Sbjct: 163 ASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGL 195

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 126/558 (22%), Positives = 231/558 (41%), Gaps = 82/558 (14%)

Query: 153 YKLRSHKDSITGI--WCENED--WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGL-- 206
           + L+ H  +I+ +  + E+ED  WL+++    ++K+WDL  ++C+ T   H+S   G+  
Sbjct: 83  HSLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDF 142

Query: 207 ---AIHNDLV--ITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSVEFITTSD 261
              +  +D++  +T   ++ I  W +   K+   KLI      +Q +  G    FI +++
Sbjct: 143 KQSSTDSDIIHLVTGGRDNIINHWTISGLKNF--KLIRTFPVHQQVEACG----FIKSTE 196

Query: 262 GVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMAD----EKIQQNIKDSYVS 317
             N  Y    D   +I  +     I K  +K  + L   G+       K+   + D  + 
Sbjct: 197 DDNCIYTAGGDAVFQILSLSNGSVIKKT-KKPTEELFIIGVLPIKNFTKLYLVLSDQTLQ 255

Query: 318 VI--MHPFQ------TIRSPFKIKAATWAVTTTSKLEM---VLTTSNNTVEYYSIPYQKR 366
           +I  +  F+      TI+S       T A       E+    L T++ T+    +  +  
Sbjct: 256 LIDLIDTFEEDSEIITIKSSIAGNHGTIADMRLVGPELKSIALATNSPTLRIIPVISEDN 315

Query: 367 EPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECG 425
           +   P   +LY     GH   + S+D ++D   +ATAS + T  +W           E  
Sbjct: 316 KNNIPLGVELY----DGHEDLLNSLDATEDGLWIATASKDNTAMLWRFNDS------ENK 365

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTS---DG--K 480
           +    +F+                                H +++ S+ L +   +G  +
Sbjct: 366 FKKYAQFI-------------------------------GHASSVTSVSLPNVINNGWPE 394

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540
            ++T S D TVK W  KV         D  +  +K+   T      DI A+ I+ ++   
Sbjct: 395 FIITSSNDFTVKKW--KVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIF 452

Query: 541 AVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600
           A +  D T K++ L+S +   +L  HK  +  +      K + T+S DK IKIW L+   
Sbjct: 453 ATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFK 512

Query: 601 CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS 660
              +L  H +++    F+ +     S   DGL+K WD    EC++ L  H + +WAL + 
Sbjct: 513 VVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVL 572

Query: 661 NDARFVVSTSHDHSIRVW 678
            D   +++   D   + W
Sbjct: 573 RDGDMIITADADGVFQFW 590

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 93/212 (43%), Gaps = 9/212 (4%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L   P  ++ A    D   KIWDL S  ++     HK  +  + F      + + S D  
Sbjct: 443 LSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKT 502

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
           I IW L     +  L  H +++    +   +  ++ST  DGLIKIWD  + +C++T   H
Sbjct: 503 IKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGH 562

Query: 200 TSECWGLAI--HNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSVE-F 256
            +  W L +    D++IT   +   + W  D  +++  + +EK   EK   ++  S+  F
Sbjct: 563 ANRIWALCVLRDGDMIITADADGVFQFWK-DCTEEVKEQDLEK---EKLRVEQEQSLRNF 618

Query: 257 ITTSDGVNFFYI-QNADKTVEIFRVRTQEEIS 287
           I   +  N F +    D  + ++ V  Q   S
Sbjct: 619 IANGEWTNAFLLAMTLDHPMRLYNVLKQSMTS 650

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 54/118 (45%), Gaps = 9/118 (7%)

Query: 115 GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIW----CENE 170
            H+  I  L   P  +   + S D    IWDL     +  L +HK    G+W    C+ +
Sbjct: 435 AHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHK---RGLWDVSFCQYD 491

Query: 171 DWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHN--DLVITTSTESQIKIWN 226
            ++ + S D  IKIW L+T + V T   HT+     +  N    +++T  +  IKIW+
Sbjct: 492 KYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWD 549

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 95/232 (40%), Gaps = 46/232 (19%)

Query: 85  PETNLLAVGYADGVIKIWDLISKTVLIN-------FNGHKSAITVLRFDPTGTRLISGSK 137
           PE   +A+      ++I  +IS+    N       ++GH+  +  L     G  + + SK
Sbjct: 291 PELKSIALATNSPTLRIIPVISEDNKNNIPLGVELYDGHEDLLNSLDATEDGLWIATASK 350

Query: 138 DSDIIIWDLVGEVGLYK----LRSHKDSITGIWCEN------EDWLISTSKDGLIKIWDL 187
           D+  ++W        +K       H  S+T +   N       +++I++S D  +K W +
Sbjct: 351 DNTAMLWRFNDSENKFKKYAQFIGHASSVTSVSLPNVINNGWPEFIITSSNDFTVKKWKV 410

Query: 188 -----KTQQCVETHMAHTSE-----------CWGLAIHNDLVITTSTESQIKIWNLDLDK 231
                K+    + H+   SE              +A ++ +  T S +   KIW+LD  +
Sbjct: 411 PSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGE 470

Query: 232 DMGSKLIEK-GIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRT 282
            M +    K G+++    Q     ++I T+ G         DKT++I+ + T
Sbjct: 471 LMATLANHKRGLWDVSFCQYD---KYIATASG---------DKTIKIWSLET 510

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGT-----RLISGSKDSDIII 143
           LLA G  + ++K+WDL+ +  +     H SA+  + F  + T      L++G +D+ I  
Sbjct: 107 LLASGDTN-MVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINH 165

Query: 144 WDLVG 148
           W + G
Sbjct: 166 WTISG 170

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score =  103 bits (256), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 85/335 (25%), Positives = 144/335 (42%), Gaps = 58/335 (17%)

Query: 384 HRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIRTFECG------------------ 425
           H + V  +  S+D + LAT  N T +++   T   I T                      
Sbjct: 397 HPSVVCCVRFSNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESS 456

Query: 426 --YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLV 483
             Y  +  F P G  +  G     ++++D+ +  ++   +  H   I+SLD    G++LV
Sbjct: 457 DLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILK-GHEQDIYSLDYFPSGEKLV 515

Query: 484 TGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDN-KFLAV 542
           +GS DKTV+ WD +  Q  +                 TL + D +  V  S +N KF+A 
Sbjct: 516 SGSGDKTVRIWDLRTGQCSL-----------------TLSIEDGVTTVSSSPNNGKFIAA 558

Query: 543 SLLDNTVKV------FFLNSMKFFLSLY-GHKLPVLSIDISFDSKLLITSSADKNIKIWG 595
             LD + ++      F L  +     L  GHK  + S+  + D K L++ S D+++K+W 
Sbjct: 559 GSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWN 618

Query: 596 LDFGD------CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAA 649
           LD  +      C  +   H+D ++SV          S SKD  V +WD +    +  L  
Sbjct: 619 LDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQG 678

Query: 650 HQSEVWALAISNDARF-----VVST-SHDHSIRVW 678
           H++ V ++A++N         V ST S D + ++W
Sbjct: 679 HKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 103/213 (48%), Gaps = 21/213 (9%)

Query: 35  GQIL-TGALENVNCWDIKTGEL-SKILTDGLPPGAVDAKSTKLAEST--YLQ---YHPET 87
           GQ L TG  +    +   TGEL + +L D       +++     ES+  Y++   + P+ 
Sbjct: 410 GQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSVCFSPDG 469

Query: 88  NLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL- 146
             LA G  D +I+IWD+ +K +++   GH+  I  L + P+G +L+SGS D  + IWDL 
Sbjct: 470 KFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLR 529

Query: 147 VGEVGLYKLRSHKDSITGIWCE--NEDWLISTSKDGLIKIWDLKT-------QQCVETHM 197
            G+  L    S +D +T +     N  ++ + S D   +IWD +T           +   
Sbjct: 530 TGQCSL--TLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQN 587

Query: 198 AHTSECWGLAIHND--LVITTSTESQIKIWNLD 228
            H    + ++   D   +++ S +  +K+WNLD
Sbjct: 588 GHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLD 620

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 106/229 (46%), Gaps = 25/229 (10%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
           L+GH  D+ S+D      KL++ + + T++IW+++T  C  T   E G          G 
Sbjct: 495 LKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK 554

Query: 438 LVVVGNRGGDLQLFDLASSTLLE------NKEDAHGAAIWSLDLTSDGKRLVTGSADKTV 491
            +  G+     +++D  +  LL+      + ++ H  +I+S+  T DGK+LV+GS D++V
Sbjct: 555 FIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSV 614

Query: 492 KFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKV 551
           K W+          T +      ++   T +   D +L+V  S +++++     D  V  
Sbjct: 615 KLWNLDT-------TNNNSNESCEV---TFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLF 664

Query: 552 FFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
           +  NS    L L GHK  V+S+ ++    L        T S D   KIW
Sbjct: 665 WDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 77/183 (42%), Gaps = 32/183 (17%)

Query: 45  VNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETN-LLAVGYADGVIKI 101
           V  WD++TG+ S  L+  DG+               T +   P     +A G  D   +I
Sbjct: 523 VRIWDLRTGQCSLTLSIEDGV---------------TTVSSSPNNGKFIAAGSLDRSARI 567

Query: 102 WDLISKTVLINF-------NGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL------VG 148
           WD  +  +L          NGHK +I  + F   G +L+SGS D  + +W+L        
Sbjct: 568 WDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSN 627

Query: 149 EVGLYKLRSHKDSITGIW-CENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLA 207
           E        HKD +  +   +N+++++S SKD  +  WD  +   +     H +    +A
Sbjct: 628 ESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVISVA 687

Query: 208 IHN 210
           + N
Sbjct: 688 VAN 690

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 69/163 (42%), Gaps = 19/163 (11%)

Query: 37  ILTGALE-NVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYA 95
           I  G+L+ +   WD +TG L K L         D ++        + +  +   L  G  
Sbjct: 556 IAAGSLDRSARIWDTETGFLLKRLD-----SQTDLQNGHKDSIYSVSFTKDGKKLVSGSL 610

Query: 96  DGVIKIWDL------ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGE 149
           D  +K+W+L       +++  + F GHK  +  +        ++SGSKD  ++ WD    
Sbjct: 611 DRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSG 670

Query: 150 VGLYKLRSHKDSITGIWCEN------EDWLIST-SKDGLIKIW 185
             L  L+ HK+S+  +   N      E  + ST S D   KIW
Sbjct: 671 NPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 88/349 (25%), Positives = 147/349 (42%), Gaps = 69/349 (19%)

Query: 355 TVEYYSIPYQKREPTRPAPNKLYTIELQGHRT-----DVRSIDISDDNKLLATASNGTLK 409
           T +YY +      PT+P       I+++ HRT      V  +  S++ + LAT  N T K
Sbjct: 292 TEDYYVL----YNPTQPK-----DIDIELHRTLLHDSVVCCVKFSNNGEYLATGCNKTTK 342

Query: 410 IWNIKTHACIRTF----ECG------------YALTCKFLPGGALVVVGNRGGDLQLFDL 453
           I+ + T   +       + G            Y  +  F P G  +  G     ++++D+
Sbjct: 343 IFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDI 402

Query: 454 ASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPK 513
           A   ++      H   I+SLD    G +LV+GS D+T++ WD    Q  +          
Sbjct: 403 AQRKIVMVLR-GHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL---------- 451

Query: 514 LKIFHDTTLELNDDILAVKISSDN-KFLAVSLLDNTVKVFFLNSMKFFLSL-------YG 565
                  TL + D +  V +S  N  ++A   LD TV+V+  NS      L        G
Sbjct: 452 -------TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVG 504

Query: 566 HKLPVLSIDISFDSKLLITSSADKNIKIWGL-------------DFGDCHKSLFAHQDSI 612
           HK  V S+  + D K +++ S D+++K+W L               G+C  +   H+D +
Sbjct: 505 HKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFV 564

Query: 613 MSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN 661
           +SV          S SKD  V +WD      +  L  H++ V ++A++N
Sbjct: 565 LSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVAN 613

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 100/206 (48%), Gaps = 18/206 (8%)

Query: 37  ILTGALENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQ---YHPETNLLAVG 93
           + TG  +    +++ TG L   L D    G  DA S   A+  Y++   + P+   LA G
Sbjct: 333 LATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSAD-LYIRSVCFSPDGKFLATG 391

Query: 94  YADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-VGEVGL 152
             D +I+IWD+  + +++   GH+  I  L +  +G +L+SGS D  I IWDL  G+  L
Sbjct: 392 AEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL 451

Query: 153 YKLRSHKDSITGIWCE--NEDWLISTSKDGLIKIWDLKTQQCV-------ETHMAHTSEC 203
               S +D +T +     N +++ + S D  +++WD  +   V       ET + H    
Sbjct: 452 --TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSV 509

Query: 204 WGLAIHNDL--VITTSTESQIKIWNL 227
           + +    D   +++ S +  +K+WNL
Sbjct: 510 YSVVFTRDGKNIVSGSLDRSVKLWNL 535

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 107/223 (47%), Gaps = 16/223 (7%)

Query: 466 HGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELN 525
           H + +  +  +++G+ L TG  +KT K ++      L+   VD      +   D     +
Sbjct: 317 HDSVVCCVKFSNNGEYLATG-CNKTTKIFEVATGN-LVTELVDDTKTGTE---DANSASS 371

Query: 526 DD--ILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLI 583
            D  I +V  S D KFLA    D  ++++ +   K  + L GH+  + S+D       L+
Sbjct: 372 ADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLV 431

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC-SKDGLVKYWDGDKFE 642
           + S D+ I+IW L  G C  +L + +D + +V   P + N+ +  S D  V+ WD +   
Sbjct: 432 SGSGDRTIRIWDLHTGQCSLTL-SIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGF 490

Query: 643 CVQKL-------AAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            V++L         H+  V+++  + D + +VS S D S+++W
Sbjct: 491 LVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLW 533

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 109/230 (47%), Gaps = 20/230 (8%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL-PG-GA 437
           L+GH  D+ S+D     NKL++ + + T++IW++ T  C  T      +T   + PG G 
Sbjct: 411 LRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGN 470

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADKTV 491
            V  G+    ++++D  S  L+E  +        H  +++S+  T DGK +V+GS D++V
Sbjct: 471 YVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSV 530

Query: 492 KFWDFKVDQELIPGTVDKFVPKLKIFHDTT-LELNDDILAVKISSDNKFLAVSLLDNTVK 550
           K W+ +     I G      PK +   + T +   D +L+V  + +++++     D  V 
Sbjct: 531 KLWNLRN----INGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVI 586

Query: 551 VFFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
            +   S    L L GH+  V+S+ ++    L        T S D   KIW
Sbjct: 587 FWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIW 636

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 72/180 (40%), Gaps = 28/180 (15%)

Query: 32  GSAGQILTGALE-NVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNL 89
           G+   +  G+L+  V  WD  +G L + L D      V  K     +S Y + +  +   
Sbjct: 467 GNGNYVAAGSLDRTVRVWDSNSGFLVERL-DSEGETGVGHK-----DSVYSVVFTRDGKN 520

Query: 90  LAVGYADGVIKIWDL-------------ISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           +  G  D  +K+W+L                   + + GHK  +  +        ++SGS
Sbjct: 521 IVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGS 580

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWL-------ISTSKDGLIKIWDLKT 189
           KD  +I WD V  V L  L+ H++S+  +   N   L        + S D   KIW  +T
Sbjct: 581 KDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQT 640

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 85/353 (24%), Positives = 143/353 (40%), Gaps = 76/353 (21%)

Query: 384 HRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIR----------------------- 420
           H + V  +  S+D + LAT  N T +++ + T   +                        
Sbjct: 292 HSSVVCCVRFSNDGEYLATGCNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNGA 351

Query: 421 ---------TFECG-----YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAH 466
                    T + G     Y  +  F P G  +  G     ++++DL+S  +L   +  H
Sbjct: 352 TEKGDESSATIQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ-GH 410

Query: 467 GAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELND 526
              I+SLD    G +LV+GS D+TV+ WD +  Q  +                 TL + D
Sbjct: 411 EQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIED 453

Query: 527 DILAVKIS-SDNKFLAVSLLDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFD 578
            +  V +S  D K++A   LD TV+V      F +  +     L  GHK  V S+  + D
Sbjct: 454 GVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRD 513

Query: 579 SKLLITSSADKNIKIWGL-------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDG 631
            + +++ S D+++K+W L           C  +   H+D ++SV    +     S SKD 
Sbjct: 514 GRSVVSGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDR 573

Query: 632 LVKYWDGDKFECVQKLAAHQSEVWALAISN------DARFVVSTSHDHSIRVW 678
            V +WD      +  L  H++ V ++A+ N      D     + S D   R+W
Sbjct: 574 GVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 103/226 (45%), Gaps = 37/226 (16%)

Query: 37  ILTGALENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLA---------EST-------- 79
           + TG  +    + + TGEL   L+D    G  +  S+ +A         ES+        
Sbjct: 308 LATGCNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNGATEKGDESSATIQPGSS 367

Query: 80  ---YLQ---YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLI 133
              Y++   + P+   LA G  D +I+IWDL SK +L+   GH+  I  L + P G +L+
Sbjct: 368 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLV 427

Query: 134 SGSKDSDIIIWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQ 190
           SGS D  + IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T 
Sbjct: 428 SGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 485

Query: 191 QCVET-------HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
             VE           H    + +    D   V++ S +  +K+W+L
Sbjct: 486 FLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDL 531

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 109/232 (46%), Gaps = 26/232 (11%)

Query: 379 IELQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL-PG- 435
           + LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T      +T   + PG 
Sbjct: 405 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 464

Query: 436 GALVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADK 489
           G  +  G+    ++++D  +  L+E  +        H  +++S+  T DG+ +V+GS D+
Sbjct: 465 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDR 524

Query: 490 TVKFWDFK-VDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNT 548
           +VK WD + ++ +    T +      K F          +L+V  + D++++     D  
Sbjct: 525 SVKLWDLRGLNGQKSHATCEVTYTGHKDF----------VLSVATTQDDEYILSGSKDRG 574

Query: 549 VKVFFLNSMKFFLSLYGHKLPVLSIDI------SFDSKLLITSSADKNIKIW 594
           V  +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 575 VLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 84/206 (40%), Gaps = 39/206 (18%)

Query: 45  VNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           V  WD++TG+ S  L+  DG+   AV     K               +A G  D  +++W
Sbjct: 435 VRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKY--------------IAAGSLDRTVRVW 480

Query: 103 DLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGL--- 152
           D  +  ++   +       GHK ++  + F   G  ++SGS D  + +WDL G  G    
Sbjct: 481 DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSH 540

Query: 153 ----YKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLA 207
                    HKD +  +    +D +++S SKD  +  WD  +   +     H +    +A
Sbjct: 541 ATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVA 600

Query: 208 IHNDLVI--------TTSTESQIKIW 225
           + N   +        T S + + +IW
Sbjct: 601 VVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 63/147 (42%), Gaps = 15/147 (10%)

Query: 32  GSAGQILTGALE-NVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNL 89
           G    I  G+L+  V  WD +TG L + L       + +  ST   +S Y + +  +   
Sbjct: 463 GDGKYIAAGSLDRTVRVWDSETGFLVERLD------SENELSTGHKDSVYSVVFTRDGRS 516

Query: 90  LAVGYADGVIKIWDLIS-------KTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           +  G  D  +K+WDL          T  + + GHK  +  +        ++SGSKD  ++
Sbjct: 517 VVSGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVL 576

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWCEN 169
            WD      L  L+ H++S+  +   N
Sbjct: 577 FWDTASGNPLLMLQGHRNSVISVAVVN 603

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 99/200 (49%), Gaps = 11/200 (5%)

Query: 482 LVTGSADKTVKFWDFKVDQELIPG--TVDKFVPKLKIFHDTTLELND-DILAVKISSDNK 538
           ++T S D T+K W         PG  T +  V K+    D T   +D DI A+ IS ++ 
Sbjct: 469 IITASNDLTIKKWTVPK-----PGHETAEPHVVKVS---DYTRRAHDKDINALSISPNDS 520

Query: 539 FLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598
             A +  D T KV+ ++S +   +L  HK  +  +      KLL T S DK +K+W LD 
Sbjct: 521 TFATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDT 580

Query: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658
               K+L  H +++    F+ ++    S   DGL+K WD    ECV+ L AH++ +WAL+
Sbjct: 581 LSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALS 640

Query: 659 ISNDARFVVSTSHDHSIRVW 678
           + +D    V+   D   + W
Sbjct: 641 VLHDGDEFVTADADGVFQFW 660

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 90/204 (44%), Gaps = 7/204 (3%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L   P  +  A    D   K+WD+ S  +      HK  +  + F      L + S D  
Sbjct: 513 LSISPNDSTFATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKT 572

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAH 199
           + +W L     +  L  H +++      N++  L+ST  DGLIK+WDL T +CV T  AH
Sbjct: 573 VKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAH 632

Query: 200 TSECWGLAI--HNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSVEFI 257
            +  W L++    D  +T   +   + W  D  ++   + +E   ++++ +Q      ++
Sbjct: 633 ENRIWALSVLHDGDEFVTADADGVFQFWK-DCSEEQEKENLEN--HKRKVEQDQSLQNYM 689

Query: 258 TTSDGVNFFYI-QNADKTVEIFRV 280
           +  D  N F +    D  + ++RV
Sbjct: 690 SQGDWTNAFLLAMTLDHPMRLYRV 713

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 9/130 (6%)

Query: 380 ELQG----HRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFE--CGYALTCKF 432
           ELQG    H+  +  +     +KLLAT S + T+K+W++ T + ++T E        C F
Sbjct: 540 ELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSF 599

Query: 433 LPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
           +     +V     G ++L+DL++   +    DAH   IW+L +  DG   VT  AD   +
Sbjct: 600 INKNKQLVSTGADGLIKLWDLSTGECVRTL-DAHENRIWALSVLHDGDEFVTADADGVFQ 658

Query: 493 FW-DFKVDQE 501
           FW D   +QE
Sbjct: 659 FWKDCSEEQE 668

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 68/153 (44%), Gaps = 5/153 (3%)

Query: 509 KFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKL 568
           +  P  ++ H    +   +I A+K++ D ++L        ++++ L S +   S+     
Sbjct: 44  ELAPTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSS- 102

Query: 569 PVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN----F 624
           PV  ID    S L+     D ++ +  ++ G    SL  H  +I SVKF  E ++     
Sbjct: 103 PVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRL 162

Query: 625 FSCSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 657
            S   +G+VK WD  +  C+  +  H + V  L
Sbjct: 163 GSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGL 195

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 95/228 (41%), Gaps = 13/228 (5%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGS 136
           E T L+  P+   L       +++I+ L SK V+ +     S + V+  DP+ T +  G 
Sbjct: 62  EITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKV-SSPVYVIDCDPSSTLVALGG 120

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE----DW-LISTSKDGLIKIWDLKTQQ 191
            D  + + D+      + L+ H  +I+ +    E     W L S   +G++K+WDL  + 
Sbjct: 121 TDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGVVKVWDLVRRS 180

Query: 192 CVETHMAHTSECWGLAIH----NDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQS 247
           C+ T   H +   GL       +D V+   +  +  I NL     +GS    K +     
Sbjct: 181 CLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNL---YQLGSTKKVKLVKTIPV 237

Query: 248 KQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREK 295
            Q+  +  FI   +  + FY    D   +I  + T   I K  +  E+
Sbjct: 238 HQQIEACGFIHDGEHQDLFYTAGGDAVYQILSLATASVIKKTNKPIEE 285

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 55/139 (39%), Gaps = 23/139 (16%)

Query: 113 FNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEV----GLYKLRSHKDSITGIWCE 168
           + GH   +  L     G  L + SKD  +I+W    E+       K   H   +T +   
Sbjct: 399 YEGHTDLLNALDSSEDGKWLATCSKDHTVILWRYSSELEKFKAYAKFTGHAGPVTAVGLP 458

Query: 169 N------EDWLISTSKDGLIKIWDLKT--QQCVETHM---------AHTSECWGLAI--H 209
           N       +++I+ S D  IK W +     +  E H+         AH  +   L+I  +
Sbjct: 459 NVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPN 518

Query: 210 NDLVITTSTESQIKIWNLD 228
           +    T S +   K+W++D
Sbjct: 519 DSTFATASYDKTCKVWDVD 537

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 89/382 (23%), Positives = 158/382 (41%), Gaps = 77/382 (20%)

Query: 356 VEYYSIPYQKREPTR-------PAPNKLYTIELQG---HRTDVRSIDISDDNKLLATASN 405
           ++Y  +P   R+ T        PA  +   +EL     H + V  +  S+D + LAT  N
Sbjct: 276 LDYKQVPENLRKKTEEYDVLYNPALPRTLEVELHKSLEHTSVVCCVKFSNDGQYLATGCN 335

Query: 406 GTLKIWNIKTHACIR--------TFECG-----------YALTCKFLPGGALVVVGNRGG 446
            T +++ +     +         + + G           Y  +  F P G  +  G    
Sbjct: 336 KTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLATGAEDR 395

Query: 447 DLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGT 506
            ++++DLA   ++   +  H   ++SLD    G +LV+GS D+TV+ WD K  Q  +   
Sbjct: 396 LIRIWDLAQQKIVMVLQ-GHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSL--- 451

Query: 507 VDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKFLAVSLLDNTVKV------FFLNSMKF 559
                         TL + D +  V +S  D K++A   LD  V+V      F +  +  
Sbjct: 452 --------------TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDS 497

Query: 560 FLSL-YGHKLPVLSIDISFDSKLLITSSADKNIKIWGL-------DFGD---------CH 602
              L  GH+  V S+  + D   +++SS D+++K+W L       +  D         C 
Sbjct: 498 ENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADNNKSQSSVVCE 557

Query: 603 KSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN- 661
            +   H+D ++SV          S SKD  V +WD +    +  L  H++ V ++A++N 
Sbjct: 558 VTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAVANG 617

Query: 662 -----DARFVVSTSHDHSIRVW 678
                + +   + S D   R+W
Sbjct: 618 HPLGPEYQVFATGSGDCRARIW 639

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 101/211 (47%), Gaps = 20/211 (9%)

Query: 35  GQIL-TGALENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAEST--YLQ---YHPETN 88
           GQ L TG  +    + +  GEL   L+D   P   +  +   + ST  Y++   + P+  
Sbjct: 327 GQYLATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGK 386

Query: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-V 147
            LA G  D +I+IWDL  + +++   GH   +  L + P+G +L+SGS D  + IWDL  
Sbjct: 387 FLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKT 446

Query: 148 GEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET-------HMA 198
           G+  L    S +D +T +     D  ++ + S D  +++WD +T   VE           
Sbjct: 447 GQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTG 504

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWNL 227
           H    + +    D   V+++S +  +K+WNL
Sbjct: 505 HRDSVYSVVFTRDGNKVVSSSLDRSVKLWNL 535

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 93/228 (40%), Gaps = 49/228 (21%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD+KTG+ S  L+  DG+   AV     K               
Sbjct: 426 SGDKLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKY-------------- 471

Query: 90  LAVGYADGVIKIWDLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDII 142
           +A G  D  +++WD  +  ++   +       GH+ ++  + F   G +++S S D  + 
Sbjct: 472 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVK 531

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWCE-----------------NEDWLISTSKDGLIKIW 185
           +W+L G         +  S + + CE                 N+++++S SKD  +  W
Sbjct: 532 LWNLRGYNEKENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFW 591

Query: 186 DLKTQQCVETHMAHTSECWGLAIHN--------DLVITTSTESQIKIW 225
           D  T   +     H +    +A+ N         +  T S + + +IW
Sbjct: 592 DTNTGNPLLMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIW 639

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 110/275 (40%), Gaps = 56/275 (20%)

Query: 460 ENKE---------DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQE--------- 501
           ENKE         + H   + SLD T+DG  + T S D +V  W +    E         
Sbjct: 374 ENKETFPIEVKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFV 433

Query: 502 ----------------------LIPGTVDKFVPKLKIFHDTTLELND------------- 526
                                 +I  + D  + K K+   T+ E  D             
Sbjct: 434 GHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRA 493

Query: 527 ---DILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLI 583
              DI A+ IS ++   A +  D T K++ L+  +F  +L  HK  +  +      KLL 
Sbjct: 494 HEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLA 553

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFEC 643
           T S DK IKIW L+     K+L  H +++    F+ ++    S   DGLV  WD    E 
Sbjct: 554 TCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGES 613

Query: 644 VQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           V+ L AH + +WALA+ ND    V+   D     W
Sbjct: 614 VKTLDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 58/128 (45%), Gaps = 1/128 (0%)

Query: 85  PETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIW 144
           P  +L A    D   KIW+L           HK  +  + F      L + S D  I IW
Sbjct: 505 PNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIW 564

Query: 145 DLVGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTSEC 203
            L     +  L  H +++      N++  LIST  DGL+ IWDL T + V+T  AH +  
Sbjct: 565 SLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRI 624

Query: 204 WGLAIHND 211
           W LA+ ND
Sbjct: 625 WALAVMND 632

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 91/381 (23%), Positives = 148/381 (38%), Gaps = 76/381 (19%)

Query: 346 EMVLTTSNNTVEYYSIPYQKREPTRPAPNK-LYTIEL---QGHRTDVRSIDISDDNKLLA 401
           ++ L T++ T+     P    E      NK  + IE+   +GH   + S+D + D   +A
Sbjct: 347 KLALATNSPTLRIIPTPTSSEEEFENGENKETFPIEVKMYEGHTDLLNSLDATADGLWVA 406

Query: 402 TAS-NGTLKIWNIKTHACIRTFECGYALTCKFLPG-GALVVVG--------------NRG 445
           TAS + ++ +W  + HA    F   Y  T KF+   G++  VG                 
Sbjct: 407 TASKDHSVILW--RYHAKYEDF---YPYT-KFVGHVGSVNAVGLPNVMPRSWPEFIITAS 460

Query: 446 GDLQL-------------FDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
            DL +              DL      E    AH   I ++ ++ +     T S DKT K
Sbjct: 461 NDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFATASYDKTCK 520

Query: 493 FWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVF 552
            W+   D E               F  T       +  V     +K LA    D T+K++
Sbjct: 521 IWNLD-DGE---------------FQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIW 564

Query: 553 FLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSI 612
            L S     +L GH   V        +K LI++ AD  + IW L  G+  K+L AH + I
Sbjct: 565 SLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRI 624

Query: 613 MSVKFVPESHNFFSCSKDGLVKYWDGD--------------KFECVQKLAAHQSEV-WAL 657
            ++  + +  +F +   DG  ++W  +              K E  Q L  + SE  W  
Sbjct: 625 WALAVMNDGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQEQSLQNYLSEGDWTN 684

Query: 658 AISNDARFVVSTSHDHSIRVW 678
           A      F+++ + DH +R++
Sbjct: 685 A------FLLAMTLDHPMRLY 699

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 62/147 (42%), Gaps = 5/147 (3%)

Query: 515 KIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSID 574
           ++ H    E   DI A+ ++ D  +L        ++V+ L   +   S+     PV  ++
Sbjct: 50  RVLHSVDTEDEQDITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMKISS-PVYVMN 108

Query: 575 ISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN----FFSCSKD 630
               S LL     D ++ +  ++ G    SL  H  +I SVKF  E ++      S   +
Sbjct: 109 CDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTN 168

Query: 631 GLVKYWDGDKFECVQKLAAHQSEVWAL 657
           G++K WD  K  C   +  H + V  L
Sbjct: 169 GMIKVWDLVKRNCQCTIQEHTTAVRGL 195

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 60/133 (45%), Gaps = 6/133 (4%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKD 138
           T L   P+ + L       +++++ L  + ++ +     S + V+  D T T L  G  D
Sbjct: 64  TALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMK-ISSPVYVMNCDQTSTLLAIGGTD 122

Query: 139 SDIIIWDLVGEVGLYKLRSHKDSITGI----WCENEDW-LISTSKDGLIKIWDLKTQQCV 193
             + + D+      + L+ H  +I+ +       +E W L S   +G+IK+WDL  + C 
Sbjct: 123 GSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQ 182

Query: 194 ETHMAHTSECWGL 206
            T   HT+   GL
Sbjct: 183 CTIQEHTTAVRGL 195

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 9/68 (13%)

Query: 81  LQYHPETNL----LAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPT----GT-R 131
           +++H E N     LA G  +G+IK+WDL+ +        H +A+  L F  T    GT +
Sbjct: 149 VKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQ 208

Query: 132 LISGSKDS 139
           L+SG +D+
Sbjct: 209 LLSGGRDN 216

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 55/143 (38%), Gaps = 30/143 (20%)

Query: 113 FNGHKSAITVLRFDPTGTRLISGSKDSDIIIW-------------DLVGEVGLYKLRSHK 159
           + GH   +  L     G  + + SKD  +I+W               VG VG        
Sbjct: 386 YEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGLP 445

Query: 160 DSITGIWCENEDWLISTSKDGLIKIW-----------DLKTQQCVE-THMAHTSECWGLA 207
           + +   W E   ++I+ S D  IK W           DL   +  E T  AH  +   ++
Sbjct: 446 NVMPRSWPE---FIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAIS 502

Query: 208 I--HNDLVITTSTESQIKIWNLD 228
           I  ++ L  T S +   KIWNLD
Sbjct: 503 ISPNDSLFATASYDKTCKIWNLD 525

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/356 (23%), Positives = 144/356 (40%), Gaps = 79/356 (22%)

Query: 384 HRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACI-----------------RTFECG- 425
           H + V  +  S+D K LAT  N T +++N+ +   I                 +  E G 
Sbjct: 351 HTSVVCCVRFSNDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGGE 410

Query: 426 ------------------YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHG 467
                             Y  +  F P G  +  G     ++++D+A   ++   +  H 
Sbjct: 411 ENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQ-GHE 469

Query: 468 AAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDD 527
             I+SLD    G++LV+GS D+TV+ WD +  Q  +                 TL + D 
Sbjct: 470 QDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDG 512

Query: 528 ILAVKISS-DNKFLAVSLLDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDS 579
           +  V +S  D K++A   LD  V+V      F +  +     L  GHK  V S+  + D 
Sbjct: 513 VTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDG 572

Query: 580 KLLITSSADKNIKIWGLD-----------FGDCHKSLFAHQDSIMSVKFVPESHNFFSCS 628
             +++ S D+++K+W L+            G C  +   H+D ++SV          S S
Sbjct: 573 NNVVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGS 632

Query: 629 KDGLVKYWDGDKFECVQKLAAHQSEVWALAISN------DARFVVSTSHDHSIRVW 678
           KD  V +WD      +  L  H++ V ++A++N      +     + S D   R+W
Sbjct: 633 KDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIW 688

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 80/158 (50%), Gaps = 14/158 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+  K +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 435 FSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSGDRTVR 494

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET---- 195
           IWDL  G+  L    S +D +T +    ED  ++ + S D  +++WD +T   VE     
Sbjct: 495 IWDLRTGQCSL--TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSE 552

Query: 196 ---HMAHTSECWGLAIHNDL--VITTSTESQIKIWNLD 228
                 H    + +    D   V++ S +  +K+WNL+
Sbjct: 553 NELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLN 590

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 103/234 (44%), Gaps = 30/234 (12%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
           LQGH  D+ S+D      KL++ + + T++IW+++T  C  T   E G          G 
Sbjct: 465 LQGHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGK 524

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADKTV 491
            +  G+    ++++D  +  L+E  +        H  +++S+  T DG  +V+GS D++V
Sbjct: 525 YIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSV 584

Query: 492 KFWDF-----KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLD 546
           K W+      K  +  +PGT +      K F          +L+V  +  ++++     D
Sbjct: 585 KLWNLNDANNKDLKPNVPGTCEVTYTGHKDF----------VLSVATTQGDEYILSGSKD 634

Query: 547 NTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
             V  +   S    L L GH+  V+S+ ++    L        T S D   +IW
Sbjct: 635 RGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIW 688

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 86/210 (40%), Gaps = 43/210 (20%)

Query: 45  VNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           V  WD++TG+ S  L+  DG+   AV  +  K               +A G  D  +++W
Sbjct: 493 VRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGKY--------------IAAGSLDRAVRVW 538

Query: 103 DLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDIIIWDL--------- 146
           D  +  ++   +       GHK ++  + F   G  ++SGS D  + +W+L         
Sbjct: 539 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLK 598

Query: 147 --VGEVGLYKLRSHKDSITGIWC-ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSEC 203
             V          HKD +  +   + +++++S SKD  +  WD K+   +     H +  
Sbjct: 599 PNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 658

Query: 204 WGLAIHN--------DLVITTSTESQIKIW 225
             +A+ N         +  T S + + +IW
Sbjct: 659 ISVAVANGHPLGTEYGVFATGSGDCKARIW 688

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 71/172 (41%), Gaps = 26/172 (15%)

Query: 37  ILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNLLAVGY 94
           I  G+L+  V  WD +TG L + L       + +   T   +S Y + +  + N +  G 
Sbjct: 526 IAAGSLDRAVRVWDSETGFLVERLD------SENELGTGHKDSVYSVVFTRDGNNVVSGS 579

Query: 95  ADGVIKIWDL-----------ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIII 143
            D  +K+W+L           +  T  + + GHK  +  +        ++SGSKD  ++ 
Sbjct: 580 LDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLF 639

Query: 144 WDLVGEVGLYKLRSHKDSITGIWCENEDWL-------ISTSKDGLIKIWDLK 188
           WD      L  L+ H++S+  +   N   L        + S D   +IW  +
Sbjct: 640 WDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIWKYR 691

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 120/274 (43%), Gaps = 39/274 (14%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTG 485
           Y  +  F P G  +  G     ++++DL +  +L   +  H   I+SLD    G +LV+G
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 412

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + D +  V +S  D K++A   
Sbjct: 413 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 455

Query: 545 LDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSKLLITSSADKNIKIWGL- 596
           LD TV+V      F +  +     L  GHK  V S+  + D + +I+ S D+++K+W L 
Sbjct: 456 LDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLR 515

Query: 597 ------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH 650
                     C  +   H+D ++SV    +     S SKD  V +WD      +  L  H
Sbjct: 516 GLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGH 575

Query: 651 QSEVWALAISN------DARFVVSTSHDHSIRVW 678
           ++ V ++A+ N      D     + S D   R+W
Sbjct: 576 RNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 99/226 (43%), Gaps = 37/226 (16%)

Query: 37  ILTGALENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAE----------STYLQ---- 82
           + TG  +    + + TGEL   L+D    G  +  ST  A           S  +Q    
Sbjct: 291 LATGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENSATIQPASS 350

Query: 83  ---------YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLI 133
                    + P+   LA G  D +I+IWDL +K +L+   GH+  I  L + P G +L+
Sbjct: 351 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 134 SGSKDSDIIIWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQ 190
           SGS D  + IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T 
Sbjct: 411 SGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 468

Query: 191 QCVET-------HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
             VE           H    + +    D   VI+ S +  +K+W+L
Sbjct: 469 FLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDL 514

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 109/232 (46%), Gaps = 26/232 (11%)

Query: 379 IELQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL-PG- 435
           + LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T      +T   + PG 
Sbjct: 388 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 447

Query: 436 GALVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADK 489
           G  +  G+    ++++D  +  L+E  +        H  +++S+  T DG+ +++GS D+
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDR 507

Query: 490 TVKFWDFK-VDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNT 548
           +VK WD + ++ +    T +      K F          +L+V  + D++++     D  
Sbjct: 508 SVKLWDLRGLNGQKSHATCEVTYTGHKDF----------VLSVATTQDDEYILSGSKDRG 557

Query: 549 VKVFFLNSMKFFLSLYGHKLPVLSIDI------SFDSKLLITSSADKNIKIW 594
           V  +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 558 VLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 91/214 (42%), Gaps = 26/214 (12%)

Query: 466 HGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELN 525
           H + +  +  ++DG+ L TG  +KT + +     + L            ++  D+   +N
Sbjct: 275 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELLA-----------RLSDDSVAGVN 322

Query: 526 DDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585
           ++         N   A +  +N+  +   +S   +         + S+  S D K L T 
Sbjct: 323 NE---ASTGPANNGTADNGGENSATIQPASSSDLY---------IRSVCFSPDGKYLATG 370

Query: 586 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQ 645
           + DK I+IW L       +L  H+  I S+ + P      S S D  V+ WD    +C  
Sbjct: 371 AEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSL 430

Query: 646 KLAAHQSEVWALAIS-NDARFVVSTSHDHSIRVW 678
            L+  +  V  +A+S  D +++ + S D ++RVW
Sbjct: 431 TLSI-EDGVTTVAVSPGDGKYIAAGSLDRTVRVW 463

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 84/206 (40%), Gaps = 39/206 (18%)

Query: 45  VNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           V  WD++TG+ S  L+  DG+   AV     K               +A G  D  +++W
Sbjct: 418 VRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKY--------------IAAGSLDRTVRVW 463

Query: 103 DLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGL--- 152
           D  +  ++   +       GHK ++  + F   G  +ISGS D  + +WDL G  G    
Sbjct: 464 DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSH 523

Query: 153 ----YKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLA 207
                    HKD +  +    +D +++S SKD  +  WD  +   +     H +    +A
Sbjct: 524 ATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVA 583

Query: 208 IHNDLVI--------TTSTESQIKIW 225
           + N   +        T S + + +IW
Sbjct: 584 VVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 63/147 (42%), Gaps = 15/147 (10%)

Query: 32  GSAGQILTGALE-NVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNL 89
           G    I  G+L+  V  WD +TG L + L       + +  ST   +S Y + +  +   
Sbjct: 446 GDGKYIAAGSLDRTVRVWDSETGFLVERLD------SENELSTGHKDSVYSVVFTRDGQG 499

Query: 90  LAVGYADGVIKIWDLIS-------KTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           +  G  D  +K+WDL          T  + + GHK  +  +        ++SGSKD  ++
Sbjct: 500 VISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVL 559

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWCEN 169
            WD      L  L+ H++S+  +   N
Sbjct: 560 FWDTASGNPLLMLQGHRNSVISVAVVN 586

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 145/340 (42%), Gaps = 65/340 (19%)

Query: 384 HRTDVRSIDISDDNKLLATASNGTLKIWNIKT------------HACIRTFECG------ 425
           H + V  +  S D K LAT  N T +I+++ T            +  I T          
Sbjct: 278 HDSVVCCVKFSQDGKYLATGCNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETVT 337

Query: 426 -----YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480
                Y  +  F P G  +  G     ++++++    ++   +  H   I+SLD   DG+
Sbjct: 338 TTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLK-GHEQDIYSLDYFPDGQ 396

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKF 539
           +LV+GS D++++ WD K  Q  +                 TL + D +  V +S ++ K 
Sbjct: 397 KLVSGSGDRSIRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPNEGKL 439

Query: 540 LAVSLLDNTVKVFFLNSMKFFL---------SLYGHKLPVLSIDISFDSKLLITSSADKN 590
           +A   LD +V+++  +S   FL         S  GH+  V S+  + D + +++ S D+ 
Sbjct: 440 IAAGSLDRSVRIW--DSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRT 497

Query: 591 IKIWGLD-----FGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQ 645
           +K+W L       G C  +   H+D ++SV    +    FS SKD  V  WD D    + 
Sbjct: 498 VKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPIL 557

Query: 646 KLAAHQSEVWALAISN-------DARFVVSTSHDHSIRVW 678
            L  H++ V ++A  N       + +   + S D   R+W
Sbjct: 558 MLQGHRNSVISVATVNSNVDDGKNYKLFATGSGDCKARIW 597

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 111/227 (48%), Gaps = 15/227 (6%)

Query: 465 AHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQ---ELIPGTVDKFVPKLKIFHDTT 521
            H + +  +  + DGK L TG  ++T + +D    +   +L+  TV+  +      ++ T
Sbjct: 277 PHDSVVCCVKFSQDGKYLATG-CNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNET 335

Query: 522 LELNDD--ILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDS 579
           +    D  I ++  S D +FLA    D  ++++ +   K  + L GH+  + S+D   D 
Sbjct: 336 VTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDG 395

Query: 580 KLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC-SKDGLVKYWDG 638
           + L++ S D++I+IW L  G C  +L + +D + +V   P      +  S D  V+ WD 
Sbjct: 396 QKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDS 454

Query: 639 DKFECVQKL-------AAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
                V++L         HQ  V+++A + D + VVS S D ++++W
Sbjct: 455 STGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLW 501

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 111/230 (48%), Gaps = 27/230 (11%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
           L+GH  D+ S+D   D  KL++ + + +++IW++KT  C  T   E G          G 
Sbjct: 379 LKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGK 438

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKE------DAHGAAIWSLDLTSDGKRLVTGSADKTV 491
           L+  G+    ++++D ++  L+E  +      + H  +++S+  T DG+ +V+GS D+TV
Sbjct: 439 LIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTV 498

Query: 492 KFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKV 551
           K W+         G       K ++   T +   D +L+V  S+D+K++     D  V +
Sbjct: 499 KLWNL--------GDTQSGTGKCEV---TYIGHKDFVLSVATSNDDKYIFSGSKDRGVII 547

Query: 552 FFLNSMKFFLSLYGHKLPVLS-------IDISFDSKLLITSSADKNIKIW 594
           +  +S    L L GH+  V+S       +D   + KL  T S D   +IW
Sbjct: 548 WDKDSGNPILMLQGHRNSVISVATVNSNVDDGKNYKLFATGSGDCKARIW 597

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 101/212 (47%), Gaps = 23/212 (10%)

Query: 37  ILTGALENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAEST------YLQ---YHPET 87
           + TG       +D+ TGEL   L D     A+   +T+  E+       Y++   + P+ 
Sbjct: 294 LATGCNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETVTTTADLYIRSICFSPDG 353

Query: 88  NLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL- 146
             LA G  D +I+IW++  + +++   GH+  I  L + P G +L+SGS D  I IWDL 
Sbjct: 354 EFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLK 413

Query: 147 VGEVGLYKLRSHKDSITGIWCE-NEDWLIST-SKDGLIKIWDLKTQQCV-------ETHM 197
            G+  L    S +D +T +    NE  LI+  S D  ++IWD  T   V       E+  
Sbjct: 414 TGQCSL--TLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGN 471

Query: 198 AHTSECWGLAIHND--LVITTSTESQIKIWNL 227
            H    + +A   D   V++ S +  +K+WNL
Sbjct: 472 GHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

 Score = 35.4 bits (80), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 57/141 (40%), Gaps = 11/141 (7%)

Query: 37  ILTGALE-NVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYA 95
           I  G+L+ +V  WD  TG L + L      G     S      T    H     +  G  
Sbjct: 440 IAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQH-----VVSGSL 494

Query: 96  DGVIKIWDLI-----SKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEV 150
           D  +K+W+L      +    + + GHK  +  +        + SGSKD  +IIWD     
Sbjct: 495 DRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGN 554

Query: 151 GLYKLRSHKDSITGIWCENED 171
            +  L+ H++S+  +   N +
Sbjct: 555 PILMLQGHRNSVISVATVNSN 575

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 130/294 (44%), Gaps = 40/294 (13%)

Query: 387 DVRSIDISDDNKLLATA-SNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRG 445
           D+ S++ SDD++L A    +  +K+W++           G +L    +P         + 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLD----------GSSLISNKIPS-------YKR 526

Query: 446 GDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPG 505
            +++  D A+STL+      H  +++S   + D + L++GS DKTV+ W       L+  
Sbjct: 527 KEMETTDPATSTLI-----GHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALV-- 579

Query: 506 TVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYG 565
                         +    N  +  VK S    + A +  D T +++  + +       G
Sbjct: 580 --------------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 625

Query: 566 HKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFF 625
           H   V ++    +   + T S+DK  ++W +  GD  +  + H   I+S    P+     
Sbjct: 626 HLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLC 685

Query: 626 SCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
           + S DGL+  WD    + ++++  H ++ V +L ++ +   ++S   DHS+RVW
Sbjct: 686 TGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVW 739

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 80/184 (43%), Gaps = 23/184 (12%)

Query: 514 LKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFL------------ 561
           +  FH+T    N D+ +++ S D++  A    D+ +K++ L+                  
Sbjct: 475 MYTFHNT----NRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEME 530

Query: 562 -------SLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMS 614
                  +L GH   V S   S DS+ L++ S DK +++W LD      S   H   +  
Sbjct: 531 TTDPATSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWD 590

Query: 615 VKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHS 674
           VKF P  H F + S D   + W  D    ++  A H S+V  ++   +  +V + S D +
Sbjct: 591 VKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKT 650

Query: 675 IRVW 678
            R+W
Sbjct: 651 CRMW 654

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 93/235 (39%), Gaps = 16/235 (6%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P++  L  G  D  +++W L + T L+++ GH   +  ++F P G    + S D    
Sbjct: 551 FSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASHDQTAR 610

Query: 143 IWDLVGEVGLYKLRSH-KDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS 201
           +W       L     H  D  T  +  N  ++ + S D   ++WD+ T   V     HT+
Sbjct: 611 LWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTA 670

Query: 202 ECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGV-SVEFIT 258
                 +  D   + T S +  I +W++   K +           KQ +  G  +V  +T
Sbjct: 671 PILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRI-----------KQMRGHGKNAVHSLT 719

Query: 259 TSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMADEKIQQNIKD 313
            +   N      AD +V ++ ++        L   +  +   G     I Q++KD
Sbjct: 720 LNKEGNVLLSGGADHSVRVWDLKKATN-EPGLEPEQPFIGHIGDVTASINQDVKD 773

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 66/151 (43%), Gaps = 4/151 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +++ P  +  A    D   ++W       L  F GH S +  + F P G  + +GS D  
Sbjct: 591 VKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKT 650

Query: 141 IIIWDL-VGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +WD+  G+   Y        ++ +   +  WL + S DGLI +WD+ T + ++    H
Sbjct: 651 CRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGH 710

Query: 200 TSEC---WGLAIHNDLVITTSTESQIKIWNL 227
                    L    +++++   +  +++W+L
Sbjct: 711 GKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 70/151 (46%), Gaps = 5/151 (3%)

Query: 381 LQGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
             GH +DV ++    +   + T +S+ T ++W+I T   +R F       L+    P G 
Sbjct: 623 FAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGR 682

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +  G+  G + L+D+ +   ++        A+ SL L  +G  L++G AD +V+ WD K
Sbjct: 683 WLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

Query: 498 VDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
                 PG ++   P +    D T  +N D+
Sbjct: 743 KATNE-PG-LEPEQPFIGHIGDVTASINQDV 771

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 68/171 (39%), Gaps = 22/171 (12%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIWDLISKTVLIN-------------------FNGHKSA 119
           T L++  ++ L A G+ D  IK+W L   +++ N                     GH  +
Sbjct: 486 TSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHSGS 545

Query: 120 ITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSK 178
           +    F P    L+SGS+D  + +W L     L   + H   +  + +     +  + S 
Sbjct: 546 VYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASH 605

Query: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
           D   ++W       +     H S+   ++ H +   V T S++   ++W++
Sbjct: 606 DQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDI 656

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 2/116 (1%)

Query: 75  LAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLIS 134
           L++   + +HP    +  G +D   ++WD+ +   +  F  H + I      P G  L +
Sbjct: 627 LSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCT 686

Query: 135 GSKDSDIIIWDLVGEVGLYKLRSH-KDSITGIWCENE-DWLISTSKDGLIKIWDLK 188
           GS D  I +WD+     + ++R H K+++  +    E + L+S   D  +++WDLK
Sbjct: 687 GSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 54/141 (38%), Gaps = 22/141 (15%)

Query: 110 LINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVG------EVGLYK--------- 154
           +  F+     +T L F        +G +DS I +W L G      ++  YK         
Sbjct: 475 MYTFHNTNRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDP 534

Query: 155 ----LRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH 209
               L  H  S+    +  +  +L+S S+D  +++W L T   + ++  H    W +   
Sbjct: 535 ATSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFS 594

Query: 210 --NDLVITTSTESQIKIWNLD 228
                  T S +   ++W+ D
Sbjct: 595 PLGHYFATASHDQTARLWSCD 615

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 92/202 (45%), Gaps = 14/202 (6%)

Query: 482 LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELN-----DDILAVKISSD 536
           L+T S D TVK W        +P   D+F   ++I+  ++ E        DI  + IS +
Sbjct: 471 LITASNDLTVKKWK-------VPKPTDRF--DIEIYSISSSEYTRRAHEKDINMLSISPN 521

Query: 537 NKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGL 596
           +   A +  D T K++ L + +   +L  HK  +  +      K + T+S DK +KIW L
Sbjct: 522 DSIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSL 581

Query: 597 DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWA 656
           D     K+L  H +++    F  +     S   DGLVK WD    EC+  L  H + +WA
Sbjct: 582 DTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWA 641

Query: 657 LAISNDARFVVSTSHDHSIRVW 678
           L +  D   V++   D   + W
Sbjct: 642 LNVIKDGDIVITADADGVFQFW 663

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 92/208 (44%), Gaps = 9/208 (4%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L   P  ++ A    D   KIWDL +  +    N HK  +  + F      + + S D  
Sbjct: 516 LSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKT 575

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
           + IW L     +  L  H +++    +   +  L+ST  DGL+K+WD  T +C+ T   H
Sbjct: 576 VKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGH 635

Query: 200 TSECWGLAI--HNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSVE-F 256
            +  W L +    D+VIT   +   + W  D  ++   + IEK   EK   ++  ++E +
Sbjct: 636 DNRIWALNVIKDGDIVITADADGVFQFWK-DRTEEAREEDIEK---EKLKVEQMQTLENY 691

Query: 257 ITTSDGVNFFYIQ-NADKTVEIFRVRTQ 283
           I++ D  N F +    D    ++ V  Q
Sbjct: 692 ISSGDWTNAFLLAITLDHPARLYNVLKQ 719

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 102/241 (42%), Gaps = 28/241 (11%)

Query: 447 DLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGT 506
           D++++ ++SS   E    AH   I  L ++ +     T S DKT K WD +  +  +  T
Sbjct: 493 DIEIYSISSS---EYTRRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGE--LKAT 547

Query: 507 VDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH 566
           ++     L                V     +KF+A +  D TVK++ L++     +L GH
Sbjct: 548 LNNHKRGL--------------WDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLEGH 593

Query: 567 KLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFS 626
              V         K L+++ AD  +K+W    G+C  +L  H + I ++  + +     +
Sbjct: 594 SNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALNVIKDGDIVIT 653

Query: 627 CSKDGLVKYWDGDKFECV------QKLAAHQSEVWALAISND---ARFVVSTSHDHSIRV 677
              DG+ ++W     E        +KL   Q +     IS+      F+++ + DH  R+
Sbjct: 654 ADADGVFQFWKDRTEEAREEDIEKEKLKVEQMQTLENYISSGDWTNAFLLAITLDHPARL 713

Query: 678 W 678
           +
Sbjct: 714 Y 714

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 68/131 (51%), Gaps = 13/131 (9%)

Query: 71  KSTKLAESTY-LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRF---D 126
           KS K++  +Y L+  P + LLA+G  DG + + D+ +  +  +  GH + I+ L+F    
Sbjct: 109 KSMKISSPSYVLETDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQ 168

Query: 127 PTGTRLI-SGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI--------WCENEDWLISTS 177
            T T L+ SG  +  + IWDLV    ++ L+ H  ++ GI          E+   LI+ +
Sbjct: 169 HTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGA 228

Query: 178 KDGLIKIWDLK 188
           +D +I  W+ K
Sbjct: 229 RDDVINHWEFK 239

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 57/117 (48%), Gaps = 4/117 (3%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFE--CGYALTCKFLPGGA 437
           L  H+  +  +     +K +ATAS + T+KIW++ T   ++T E        C F     
Sbjct: 548 LNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQK 607

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFW 494
            +V     G ++L+D ++   + N  D H   IW+L++  DG  ++T  AD   +FW
Sbjct: 608 QLVSTGADGLVKLWDCSTGECI-NTLDGHDNRIWALNVIKDGDIVITADADGVFQFW 663

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 64/151 (42%), Gaps = 19/151 (12%)

Query: 48  WDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISK 107
           WD++TGEL   L +             L + ++ QY      +A    D  +KIW L + 
Sbjct: 537 WDLETGELKATLNN---------HKRGLWDVSFCQYD---KFIATASGDKTVKIWSLDTF 584

Query: 108 TVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWC 167
           TV+    GH +A+    F     +L+S   D  + +WD      +  L  H +    IW 
Sbjct: 585 TVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNR---IWA 641

Query: 168 EN----EDWLISTSKDGLIKIWDLKTQQCVE 194
            N     D +I+   DG+ + W  +T++  E
Sbjct: 642 LNVIKDGDIVITADADGVFQFWKDRTEEARE 672

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 73/175 (41%), Gaps = 12/175 (6%)

Query: 515 KIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSID 574
           +I H    +   +I A+ ++ D ++L        +K+F L++ K   S+     P   ++
Sbjct: 63  QILHKIENDDEQEITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS-PSYVLE 121

Query: 575 ISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN----FFSCSKD 630
               S LL     D ++ +  ++ G    SL  H  +I S+KF  E H       S   +
Sbjct: 122 TDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTN 181

Query: 631 GLVKYWDGDKFECVQKLAAHQSEVWALAI-------SNDARFVVSTSHDHSIRVW 678
           G+VK WD    + +  L  H S V  +         S D+  +++ + D  I  W
Sbjct: 182 GMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHW 236

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 83/357 (23%), Positives = 144/357 (40%), Gaps = 80/357 (22%)

Query: 384 HRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACI---------------------RTF 422
           H + V  +  S+D + LAT  N T +++ + T A +                      + 
Sbjct: 303 HSSVVCCVRFSNDGEYLATGCNKTTQVYKVSTGALVARLSDDSASTTANSSISQDANNSG 362

Query: 423 ECG--------------YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGA 468
           E G              Y  +  F P G  +  G     ++++DL++  ++   +  H  
Sbjct: 363 ENGENAVSSASTSSSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQ-GHEQ 421

Query: 469 AIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
            I+SLD    G +LV+GS D+TV+ WD +  Q  +                 TL + D +
Sbjct: 422 DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGV 464

Query: 529 LAVKISS-DNKFLAVSLLDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSK 580
             V +S  + KF+A   LD T++V      F +  +     L  GHK  V S+  + D +
Sbjct: 465 TTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQ 524

Query: 581 LLITSSADKNIKIWGLD-------------FGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
            +++ S D+++K+W L                 C  +   H+D ++SV          S 
Sbjct: 525 GVVSGSLDRSVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSG 584

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN------DARFVVSTSHDHSIRVW 678
           SKD  V +WD      +  L  H++ V ++A++N      D     + S D   R+W
Sbjct: 585 SKDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 79/157 (50%), Gaps = 14/157 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWDL +K +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 386 FSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 445

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET---- 195
           IWDL  G+  L    S +D +T +     +  ++ + S D  +++WD +T   VE     
Sbjct: 446 IWDLRTGQCSL--TLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSE 503

Query: 196 ---HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
                 H    + +    D   V++ S +  +K+WNL
Sbjct: 504 NELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNL 540

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 108/235 (45%), Gaps = 18/235 (7%)

Query: 375 KLYTIELQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL 433
           K   + LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T      +T   +
Sbjct: 410 KRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAV 469

Query: 434 -PG-GALVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTG 485
            PG G  +  G+    L+++D  +  L+E  +        H  +++S+  T DG+ +V+G
Sbjct: 470 SPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSG 529

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLL 545
           S D++VK W+          + +   P       T     D +L+V  + ++K++     
Sbjct: 530 SLDRSVKLWNL---HNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSK 586

Query: 546 DNTVKVFFLNSMKFFLSLYGHKLPVLSIDIS------FDSKLLITSSADKNIKIW 594
           D  V  +   S    L L GH+  V+S+ ++       D  +  T S D   +IW
Sbjct: 587 DRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 98/236 (41%), Gaps = 46/236 (19%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD++TG+ S  L+  DG+   AV                 E   
Sbjct: 431 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPG--------------EGKF 476

Query: 90  LAVGYADGVIKIWDLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDII 142
           +A G  D  +++WD  +  ++   +       GHK ++  + F   G  ++SGS D  + 
Sbjct: 477 IAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVK 536

Query: 143 IWDLVGEVGLYKLRS-------------HKDSITGIWC-ENEDWLISTSKDGLIKIWDLK 188
           +W+L       K  S             HKD +  +   +N+ +++S SKD  +  WD +
Sbjct: 537 LWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQ 596

Query: 189 TQQCVETHMAHTSECWGLAIHNDLVI--------TTSTESQIKIWNLDLDKDMGSK 236
           +   +     H +    +A+ N   +        T S + + +IW    +K   S+
Sbjct: 597 SGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWKYSKNKANASE 652

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 123/286 (43%), Gaps = 58/286 (20%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKE-----DAHGAAIWSLDLTSDGK 480
           Y  +  F P G  +  G     ++++D+      EN++       H   I+SLD    G 
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDI------ENRKIVMILQGHEQDIYSLDYFPSGD 498

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKF 539
           +LV+GS D+TV+ WD +  Q  +                 TL + D +  V +S  D K+
Sbjct: 499 KLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKY 541

Query: 540 LAVSLLDNTVKVFFLNSMKFFL---------SLYGHKLPVLSIDISFDSKLLITSSADKN 590
           +A   LD  V+V+  +S   FL         S  GHK  V S+  + D + +++ S D++
Sbjct: 542 IAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRS 599

Query: 591 IKIWGL------------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDG 638
           +K+W L            + G C  +   H+D ++SV          S SKD  V +WD 
Sbjct: 600 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 659

Query: 639 DKFECVQKLAAHQSEVWALAISNDARF------VVSTSHDHSIRVW 678
                +  L  H++ V ++A++N +          + S D   R+W
Sbjct: 660 KSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 80/157 (50%), Gaps = 14/157 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+ ++ +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 451 FSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 510

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCV------ 193
           IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   V      
Sbjct: 511 IWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSE 568

Query: 194 -ETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
            E+   H    + +    D   V++ S +  +K+WNL
Sbjct: 569 NESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNL 605

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 110/236 (46%), Gaps = 19/236 (8%)

Query: 374 NKLYTIELQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKF 432
           N+   + LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T      +T   
Sbjct: 474 NRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVA 533

Query: 433 L-PG-GALVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVT 484
           + PG G  +  G+    ++++D  +  L+E  +        H  +++S+  T DG+ +V+
Sbjct: 534 VSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVS 593

Query: 485 GSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSL 544
           GS D++VK W+ +          D   P       T +   D +L+V  + +++++    
Sbjct: 594 GSLDRSVKLWNLQNAN----NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGS 649

Query: 545 LDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
            D  V  +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 650 KDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 49/111 (44%)

Query: 568 LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
           L + S+  S D K L T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           S D  V+ WD    +C   L+             D +++ + S D ++RVW
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 554

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 98/226 (43%), Gaps = 49/226 (21%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD++TG+ S  L+  DG+   AV     K               
Sbjct: 496 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKY-------------- 541

Query: 90  LAVGYADGVIKIWDLISKTVLI---------NFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +A G  D  +++WD  S+T  +         +  GHK ++  + F   G  ++SGS D  
Sbjct: 542 IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRS 599

Query: 141 IIIWDL----------VGEVGLYKLR--SHKDSITGIWC-ENEDWLISTSKDGLIKIWDL 187
           + +W+L              G  ++    HKD +  +   +N+++++S SKD  +  WD 
Sbjct: 600 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 659

Query: 188 KTQQCVETHMAHTSECWGLAIHN--------DLVITTSTESQIKIW 225
           K+   +     H +    +A+ N        ++  T S + + +IW
Sbjct: 660 KSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 72/166 (43%), Gaps = 15/166 (9%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L Y P  + L  G  D  ++IWDL +    +  +      TV      G  + +GS D  
Sbjct: 491 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 550

Query: 141 IIIWDLVGEVGLYKLR---------SHKDSI-TGIWCENEDWLISTSKDGLIKIWDLK-T 189
           + +WD   E G    R          HKDS+ + ++  +   ++S S D  +K+W+L+  
Sbjct: 551 VRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNA 608

Query: 190 QQCVETHMAHTSECWGLAI-HNDLVITTSTESQIKIWNLDLDKDMG 234
               ++   ++  C    I H D V++ +T +Q   + L   KD G
Sbjct: 609 NNKSDSKTPNSGTCEVTYIGHKDFVLSVAT-TQNDEYILSGSKDRG 653

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 71/178 (39%), Gaps = 27/178 (15%)

Query: 32  GSAGQILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNL 89
           G    I  G+L+  V  WD +TG L + L       + +   T   +S Y + +  +   
Sbjct: 537 GDGKYIAAGSLDRAVRVWDSETGFLVERL------DSENESGTGHKDSVYSVVFTRDGQS 590

Query: 90  LAVGYADGVIKIWDLI------------SKTVLINFNGHKSAITVLRFDPTGTRLISGSK 137
           +  G  D  +K+W+L             S T  + + GHK  +  +        ++SGSK
Sbjct: 591 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 650

Query: 138 DSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWL-------ISTSKDGLIKIWDLK 188
           D  ++ WD      L  L+ H++S+  +   N   L        + S D   +IW  K
Sbjct: 651 DRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYK 708

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 118/278 (42%), Gaps = 31/278 (11%)

Query: 432 FLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTV 491
            +   AL   G+  GD+++ D  +  ++   E+ H   I  L   S    LV+G+ D  V
Sbjct: 194 LMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLV 253

Query: 492 KFWDFKVDQELI---------PGTV--------DKFVPKLK---------IFHDTTLELN 525
           K   F  D ++I          G V         +FV             I  +T L+  
Sbjct: 254 KIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQ 313

Query: 526 D----DILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL 581
           +    ++ ++   +D   L    LDN   V+ + + K  ++L GH  P+ S+D S D   
Sbjct: 314 EGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYH 373

Query: 582 LITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPES-HNFFSCSKDGLVKYWDGDK 640
           + T   D  I IW +        L AH + +  V+F   + H   SC  D  ++ +  D 
Sbjct: 374 IATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDN 433

Query: 641 FECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           +  V+ L  H  ++  + IS DA+ +VS+  D S+++W
Sbjct: 434 WIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 68/152 (44%), Gaps = 4/152 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    +A    D   ++WD+ S+T L    GH   +  L F   G  L SG  D+ 
Sbjct: 281 VDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNA 340

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
            I+WD+     +  L+ H   I  + W  +   + +   DG+I IWD++        +AH
Sbjct: 341 AIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAH 400

Query: 200 TSECWGLAIH---NDLVITTSTESQIKIWNLD 228
            +   G+         +++   + QI+I++ D
Sbjct: 401 NNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSD 432

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 68/149 (45%), Gaps = 4/149 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L +  +  LL  G  D    +WD+ +   ++N  GH   I  + + P G  + +G  D  
Sbjct: 323 LSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGV 382

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENE--DWLISTSKDGLIKIWDLKTQQCVETHMA 198
           I IWD+       +L +H + +TG+  +      L+S   D  I+I+       V+T   
Sbjct: 383 INIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEG 442

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIW 225
           HT +   + I  D  L++++  +  +K+W
Sbjct: 443 HTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 90/212 (42%), Gaps = 12/212 (5%)

Query: 89  LLAVGYADGVIKIWDLISKTVLINF-NGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLV 147
           L A G   G IKI D  +  V+    NGH   I  L ++ T T L+SG+ D  + I    
Sbjct: 200 LCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFD 259

Query: 148 GEVGLYK----LRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSE 202
            +V + K    L+ H   +  + +  +  ++ S S D   ++WD++++  ++    H  E
Sbjct: 260 PDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKE 319

Query: 203 CWGLAIHND--LVITTSTESQIKIWNLDLDKD-MGSKLIEKGIYEKQSKQRGVSVEFITT 259
            + L+  ND  L+ +   ++   +W++   K  M  +   K IY       G     I T
Sbjct: 320 VYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGY---HIAT 376

Query: 260 SDGVNFFYIQNADKTVEIFRVRTQEEISKALR 291
             G     I +  KT E  R+     I   +R
Sbjct: 377 GGGDGVINIWDIRKTTETTRLLAHNNIVTGVR 408

 Score = 38.5 bits (88), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 58/120 (48%), Gaps = 5/120 (4%)

Query: 379 IELQGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNI-KTHACIRTFECGYALT-CKFLPG 435
           + LQGH   + S+D S D   +AT   +G + IW+I KT    R       +T  +F   
Sbjct: 353 MNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKS 412

Query: 436 GALVVVGNRGGDLQLFDLASSTLLENKE-DAHGAAIWSLDLTSDGKRLVTGSADKTVKFW 494
               +V + G D Q+   +S   ++ K  + H   I  +D++ D + +V+   D+++K W
Sbjct: 413 TGHCLV-SCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 63/154 (40%), Gaps = 7/154 (4%)

Query: 81  LQYHPETNLLAVGYADGVIKI--WDLISKTV--LINFNGHKSAITVLRFDPTGTRLISGS 136
           L ++     L  G  D ++KI  +D   K +  L    GH   +  + F P+G  + S S
Sbjct: 235 LAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASAS 294

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLI-STSKDGLIKIWDLKTQQCVET 195
            D    +WD+  E  L     H   +  +  +N+  L+ S   D    +WD++T + +  
Sbjct: 295 FDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMN 354

Query: 196 HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
              H    + +    D   + T   +  I IW++
Sbjct: 355 LQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDI 388

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 89.0 bits (219), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 116/271 (42%), Gaps = 29/271 (10%)

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
           ++V   + GGDL++    +  +++  + AH + I  +D   DG  LVTG+A+  ++ W+ 
Sbjct: 195 SMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANGEIRIWNL 254

Query: 497 KVDQELIPGTVD---------KFVPKLKIFHDTTLELN-------------------DDI 528
             D E   GT+          +F P  K     + ++                     ++
Sbjct: 255 NNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEV 314

Query: 529 LAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSAD 588
             V    D   L  + LD+   V+ L S K  ++L GH  P+  +D S +   + T SAD
Sbjct: 315 YCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGSAD 374

Query: 589 KNIKIWGLDFGDCHKSLFAHQDSIMSVKF-VPESHNFFSCSKDGLVKYWDGDKFECVQKL 647
             I++W +       +L AH   +  VKF     H   S S D  +  + GD +  +  +
Sbjct: 375 GTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDNWTKLSVI 434

Query: 648 AAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             H  ++ ++ IS D   + S+  D S++ W
Sbjct: 435 QGHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 76/152 (50%), Gaps = 5/152 (3%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLI--SKTVLINFNGHKSAITVLRFDPTGTRLISGSKD 138
           + ++P+   L  G A+G I+IW+L   S++      GH++ +  +RF P+G  + S S D
Sbjct: 231 VDWNPDGTALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFD 290

Query: 139 SDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLI-STSKDGLIKIWDLKTQQCVETHM 197
               +WD+  ++ L     H   +  +  + +  L+ ST  D +  +WDL++ + +    
Sbjct: 291 MTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALE 350

Query: 198 AHTSECWGL--AIHNDLVITTSTESQIKIWNL 227
            H    +GL  + +   + T S +  I++W++
Sbjct: 351 GHIKPIYGLDWSPNGYDIATGSADGTIRLWDV 382

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 102/222 (45%), Gaps = 25/222 (11%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYA--LTC-KFLPGG 436
           L GH   V  +      K +A+AS + T ++W+++    ++  E G+A  + C  F   G
Sbjct: 265 LTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQE-GHAKEVYCVAFQKDG 323

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
           +L+          ++DL S   +   E  H   I+ LD + +G  + TGSAD T++ WD 
Sbjct: 324 SLLCSTGLDSVGLVWDLRSGKSIMALE-GHIKPIYGLDWSPNGYDIATGSADGTIRLWD- 381

Query: 497 KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILA-VKISSDN-KFLAVSLLDNTVKVFFL 554
                         V K+ I     L  ++ I++ VK    N  +L  S  D T+ ++  
Sbjct: 382 --------------VRKVGIL--GALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSG 425

Query: 555 NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGL 596
           ++      + GH   +LS+DIS D   L +S  D+++K W L
Sbjct: 426 DNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSL 467

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 61/139 (43%), Gaps = 4/139 (2%)

Query: 64  PPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVL 123
           P G +     ++A    +++HP    +A    D   ++WD+  +  L    GH   +  +
Sbjct: 261 PAGTLTGHENRVAR---VRFHPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEVYCV 317

Query: 124 RFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLI 182
            F   G+ L S   DS  ++WDL     +  L  H   I G+ W  N   + + S DG I
Sbjct: 318 AFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGSADGTI 377

Query: 183 KIWDLKTQQCVETHMAHTS 201
           ++WD++    +    AH S
Sbjct: 378 RLWDVRKVGILGALPAHNS 396

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 2/110 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFD-PTGTRLISGSKDS 139
           L + P    +A G ADG I++WD+    +L     H S ++ ++FD   G  L+S S D 
Sbjct: 359 LDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDK 418

Query: 140 DIIIWDLVGEVGLYKLRSHKDSITGIWCENE-DWLISTSKDGLIKIWDLK 188
            + I+       L  ++ H D I  +    +   L S+  D  +K W LK
Sbjct: 419 TLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSLK 468

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 60/118 (50%), Gaps = 5/118 (4%)

Query: 115 GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLV--GEVGLYKLRSHKDSITGI-WCENED 171
            H S I  + ++P GT L++G+ + +I IW+L    E     L  H++ +  + +  +  
Sbjct: 223 AHDSKIGGVDWNPDGTALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGK 282

Query: 172 WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
           ++ S S D   ++WD++ Q  ++    H  E + +A   D  L+ +T  +S   +W+L
Sbjct: 283 YVASASFDMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDL 340

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 5/124 (4%)

Query: 379 IELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALT--CKF-LP 434
           + L+GH   +  +D S +   +AT S +GT+++W+++    +       ++    KF   
Sbjct: 347 MALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKA 406

Query: 435 GGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFW 494
            G  +V  +    L ++   + T L   +  H   I S+D+++DG  L +   D+++K W
Sbjct: 407 NGHYLVSSSYDKTLNIYSGDNWTKLSVIQ-GHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

Query: 495 DFKV 498
             K+
Sbjct: 466 SLKI 469

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 97/439 (22%), Positives = 179/439 (40%), Gaps = 101/439 (23%)

Query: 82  QYHPETN-LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           Q+ P T+  +  G  D   ++WD  ++T +   +GH++ +  + + P G  + +GS D  
Sbjct: 150 QFAPHTSSRMVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVAWSPDGETIATGSMDCT 209

Query: 141 IIIWDL-VGEVGLYKLRSHKDSITGIWCE--------NEDWLISTSKDGLIKIWDLKTQQ 191
           + +WD   G+     L+ H+  IT +  E        ++  L S SKDG IKIWD   + 
Sbjct: 210 VRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRV 269

Query: 192 CVETHMAHTS--EC--WGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQS 247
           C+ T   HT+   C  WG      L+ + S +  +++W    D ++G K I   I +  +
Sbjct: 270 CIYTLSGHTNSVSCVKWG---GQGLLYSGSHDKTVRVW----DMNVGGKCIN--ILKSHA 320

Query: 248 ---KQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMAD 304
                  +S E+           +   D T   F    +E   KAL   EK  +  G A+
Sbjct: 321 HWVNHLSLSTEYA--------LRVGPFDHTATKF-TSAEEARKKALENYEKIAKRNGKAE 371

Query: 305 EKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYSIPYQ 364
                                                    E+++T S++   +   P +
Sbjct: 372 -----------------------------------------ELIVTASDDFTMFLWDPTK 390

Query: 365 KREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTF- 422
             +P            L GH+  V  +  S D + + +AS + ++K+W+ +    I TF 
Sbjct: 391 SGKP---------LARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWDGRNGTFISTFR 441

Query: 423 -------ECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDL 475
                  +  ++  C+ L      V  ++   L+++D+ +  L  +    H   ++++D 
Sbjct: 442 GHVASVYQVAWSSDCRLL------VSCSKDTTLKVWDVRTRKLSVDLP-GHKDEVYTVDW 494

Query: 476 TSDGKRLVTGSADKTVKFW 494
           + DGKR+ +G  DK V+ W
Sbjct: 495 SVDGKRVCSGGKDKMVRLW 513

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 130/308 (42%), Gaps = 29/308 (9%)

Query: 381 LQGHRTDVRS--------IDISDDNKLLATASNGTLKIWNIKTHACIRTFECGY--ALTC 430
           L+GH+  + S        +   D  +L + + +GT+KIW+     CI T   G+  +++C
Sbjct: 225 LKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRVCIYTLS-GHTNSVSC 283

Query: 431 KFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT 490
               G  L+  G+    ++++D+       N   +H   +  L L+++   L  G  D T
Sbjct: 284 VKWGGQGLLYSGSHDKTVRVWDMNVGGKCINILKSHAHWVNHLSLSTE-YALRVGPFDHT 342

Query: 491 VKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVK 550
                F   +E     ++ +        +   + N     + +++ + F  + L D T  
Sbjct: 343 AT--KFTSAEEARKKALENY--------EKIAKRNGKAEELIVTASDDF-TMFLWDPT-- 389

Query: 551 VFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQD 610
                S K    L GH+  V  +  S D + ++++S D +IK+W    G    +   H  
Sbjct: 390 ----KSGKPLARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWDGRNGTFISTFRGHVA 445

Query: 611 SIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTS 670
           S+  V +  +     SCSKD  +K WD    +    L  H+ EV+ +  S D + V S  
Sbjct: 446 SVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGG 505

Query: 671 HDHSIRVW 678
            D  +R+W
Sbjct: 506 KDKMVRLW 513

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 91/221 (41%), Gaps = 30/221 (13%)

Query: 465 AHGAAIWSLDLTSD-GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLE 523
            HGA I           R+VTG+ D T + WD      +                  TL 
Sbjct: 141 GHGATILCSQFAPHTSSRMVTGAGDNTARVWDCDTQTPM-----------------ATLS 183

Query: 524 LNDD-ILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFL-SLYGHKLPVLSIDI------ 575
            + + +L V  S D + +A   +D TV+++   + +    +L GH+  + S+        
Sbjct: 184 GHQNWVLCVAWSPDGETIATGSMDCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLV 243

Query: 576 -SFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVK 634
              D   L ++S D  IKIW      C  +L  H +S+  VK+  +    +S S D  V+
Sbjct: 244 KPGDKPRLASASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWGGQGL-LYSGSHDKTVR 302

Query: 635 YWDGD-KFECVQKLAAHQSEVWALAISNDARFVVSTSHDHS 674
            WD +   +C+  L +H   V  L++S +    V    DH+
Sbjct: 303 VWDMNVGGKCINILKSHAHWVNHLSLSTEYALRVG-PFDHT 342

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 80  YLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDS 139
           ++ + P+   +     D  IK+WD  + T +  F GH +++  + +      L+S SKD+
Sbjct: 407 HVAFSPDGRFIVSASFDNSIKLWDGRNGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDT 466

Query: 140 DIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIW 185
            + +WD+        L  HKD +  + W  +   + S  KD ++++W
Sbjct: 467 TLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 81/191 (42%), Gaps = 13/191 (6%)

Query: 501 ELIPGTVDKFVP-KLKIFHDTTLELNDDILAVKISSDNKFL--AVSLLDNTVKVFFLNSM 557
           E +P T    VP K K     T+++ D++ +  +    K     ++L+     VF +  +
Sbjct: 73  EPVPYTFSCSVPGKRKNDPQQTIDITDNLYSSLLKPGLKTTEDQITLIYTPRAVFKVKPI 132

Query: 558 -KFFLSLYGHKLPVLSIDIS-FDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSV 615
            +   ++ GH   +L    +   S  ++T + D   ++W  D      +L  HQ+ ++ V
Sbjct: 133 TRSSSAIAGHGATILCSQFAPHTSSRMVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCV 192

Query: 616 KFVPESHNFFSCSKDGLVKYWDGDKFECV-QKLAAHQ----SEVWA---LAISNDARFVV 667
            + P+     + S D  V+ WD    + +   L  HQ    S VW    L    D   + 
Sbjct: 193 AWSPDGETIATGSMDCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLA 252

Query: 668 STSHDHSIRVW 678
           S S D +I++W
Sbjct: 253 SASKDGTIKIW 263

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/346 (23%), Positives = 139/346 (40%), Gaps = 69/346 (19%)

Query: 384 HRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCK------------ 431
           H + V  +  S+D + LAT  N T +I+ +     +  F    A T K            
Sbjct: 490 HTSVVCCVKFSNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETS 549

Query: 432 -------------FLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSD 478
                        F P G  +  G     ++++D+    ++   +  H   I+SLD    
Sbjct: 550 AGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLK-GHEQDIYSLDYFPS 608

Query: 479 GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISS-DN 537
           G +LV+GS D+TV+ WD K  Q  +                 TL + D +  V +S  D 
Sbjct: 609 GDKLVSGSGDRTVRIWDLKTGQCTL-----------------TLSIEDGVTTVAVSPGDG 651

Query: 538 KFLAVSLLDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSKLLITSSADKN 590
           KF+A   LD  V+V      F +  +     L  GHK  V S+  + D   +++ S D++
Sbjct: 652 KFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRS 711

Query: 591 IKIWGL------------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDG 638
           +K+W L              G C  +   H+D ++SV    +     S SKD  V +WD 
Sbjct: 712 VKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDK 771

Query: 639 DKFECVQKLAAHQSEVWALAISN------DARFVVSTSHDHSIRVW 678
                +  L  H++ V ++A+++      +     + S D   R+W
Sbjct: 772 VSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIW 817

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 14/157 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+  K +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 563 FSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVR 622

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET---- 195
           IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD  T   VE     
Sbjct: 623 IWDLKTGQCTL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSE 680

Query: 196 ---HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
                 H    + +    D   V++ S +  +K+WNL
Sbjct: 681 NELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNL 717

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 78/182 (42%), Gaps = 26/182 (14%)

Query: 521 TLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKF---FLSLYGHK---------- 567
           TLE    +  VK S+D +FLA    + T +++ ++  +    F     H           
Sbjct: 487 TLEHTSVVCCVKFSNDGEFLATG-CNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAE 545

Query: 568 ----------LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 617
                     L + S+  S D K L T + DK I+IW ++       L  H+  I S+ +
Sbjct: 546 AETSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDY 605

Query: 618 VPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS-NDARFVVSTSHDHSIR 676
            P      S S D  V+ WD    +C   L+  +  V  +A+S  D +F+ + S D ++R
Sbjct: 606 FPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSI-EDGVTTVAVSPGDGKFIAAGSLDRAVR 664

Query: 677 VW 678
           VW
Sbjct: 665 VW 666

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 68/164 (41%), Gaps = 36/164 (21%)

Query: 45  VNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           V  WD+KTG+ +  L+  DG+   AV     K               +A G  D  +++W
Sbjct: 621 VRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKF--------------IAAGSLDRAVRVW 666

Query: 103 DLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDIIIWDL--------- 146
           D  +  ++   +       GHK ++  + F   G  ++SGS D  + +W+L         
Sbjct: 667 DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNAD 726

Query: 147 ---VGEVGLYKLRSHKDSITGIWC-ENEDWLISTSKDGLIKIWD 186
                         HKD +  +   E++++++S SKD  +  WD
Sbjct: 727 GKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWD 770

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 69/170 (40%), Gaps = 27/170 (15%)

Query: 37  ILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNLLAVGY 94
           I  G+L+  V  WD  TG L + L       + +   T   +S Y + +  + N +  G 
Sbjct: 654 IAAGSLDRAVRVWDSDTGFLVERL------DSENELGTGHKDSVYSVVFTRDGNGVVSGS 707

Query: 95  ADGVIKIWDL------------ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
            D  +K+W+L             S T  + + GHK  +  +        ++SGSKD  ++
Sbjct: 708 LDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVL 767

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWC-------ENEDWLISTSKDGLIKIW 185
            WD V    L  L+ H++S+  +          N     + S D   +IW
Sbjct: 768 FWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIW 817

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 123/286 (43%), Gaps = 58/286 (20%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKE-----DAHGAAIWSLDLTSDGK 480
           Y  +  F P G  +  G     ++++D+      EN++       H   I+SLD    G 
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDI------ENRKIVMILQGHEQDIYSLDYFPSGD 498

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKF 539
           +LV+GS D+TV+ WD +  Q  +                 TL + D +  V +S  D K+
Sbjct: 499 KLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKY 541

Query: 540 LAVSLLDNTVKVFFLNSMKFFL---------SLYGHKLPVLSIDISFDSKLLITSSADKN 590
           +A   LD  V+V+  +S   FL         S  GHK  V S+  + D + +++ S D++
Sbjct: 542 IAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRS 599

Query: 591 IKIWGL------------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDG 638
           +K+W L            + G C  +   H+D ++SV          S SKD  V +WD 
Sbjct: 600 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 659

Query: 639 DKFECVQKLAAHQSEVWALAISNDARF------VVSTSHDHSIRVW 678
                +  L  H++ V ++A++N +          + S D   R+W
Sbjct: 660 TSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 80/157 (50%), Gaps = 14/157 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+ ++ +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 451 FSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 510

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCV------ 193
           IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   V      
Sbjct: 511 IWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSE 568

Query: 194 -ETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
            E+   H    + +    D   V++ S +  +K+WNL
Sbjct: 569 NESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNL 605

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 110/236 (46%), Gaps = 19/236 (8%)

Query: 374 NKLYTIELQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKF 432
           N+   + LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T      +T   
Sbjct: 474 NRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVA 533

Query: 433 L-PG-GALVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVT 484
           + PG G  +  G+    ++++D  +  L+E  +        H  +++S+  T DG+ +V+
Sbjct: 534 VSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVS 593

Query: 485 GSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSL 544
           GS D++VK W+ +          D   P       T +   D +L+V  + +++++    
Sbjct: 594 GSLDRSVKLWNLQNANN----KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGS 649

Query: 545 LDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
            D  V  +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 650 KDRGVLFWDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 49/111 (44%)

Query: 568 LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
           L + S+  S D K L T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           S D  V+ WD    +C   L+             D +++ + S D ++RVW
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 554

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 97/226 (42%), Gaps = 49/226 (21%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD++TG+ S  L+  DG+   AV     K               
Sbjct: 496 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKY-------------- 541

Query: 90  LAVGYADGVIKIWDLISKTVLI---------NFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +A G  D  +++WD  S+T  +         +  GHK ++  + F   G  ++SGS D  
Sbjct: 542 IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRS 599

Query: 141 IIIWDL----------VGEVGLYKLR--SHKDSITGIWC-ENEDWLISTSKDGLIKIWDL 187
           + +W+L              G  ++    HKD +  +   +N+++++S SKD  +  WD 
Sbjct: 600 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 659

Query: 188 KTQQCVETHMAHTSECWGLAIHN--------DLVITTSTESQIKIW 225
            +   +     H +    +A+ N        ++  T S + + +IW
Sbjct: 660 TSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 72/166 (43%), Gaps = 15/166 (9%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L Y P  + L  G  D  ++IWDL +    +  +      TV      G  + +GS D  
Sbjct: 491 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 550

Query: 141 IIIWDLVGEVGLYKLR---------SHKDSI-TGIWCENEDWLISTSKDGLIKIWDLK-T 189
           + +WD   E G    R          HKDS+ + ++  +   ++S S D  +K+W+L+  
Sbjct: 551 VRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNA 608

Query: 190 QQCVETHMAHTSECWGLAI-HNDLVITTSTESQIKIWNLDLDKDMG 234
               ++   ++  C    I H D V++ +T +Q   + L   KD G
Sbjct: 609 NNKSDSKTPNSGTCEVTYIGHKDFVLSVAT-TQNDEYILSGSKDRG 653

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 71/178 (39%), Gaps = 27/178 (15%)

Query: 32  GSAGQILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNL 89
           G    I  G+L+  V  WD +TG L + L       + +   T   +S Y + +  +   
Sbjct: 537 GDGKYIAAGSLDRAVRVWDSETGFLVERL------DSENESGTGHKDSVYSVVFTRDGQS 590

Query: 90  LAVGYADGVIKIWDLI------------SKTVLINFNGHKSAITVLRFDPTGTRLISGSK 137
           +  G  D  +K+W+L             S T  + + GHK  +  +        ++SGSK
Sbjct: 591 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 650

Query: 138 DSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWL-------ISTSKDGLIKIWDLK 188
           D  ++ WD      L  L+ H++S+  +   N   L        + S D   +IW  +
Sbjct: 651 DRGVLFWDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYR 708

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 138/320 (43%), Gaps = 31/320 (9%)

Query: 370 RPAPNKLYTIELQGHR----TDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFEC 424
           R    +L T EL G +      V  + +  D + LAT    G++K+ + +T    ++ + 
Sbjct: 153 RAEGKRLATFELVGSQLVADKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDA 212

Query: 425 GYALTCKFL---PGGALVVVGNRGGD--LQLFDLASSTLLENKEDAHGAAIWSLDLTSDG 479
            +      L   P G  ++ G  GGD  ++L+D+ S++  E +   H   +  + +   G
Sbjct: 213 AHEGKIGGLDWHPDGNHLLSG--GGDNLVKLWDMTSNSFEELR--GHAGRVSRVKVHPSG 268

Query: 480 KRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKF 539
           +   + S D T   WD +   EL          +L+  H         +  +   SD   
Sbjct: 269 RLAASASFDLTWILWDLERKVEL----------QLQEGHSKA------VYTIAFQSDGAL 312

Query: 540 LAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG 599
           LA + LD    ++ L S +  + L GH   +  +D S +   L T+ AD  +++W +   
Sbjct: 313 LASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNV 372

Query: 600 DCHKSLFAHQDSIMSVKFVPESHNFF-SCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658
               +L AHQ + + VKF   +  F  SC  D LV  ++ D ++ +  L  H   V+ + 
Sbjct: 373 GTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVD 432

Query: 659 ISNDARFVVSTSHDHSIRVW 678
           I+ D   + S   D S++ W
Sbjct: 433 ITEDGSTIYSGGKDRSLKQW 452

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 74/150 (49%), Gaps = 4/150 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L +HP+ N L  G  D ++K+WD+ S +      GH   ++ ++  P+G    S S D  
Sbjct: 221 LDWHPDGNHLLSGGGDNLVKLWDMTSNS-FEELRGHAGRVSRVKVHPSGRLAASASFDLT 279

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSK-DGLIKIWDLKTQQCVETHMAH 199
            I+WDL  +V L     H  ++  I  +++  L++++  D +  IWDL++ + +     H
Sbjct: 280 WILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGH 339

Query: 200 TSECWGL--AIHNDLVITTSTESQIKIWNL 227
                G+  + +   + T   +  +++W++
Sbjct: 340 AGAISGVDWSPNGYQLATAGADGTVRVWDI 369

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 1/122 (0%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKD 138
           + ++ HP   L A    D    +WDL  K  L    GH  A+  + F   G  L S   D
Sbjct: 260 SRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLD 319

Query: 139 SDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHM 197
           +   IWDL     + KL  H  +I+G+ W  N   L +   DG +++WD++        +
Sbjct: 320 AVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALL 379

Query: 198 AH 199
           AH
Sbjct: 380 AH 381

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 66/149 (44%), Gaps = 4/149 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +  +  LLA    D V  IWDL S   ++   GH  AI+ + + P G +L +   D  
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGT 363

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCE--NEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           + +WD+        L +H+ +   +  +  N  +L+S   D L+ I++    Q + +   
Sbjct: 364 VRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEG 423

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIW 225
           HT   + + I  D   + +   +  +K W
Sbjct: 424 HTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 69/153 (45%), Gaps = 5/153 (3%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNG-HKSAITVLRFDPTGTRLISGSK 137
           + +  H +   LA G   G IK+    +  +  + +  H+  I  L + P G  L+SG  
Sbjct: 176 SQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGG 235

Query: 138 DSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKI-WDLKTQQCVETH 196
           D+ + +WD+       +LR H   ++ +       L +++   L  I WDL+ +  ++  
Sbjct: 236 DNLVKLWDMTSN-SFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQ 294

Query: 197 MAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
             H+   + +A  +D  L+ +   ++   IW+L
Sbjct: 295 EGHSKAVYTIAFQSDGALLASAGLDAVCAIWDL 327

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 117/274 (42%), Gaps = 29/274 (10%)

Query: 434 PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKF 493
           P   +   G+  GDL+LF+  +       ++ H   I  LD    G  LVTG+ D  VK 
Sbjct: 186 PNDEVFATGDWNGDLKLFNSKTLEPTVKIDNVHSGKIGGLDWNKTGGMLVTGAEDGMVKL 245

Query: 494 WDFKVDQ----ELIPG-----TVDKFVPKLKIF----HDTTLELND-------------- 526
           + +  ++     ++ G        KF P  +       DTT  L D              
Sbjct: 246 YSYTSNEIKETTVLKGHEKRVVATKFHPSTRFLGSTSFDTTWRLWDIATSQELLLQEGHS 305

Query: 527 -DILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585
            ++ ++    D   +    LDNT  ++ +   K  ++L GH  PV  +D S +   + T 
Sbjct: 306 KEVYSLSFQGDGSLVCTGGLDNTALLWDIRCGKSIMTLNGHSKPVYCVDWSCNGYNVATG 365

Query: 586 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE-SHNFFSCSKDGLVKYWDGDKFECV 644
             D  I IW +   +   ++ AH + I  ++F  + S    SCS D  +  +  D +  V
Sbjct: 366 GGDGLINIWDIRKTNLVNTILAHNNIISDLRFAKQDSKCLVSCSYDKKINIYSSDNWLKV 425

Query: 645 QKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           + L  H   + ++ ++N+A+ ++S   D S+++W
Sbjct: 426 KTLEGHSHNILSVDMTNNAKALISGGWDRSVKLW 459

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 1/121 (0%)

Query: 82  QYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDI 141
           ++HP T  L     D   ++WD+ +   L+   GH   +  L F   G+ + +G  D+  
Sbjct: 270 KFHPSTRFLGSTSFDTTWRLWDIATSQELLLQEGHSKEVYSLSFQGDGSLVCTGGLDNTA 329

Query: 142 IIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHT 200
           ++WD+     +  L  H   +  + W  N   + +   DGLI IWD++    V T +AH 
Sbjct: 330 LLWDIRCGKSIMTLNGHSKPVYCVDWSCNGYNVATGGGDGLINIWDIRKTNLVNTILAHN 389

Query: 201 S 201
           +
Sbjct: 390 N 390

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 91/220 (41%), Gaps = 19/220 (8%)

Query: 378 TIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKT--HACIRTFECGYALTCKFLP 434
           T  L+GH   V +       + L + S + T ++W+I T     ++        +  F  
Sbjct: 256 TTVLKGHEKRVVATKFHPSTRFLGSTSFDTTWRLWDIATSQELLLQEGHSKEVYSLSFQG 315

Query: 435 GGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFW 494
            G+LV  G       L+D+     +    + H   ++ +D + +G  + TG  D  +  W
Sbjct: 316 DGSLVCTGGLDNTALLWDIRCGKSIMTL-NGHSKPVYCVDWSCNGYNVATGGGDGLINIW 374

Query: 495 DFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL 554
           D +         V+  +    I  D      D    V  S D K + +   DN +KV   
Sbjct: 375 DIRK-----TNLVNTILAHNNIISDLRFAKQDSKCLVSCSYDKK-INIYSSDNWLKV--- 425

Query: 555 NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594
                  +L GH   +LS+D++ ++K LI+   D+++K+W
Sbjct: 426 ------KTLEGHSHNILSVDMTNNAKALISGGWDRSVKLW 459

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 66/150 (44%), Gaps = 4/150 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L +  + +L+  G  D    +WD+     ++  NGH   +  + +   G  + +G  D  
Sbjct: 311 LSFQGDGSLVCTGGLDNTALLWDIRCGKSIMTLNGHSKPVYCVDWSCNGYNVATGGGDGL 370

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVETHMA 198
           I IWD+     +  + +H + I+ +    +D   L+S S D  I I+       V+T   
Sbjct: 371 INIWDIRKTNLVNTILAHNNIISDLRFAKQDSKCLVSCSYDKKINIYSSDNWLKVKTLEG 430

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWN 226
           H+     + + N+   +I+   +  +K+W+
Sbjct: 431 HSHNILSVDMTNNAKALISGGWDRSVKLWH 460

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 63/152 (41%), Gaps = 5/152 (3%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTV--LINFNGHKSAITVLRFDPTGTRLISGSKD 138
           L ++    +L  G  DG++K++   S  +       GH+  +   +F P+   L S S D
Sbjct: 225 LDWNKTGGMLVTGAEDGMVKLYSYTSNEIKETTVLKGHEKRVVATKFHPSTRFLGSTSFD 284

Query: 139 SDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSK-DGLIKIWDLKTQQCVETHM 197
           +   +WD+     L     H   +  +  + +  L+ T   D    +WD++  + + T  
Sbjct: 285 TTWRLWDIATSQELLLQEGHSKEVYSLSFQGDGSLVCTGGLDNTALLWDIRCGKSIMTLN 344

Query: 198 AHTSE--CWGLAIHNDLVITTSTESQIKIWNL 227
            H+    C   + +   V T   +  I IW++
Sbjct: 345 GHSKPVYCVDWSCNGYNVATGGGDGLINIWDI 376

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 121/274 (44%), Gaps = 39/274 (14%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTG 485
           Y  +  F P G  +  G     ++++DL +  ++   +  H   I+SLD    G +LV+G
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLK-GHEQDIYSLDYFPSGNKLVSG 466

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKFLAVSL 544
           S D+TV+ WD      L  GT              TL + D +  V +S  + KF+A   
Sbjct: 467 SGDRTVRIWD------LTTGTC-----------SLTLSIEDGVTTVAVSPGEGKFIAAGS 509

Query: 545 LDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD 597
           LD TV+V      F +  +     L  GH+  V S+  + D K +++ S D+++K+W L+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

Query: 598 -------FGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH 650
                    +C  +   H+D ++SV          S SKD  V +WD      +  L  H
Sbjct: 570 GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 629

Query: 651 QSEVWALAISN------DARFVVSTSHDHSIRVW 678
           ++ V ++ ++N      +     + S D   R+W
Sbjct: 630 RNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 78/158 (49%), Gaps = 14/158 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWDL +K +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 414 FSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVR 473

Query: 143 IWDLVGEVGLYKLR-SHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET---- 195
           IWDL    G   L  S +D +T +     +  ++ + S D  +++WD  T   VE     
Sbjct: 474 IWDLT--TGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSE 531

Query: 196 ---HMAHTSECWGLAIHND--LVITTSTESQIKIWNLD 228
                 H    + +    D   V++ S +  +K+WNL+
Sbjct: 532 NELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 109/235 (46%), Gaps = 24/235 (10%)

Query: 375 KLYTIELQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL 433
           K   + L+GH  D+ S+D     NKL++ + + T++IW++ T  C  T      +T   +
Sbjct: 438 KKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAV 497

Query: 434 -PG-GALVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTG 485
            PG G  +  G+    ++++D  +  L+E  +        H  +++S+  T DGK +V+G
Sbjct: 498 SPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSG 557

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLL 545
           S D++VK W+       + G   K   + ++   T     D +L+V  + +++++     
Sbjct: 558 SLDRSVKLWNLNG----LSG--QKSHAECEV---TYTGHKDFVLSVATTQNDEYILSGSK 608

Query: 546 DNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
           D  V  +   S    L L GH+  V+S+ ++    L        T S D   +IW
Sbjct: 609 DRGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 568 LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
           L + S+  S D K L T + DK I+IW L+      +L  H+  I S+ + P  +   S 
Sbjct: 407 LYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSG 466

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS-NDARFVVSTSHDHSIRVW 678
           S D  V+ WD     C   L+  +  V  +A+S  + +F+ + S D ++RVW
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSI-EDGVTTVAVSPGEGKFIAAGSLDRTVRVW 517

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 92/219 (42%), Gaps = 40/219 (18%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD+ TG  S  L+  DG+   AV                 E   
Sbjct: 459 SGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPG--------------EGKF 504

Query: 90  LAVGYADGVIKIWDLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDII 142
           +A G  D  +++WD  +  ++   +       GH+ ++  + F   G  ++SGS D  + 
Sbjct: 505 IAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVK 564

Query: 143 IWDLVGEVGL-------YKLRSHKDSITGIWC-ENEDWLISTSKDGLIKIWDLKTQQCVE 194
           +W+L G  G             HKD +  +   +N+++++S SKD  +  WD K+   + 
Sbjct: 565 LWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLL 624

Query: 195 THMAHTSECWGLAIHN--------DLVITTSTESQIKIW 225
               H +    + + N         +  T S + + +IW
Sbjct: 625 MLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (44%), Gaps = 14/163 (8%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L Y P  N L  G  D  ++IWDL + T  +  +      TV      G  + +GS D  
Sbjct: 454 LDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRT 513

Query: 141 IIIWDLVGEVGLYKLRS-------HKDSI-TGIWCENEDWLISTSKDGLIKIWDLKTQQC 192
           + +WD      + +L S       H+DS+ + ++  +   ++S S D  +K+W+L     
Sbjct: 514 VRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSG 573

Query: 193 VETHMAHTSEC-WGLAIHNDLVITTSTESQIKIWNLDLDKDMG 234
            ++H    +EC      H D V++ +T +Q   + L   KD G
Sbjct: 574 QKSH----AECEVTYTGHKDFVLSVAT-TQNDEYILSGSKDRG 611

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 118/279 (42%), Gaps = 44/279 (15%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTG 485
           Y  +  F P G  +  G     ++++D+A   ++   +  H   I+SLD    G +LV+G
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 435

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + D +  V +S  D KF+A   
Sbjct: 436 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 478

Query: 545 LDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSKLLITSSADKNIKIWGL- 596
           LD  V+V      F +  +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 479 LDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 538

Query: 597 -----------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQ 645
                        G C  +   H+D ++SV          S SKD  V +WD      + 
Sbjct: 539 GDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLL 598

Query: 646 KLAAHQSEVWALAISNDARF------VVSTSHDHSIRVW 678
            L  H++ V ++A++N            + S D   R+W
Sbjct: 599 MLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIW 637

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 82/165 (49%), Gaps = 14/165 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+  K +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 383 FSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 442

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET---- 195
           IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   VE     
Sbjct: 443 IWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSE 500

Query: 196 ---HMAHTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGS 235
                 H    + +    D   V++ S +  +K+WNL  DK+  S
Sbjct: 501 NELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSS 545

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 113/247 (45%), Gaps = 38/247 (15%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL-PG-GA 437
           LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T      +T   + PG G 
Sbjct: 413 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 472

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADKTV 491
            +  G+    ++++D  +  L+E  +        H  +++S+  T DG  +V+GS D++V
Sbjct: 473 FIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSV 532

Query: 492 KFWDFKVDQ------ELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLL 545
           K W+ + D+      +  PGT +      K F          +L+V  + +++++     
Sbjct: 533 KLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDF----------VLSVATTQNDQYILSGSK 582

Query: 546 DNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW----- 594
           D  V  +   S    L L GH+  V+S+ ++    L        T S D   +IW     
Sbjct: 583 DRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYTKT 642

Query: 595 --GLDFG 599
             G+D G
Sbjct: 643 DAGIDSG 649

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 104/241 (43%), Gaps = 48/241 (19%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD++TG+ S  L+  DG+   AV     K               
Sbjct: 428 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKF-------------- 473

Query: 90  LAVGYADGVIKIWDLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDII 142
           +A G  D  +++WD  +  ++   +       GHK ++  + F   G  ++SGS D  + 
Sbjct: 474 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVK 533

Query: 143 IWDLVGE----------VGLYKLR--SHKDSITGIWC-ENEDWLISTSKDGLIKIWDLKT 189
           +W+L G+           G  ++    HKD +  +   +N+ +++S SKD  +  WD ++
Sbjct: 534 LWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQS 593

Query: 190 QQCVETHMAHTSECWGLAIHNDLVI--------TTSTESQIKIWNL---DLDKDMGSKLI 238
              +     H +    +A+ N   +        T S + + +IW     D   D GSK+ 
Sbjct: 594 GNPLLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYTKTDAGIDSGSKIK 653

Query: 239 E 239
           E
Sbjct: 654 E 654

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 71/166 (42%), Gaps = 15/166 (9%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L Y P  + L  G  D  ++IWDL +    +  +      TV      G  + +GS D  
Sbjct: 423 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRA 482

Query: 141 IIIWDLVGEVGLYKLR---------SHKDSI-TGIWCENEDWLISTSKDGLIKIWDLKTQ 190
           + +WD   E G    R          HKDS+ + ++  + + ++S S D  +K+W+L+  
Sbjct: 483 VRVWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGD 540

Query: 191 QCVETHMAHTSECWGLAI--HNDLVITTSTESQIKIWNLDLDKDMG 234
           +   +    T     +    H D V++ +T +Q   + L   KD G
Sbjct: 541 KNNSSSGKPTPGTCEVTYTGHKDFVLSVAT-TQNDQYILSGSKDRG 585

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 118/274 (43%), Gaps = 30/274 (10%)

Query: 434 PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKF 493
           P G     G+  GD+ +F+  +   +    + H   I  +D +SD + LV+G  D  VK 
Sbjct: 191 PEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKL 250

Query: 494 WDFKVDQELIPG---------TVDKFVPKLKIF----HDTTLELND-------------- 526
           ++F  +   +           T  KF P  K       DTT  L D              
Sbjct: 251 YNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHS 310

Query: 527 -DILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585
            +I ++   +D   +A +  D    ++ L S K  LSL GH  P+   D S  +      
Sbjct: 311 KEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWS-QNGYQXXX 369

Query: 586 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFF-SCSKDGLVKYWDGDKFECV 644
           S D  IKIW L   D  +++ AH++ +  +KF  E+  F  S S D  +  +  D +  +
Sbjct: 370 SGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKI 429

Query: 645 QKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             L  H  ++ ++ IS+D + +VS   D S+++W
Sbjct: 430 HTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLW 463

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 72/157 (45%), Gaps = 5/157 (3%)

Query: 76  AESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISG 135
           A  T +++HP    +     D   ++WD+++ + L+   GH   I  L F   G+ + + 
Sbjct: 269 ARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATA 328

Query: 136 SKDSDIIIWDLVGEVGLYKLRSHKDSI-TGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
             D   IIWDL     +  L  H   I    W +N  +    S DG IKIWDL+    VE
Sbjct: 329 GADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQN-GYQXXXSGDGTIKIWDLRKVDDVE 387

Query: 195 THMAHTSECWGLAIHND---LVITTSTESQIKIWNLD 228
           T +AH +    L    +    +I++S +  I +++ D
Sbjct: 388 TILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSD 424

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 110/247 (44%), Gaps = 32/247 (12%)

Query: 382 QGHRTDVRSIDISDDNK-LLATASNGTLKIWNIKTHAC-IRTFECGY---ALTCKFLPGG 436
           + H   +  ID S D++ L++   +G +K++N  +++  + T   G+       KF P  
Sbjct: 221 ETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQ 280

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
             +   +     +L+D+ +++ L  +E  H   I+SL   +DG  + T  ADK    WD 
Sbjct: 281 KYIGSASFDTTWRLWDIVTNSELLLQE-GHSKEIYSLSFQTDGSLIATAGADKVGIIWDL 339

Query: 497 KVDQELIP-------------------------GTVDKFVPKLKIFHDTTLELNDDILAV 531
           +  + ++                          GT+  +  +     +T L   + +  +
Sbjct: 340 RSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDL 399

Query: 532 KISSDN-KFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKN 590
           K   +N KFL  S  D  + VF  +S     +L GH   +LSIDIS D + +++   D++
Sbjct: 400 KFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILSIDISSDYQTIVSGGWDRS 459

Query: 591 IKIWGLD 597
           +K+W ++
Sbjct: 460 VKLWSME 466

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 103/217 (47%), Gaps = 16/217 (7%)

Query: 52  TGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLI 111
            G++S   T  L P  + ++ T   + + + +  ++  L  G  DG++K+++  S ++ +
Sbjct: 202 AGDISIFNTKTLAP-VITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQV 260

Query: 112 --NFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCEN 169
             +F GH + +T ++F P+   + S S D+   +WD+V    L     H   I  +  + 
Sbjct: 261 ATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQT 320

Query: 170 EDWLISTS-KDGLIKIWDLKTQQCVETHMAHTSE--C--WGLAIHNDLVITTSTESQIKI 224
           +  LI+T+  D +  IWDL++ + + + + H     C  W     N      S +  IKI
Sbjct: 321 DGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWS---QNGYQXXXSGDGTIKI 377

Query: 225 WNLDLDKDMGSKLIEKGI-----YEKQSKQRGVSVEF 256
           W+L    D+ + L  K +     +EK++ +  +S  +
Sbjct: 378 WDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSY 414

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 73/152 (48%), Gaps = 5/152 (3%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L +  + +L+A   AD V  IWDL S   +++  GH   I    +   G +    S D  
Sbjct: 316 LSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXX-SGDGT 374

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVETHMA 198
           I IWDL     +  + +HK+ +T +  E E+  +LIS+S D  I ++   +   + T   
Sbjct: 375 IKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQG 434

Query: 199 HTSECWGLAIHNDL--VITTSTESQIKIWNLD 228
           H  +   + I +D   +++   +  +K+W+++
Sbjct: 435 HNDKILSIDISSDYQTIVSGGWDRSVKLWSME 466

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 95  ADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTR-LISGSKDSDIIIWDLVGEVGLY 153
            DG IKIWDL     +     HK+ +T L+F+   ++ LIS S D DI ++     V ++
Sbjct: 371 GDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIH 430

Query: 154 KLRSHKDSITGIWCENE-DWLISTSKDGLIKIWDLKT 189
            L+ H D I  I   ++   ++S   D  +K+W ++ 
Sbjct: 431 TLQGHNDKILSIDISSDYQTIVSGGWDRSVKLWSMEA 467

 Score = 39.7 bits (91), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 79/199 (39%), Gaps = 21/199 (10%)

Query: 317 SVIMHPFQTI--RSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYSIPYQKREP--TRPA 372
           +V  HP Q     + F      W + T S+L   L    ++ E YS+ +Q          
Sbjct: 273 NVKFHPSQKYIGSASFDTTWRLWDIVTNSEL---LLQEGHSKEIYSLSFQTDGSLIATAG 329

Query: 373 PNKLYTI----------ELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIRTF 422
            +K+  I           L GH   +   D S +      + +GT+KIW+++    + T 
Sbjct: 330 ADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETI 389

Query: 423 EC--GYALTCKF-LPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDG 479
                     KF       ++  +   D+ +F   S   +   +  H   I S+D++SD 
Sbjct: 390 LAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQ-GHNDKILSIDISSDY 448

Query: 480 KRLVTGSADKTVKFWDFKV 498
           + +V+G  D++VK W  + 
Sbjct: 449 QTIVSGGWDRSVKLWSMEA 467

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 132/313 (42%), Gaps = 25/313 (7%)

Query: 375 KLYTIELQGHRT----DVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRT---FECGY 426
           K   IEL G +      V  + +S +  L+A AS  G L I N +T   ++       G 
Sbjct: 166 KTKNIELMGSQVVSTRPVSQVSLSPNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMGK 225

Query: 427 ALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKE-DAHGAAIWSLDLTSDGKRLVTG 485
                + P G L+  G   G ++LF   S+TL E    + H   +        G+ + + 
Sbjct: 226 IGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIASA 285

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLL 545
           S D T + WD +  +EL+          L+  H        ++ ++    D   +    +
Sbjct: 286 SFDMTWRLWDVETQEELL----------LQEGH------GKELYSLGFQCDGSLVCSGGI 329

Query: 546 DNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSL 605
           D    V+ + S K  +SL GH  P+ S+D S +   + T S D  I+IW L   + ++++
Sbjct: 330 DCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTI 389

Query: 606 FAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARF 665
            AH+  +  V F    +   S   D  +  +    +  +  L  H  ++  + IS +A  
Sbjct: 390 LAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENASS 449

Query: 666 VVSTSHDHSIRVW 678
           VVS   D S+++W
Sbjct: 450 VVSCGWDRSVKLW 462

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 57/121 (47%), Gaps = 1/121 (0%)

Query: 82  QYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDI 141
           ++HP    +A    D   ++WD+ ++  L+   GH   +  L F   G+ + SG  D   
Sbjct: 274 KFHPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKG 333

Query: 142 IIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHT 200
           ++WD+        L  H   I  + W  N   + + S DG I+IWDL+  +  +T +AH 
Sbjct: 334 LVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHK 393

Query: 201 S 201
           S
Sbjct: 394 S 394

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 60/142 (42%), Gaps = 13/142 (9%)

Query: 48  WDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISK 107
           WDI++G+ +  L+    P               L + P    +A G  DG I+IWDL   
Sbjct: 336 WDIRSGKRAMSLSGHTKP------------IYSLDWSPNGYQVATGSGDGTIRIWDLRKP 383

Query: 108 TVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-W 166
                   HKS +T + F+  G  L+S   D  I ++       L  L+ H D I  +  
Sbjct: 384 EEYQTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDI 443

Query: 167 CENEDWLISTSKDGLIKIWDLK 188
            EN   ++S   D  +K+W ++
Sbjct: 444 SENASSVVSCGWDRSVKLWTMQ 465

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 3/150 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L +  + +L+  G  D    +WD+ S    ++ +GH   I  L + P G ++ +GS D  
Sbjct: 315 LGFQCDGSLVCSGGIDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGT 374

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCE-NEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
           I IWDL        + +HK  +T +  E N + L+S+  D  I ++       + T   H
Sbjct: 375 IRIWDLRKPEEYQTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGH 434

Query: 200 TSE--CWGLAIHNDLVITTSTESQIKIWNL 227
             +  C  ++ +   V++   +  +K+W +
Sbjct: 435 MDKILCVDISENASSVVSCGWDRSVKLWTM 464

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 78/171 (45%), Gaps = 7/171 (4%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTV--LINFNGHKSAITVLRFDPTGTRLISGSKD 138
           + + P  +L+  G  +G +K++   S T+  +   NGH++ +T  +F P+G  + S S D
Sbjct: 229 IHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIASASFD 288

Query: 139 SDIIIWDLVGEVGLYKLRSHKDSI--TGIWCENEDWLISTSKDGLIKIWDLKTQQCVETH 196
               +WD+  +  L     H   +   G  C+    + S   D    +WD+++ +   + 
Sbjct: 289 MTWRLWDVETQEELLLQEGHGKELYSLGFQCDG-SLVCSGGIDCKGLVWDIRSGKRAMSL 347

Query: 197 MAHTSECWGL--AIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEK 245
             HT   + L  + +   V T S +  I+IW+L   ++  + L  K I  K
Sbjct: 348 SGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIVTK 398

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 131/314 (41%), Gaps = 46/314 (14%)

Query: 393 ISDDNKLLATASNGTLKIWNIKTHACIRTFECG--YALTCKFLPGGALVVVGNRGGDLQL 450
           +S+D     + ++ +    N K    + T      Y  +  F P G  +  G     +++
Sbjct: 437 LSEDASSAPSGADASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRI 496

Query: 451 FDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKF 510
           +DLA+  ++   +  H   I+SLD    G +LV+GS D+TV+ WD +  Q  +       
Sbjct: 497 WDLATRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL------- 548

Query: 511 VPKLKIFHDTTLELNDDILAVKIS-SDNKFLAVSLLDNTVKV------FFLNSMKFFLSL 563
                     TL + D +  V +S  D K +A   LD TV++      F +  +     L
Sbjct: 549 ----------TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENEL 598

Query: 564 -YGHKLPVLSIDISFDSKLLITSSADKNIKIWGL------------DFGDCHKSLFAHQD 610
             GHK  V S+  + D   +++ S D+++K+W L            +      +   H+D
Sbjct: 599 GTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKD 658

Query: 611 SIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARF----- 665
            ++SV          S SKD  V +WD      +  L  H++ V ++A++ND        
Sbjct: 659 FVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYG 718

Query: 666 -VVSTSHDHSIRVW 678
              + S D   R+W
Sbjct: 719 VFATGSGDCKARIW 732

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 101/220 (45%), Gaps = 31/220 (14%)

Query: 37  ILTGALENVNCWDIKTGELSKILTD---GLPPGA-----------VDAKSTKLAESTYLQ 82
           + TG  +    + + TGEL   L++     P GA             A +T  +   Y++
Sbjct: 415 LATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASPAVATSASSDLYIR 474

Query: 83  ---YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDS 139
              + P+   LA G  D +I+IWDL ++ +++   GH+  I  L + P+G +L+SGS D 
Sbjct: 475 SVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDR 534

Query: 140 DIIIWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET- 195
            + IWDL  G+  L    S +D +T +     D   + + S D  ++IWD +T   VE  
Sbjct: 535 TVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERL 592

Query: 196 ------HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
                    H    + +    D   V++ S +  +K+WNL
Sbjct: 593 DSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 632

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 107/231 (46%), Gaps = 19/231 (8%)

Query: 379 IELQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL-PG- 435
           + LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T      +T   + PG 
Sbjct: 506 MTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 565

Query: 436 GALVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADK 489
           G L+  G+    ++++D  +  L+E  +        H  +++S+  T DG  +V+GS D+
Sbjct: 566 GKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDR 625

Query: 490 TVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTV 549
           +VK W+ +       G   +          T     D +L+V  + +++F+     D  V
Sbjct: 626 SVKLWNLRSAN----GGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGV 681

Query: 550 KVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
             +   S    L L GH+  V+S+ ++ D  L        T S D   +IW
Sbjct: 682 LFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 87/211 (41%), Gaps = 44/211 (20%)

Query: 45  VNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           V  WD++TG+ S  L+  DG+   AV     KL              +A G  D  ++IW
Sbjct: 536 VRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKL--------------IAAGSLDRTVRIW 581

Query: 103 DLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGL--- 152
           D  +  ++   +       GHK ++  + F   G  ++SGS D  + +W+L    G    
Sbjct: 582 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAE 641

Query: 153 ---------YKLRSHKDSITGIWC-ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSE 202
                         HKD +  +   +N+++++S SKD  +  WD  +   +     H + 
Sbjct: 642 GKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNS 701

Query: 203 CWGLAIHND--------LVITTSTESQIKIW 225
              +A+ ND        +  T S + + +IW
Sbjct: 702 VISVAVANDHPLGPEYGVFATGSGDCKARIW 732

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 86/178 (48%), Gaps = 17/178 (9%)

Query: 514 LKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKF-------------F 560
           +  FH+T    N D+ +++ S D++ +A    D+ +K++ L+                  
Sbjct: 465 MYTFHNT----NRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNT 520

Query: 561 LSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE 620
            +L GH  PV S+  S D++ L+++S DK +++W LD   C  S   H   +  VKF P 
Sbjct: 521 TTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPL 580

Query: 621 SHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            H F + S D   + W  D    ++  A H ++V  +A   +  +V++ S D + R+W
Sbjct: 581 GHYFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMW 638

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 125/294 (42%), Gaps = 36/294 (12%)

Query: 404 SNGTLKIWNIKTHA---CIRTFECGY--ALTCKFLPGGALVVVGNRGGDLQLFDLASSTL 458
           S   +K+ N++T A   C+ TF        + +F     LV  G +   ++++ L   T 
Sbjct: 447 SRDAIKLDNLQTSAPSVCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSL-DGTP 505

Query: 459 LENKEDA-------------HGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPG 505
           LE+K  +             H   ++S+  + D + LV+ S DKTV+ W       L+  
Sbjct: 506 LESKLPSKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLV-- 563

Query: 506 TVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYG 565
                         +    N  +  VK S    + A    D T +++  + +       G
Sbjct: 564 --------------SYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAG 609

Query: 566 HKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFF 625
           H   V  +    +   ++T S+DK  ++W +  GD  +    H  S++SV   P+     
Sbjct: 610 HLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLT 669

Query: 626 SCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
           + S+DG++  WD    + ++++  H +S V +L+ + +   +VS   D S+RVW
Sbjct: 670 TGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVW 723

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/278 (20%), Positives = 115/278 (41%), Gaps = 26/278 (9%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + + P+   L     D  +++W L + T L+++ GH   +  ++F P G    + S D  
Sbjct: 533 VSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQT 592

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETH 196
             +W       +Y LR     +  + C     N  ++++ S D   ++WD++T   V   
Sbjct: 593 ARLWSC---DHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 649

Query: 197 MAHTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVS- 253
           + HT+    +A+  D   + T S +  I +W++   K +           KQ +  G S 
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI-----------KQMRGHGKSA 698

Query: 254 VEFITTSDGVNFFYIQNADKTVEIFRVR--TQEEISKALRKREKRLRDKGMADEKIQQNI 311
           V  ++ +   N      AD++V ++ ++  T E    AL   +      G  +  + Q++
Sbjct: 699 VNSLSFNKEGNILVSGGADQSVRVWDLKKFTNE---PALEPEQPYSGYSGDMETSVNQDV 755

Query: 312 KDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVL 349
           K+      + P Q + + F  K         ++  +VL
Sbjct: 756 KEYGRRRTVFPTQDLVASFHTKKTPIYTVKFTRTNLVL 793

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 103/224 (45%), Gaps = 23/224 (10%)

Query: 378 TIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTC---KFL 433
           T  L GH   V S+  S DN+ L +AS + T+++W++ T  C+ +++ G+       KF 
Sbjct: 520 TTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYK-GHNHPVWDVKFS 578

Query: 434 PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKF 493
           P G      +     +L+       L      H   +  +    +G  ++TGS+DKT + 
Sbjct: 579 PLGHYFATVSHDQTARLWSCDHIYPLRIFA-GHLNDVDCVAFHPNGTYVLTGSSDKTCRM 637

Query: 494 WDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFF 553
           WD +    +          +L + H  +      +++V +S D ++L     D  + V+ 
Sbjct: 638 WDIQTGDSV----------RLFLGHTAS------VVSVAVSPDGRWLTTGSEDGVIIVWD 681

Query: 554 LNSMKFFLSLYGH-KLPVLSIDISFDSKLLITSSADKNIKIWGL 596
           + + K    + GH K  V S+  + +  +L++  AD+++++W L
Sbjct: 682 IGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 383 GHRTDVRSIDISDDNK-LLATASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGALV 439
           GH  DV  +    +   +L  +S+ T ++W+I+T   +R F       ++    P G  +
Sbjct: 609 GHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWL 668

Query: 440 VVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
             G+  G + ++D+ +   ++       +A+ SL    +G  LV+G AD++V+ WD K
Sbjct: 669 TTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLK 726

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 55/135 (40%), Gaps = 16/135 (11%)

Query: 110 LINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRS------------ 157
           +  F+     +T L+F      + +G +DS I IW L G     KL S            
Sbjct: 465 MYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLI 524

Query: 158 -HKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH--NDLV 213
            H   +  + +  +  +L+S S+D  +++W L T  C+ ++  H    W +         
Sbjct: 525 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYF 584

Query: 214 ITTSTESQIKIWNLD 228
            T S +   ++W+ D
Sbjct: 585 ATVSHDQTARLWSCD 599

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 121/281 (43%), Gaps = 48/281 (17%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTG 485
           Y  +  F P G  +  G     ++++D+    ++   +  H   I+SLD    G +LV+G
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQ-GHEQDIYSLDYFPSGDKLVSG 499

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + D +  V +S  D K++A   
Sbjct: 500 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 542

Query: 545 LDNTVKVFFLNSMKFFL---------SLYGHKLPVLSIDISFDSKLLITSSADKNIKIWG 595
           LD  V+V+  +S   FL         S  GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 543 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 596 L------------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFEC 643
           L            + G C  +   H+D ++SV          S SKD  V +WD      
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 660

Query: 644 VQKLAAHQSEVWALAISNDARF------VVSTSHDHSIRVW 678
           +  L  H++ V ++A++N +          + S D   R+W
Sbjct: 661 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 701

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 79/157 (50%), Gaps = 14/157 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+  + +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 447 FSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 506

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCV------ 193
           IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   V      
Sbjct: 507 IWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSE 564

Query: 194 -ETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
            E+   H    + +    D   V++ S +  +K+WNL
Sbjct: 565 NESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNL 601

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 106/229 (46%), Gaps = 19/229 (8%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL-PG-GA 437
           LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T      +T   + PG G 
Sbjct: 477 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 536

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADKTV 491
            +  G+    ++++D  +  L+E  +        H  +++S+  T DG  +V+GS D++V
Sbjct: 537 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSV 596

Query: 492 KFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKV 551
           K W+ +          D   P       T +   D +L+V  + +++++     D  V  
Sbjct: 597 KLWNLQNANN----KSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 652

Query: 552 FFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
           +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 653 WDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 701

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 568 LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
           L + S+  S D K L T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 440 LYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS-NDARFVVSTSHDHSIRVW 678
           S D  V+ WD    +C   L+  +  V  +A+S  D +++ + S D ++RVW
Sbjct: 500 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVW 550

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 98/226 (43%), Gaps = 49/226 (21%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD++TG+ S  L+  DG+   AV     K               
Sbjct: 492 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKY-------------- 537

Query: 90  LAVGYADGVIKIWDLISKTVLI---------NFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +A G  D  +++WD  S+T  +         +  GHK ++  + F   G  ++SGS D  
Sbjct: 538 IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRS 595

Query: 141 IIIWDL----------VGEVGLYKLR--SHKDSITGIWC-ENEDWLISTSKDGLIKIWDL 187
           + +W+L              G  ++    HKD +  +   +N+++++S SKD  +  WD 
Sbjct: 596 VKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 655

Query: 188 KTQQCVETHMAHTSECWGLAIHN--------DLVITTSTESQIKIW 225
           K+   +     H +    +A+ N        ++  T S + + +IW
Sbjct: 656 KSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 701

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 72/166 (43%), Gaps = 15/166 (9%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L Y P  + L  G  D  ++IWDL +    +  +      TV      G  + +GS D  
Sbjct: 487 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 546

Query: 141 IIIWDLVGEVGLYKLR---------SHKDSI-TGIWCENEDWLISTSKDGLIKIWDLK-T 189
           + +WD   E G    R          HKDS+ + ++  +   ++S S D  +K+W+L+  
Sbjct: 547 VRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNA 604

Query: 190 QQCVETHMAHTSECWGLAI-HNDLVITTSTESQIKIWNLDLDKDMG 234
               ++   ++  C    I H D V++ +T +Q   + L   KD G
Sbjct: 605 NNKSDSKAPNSGTCEVTYIGHKDFVLSVAT-TQNDEYILSGSKDRG 649

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 72/178 (40%), Gaps = 27/178 (15%)

Query: 32  GSAGQILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNL 89
           G    I  G+L+  V  WD +TG L + L       + +   T   +S Y + +  + + 
Sbjct: 533 GDGKYIAAGSLDRAVRVWDSETGFLVERL------DSENESGTGHKDSVYSVVFTRDGHS 586

Query: 90  LAVGYADGVIKIWDLI------------SKTVLINFNGHKSAITVLRFDPTGTRLISGSK 137
           +  G  D  +K+W+L             S T  + + GHK  +  +        ++SGSK
Sbjct: 587 VVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 646

Query: 138 DSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWL-------ISTSKDGLIKIWDLK 188
           D  ++ WD      L  L+ H++S+  +   N   L        + S D   +IW  K
Sbjct: 647 DRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYK 704

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 119/278 (42%), Gaps = 43/278 (15%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTG 485
           Y  +  F P G  +  G     ++++D+A   ++   +  H   I+SLD    G +LV+G
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 522

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISS-DNKFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + D +  V +S  D K++A   
Sbjct: 523 SGDRTVRIWDLRNGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 565

Query: 545 LDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD 597
           LD  V+V      F +  +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 566 LDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLR 625

Query: 598 -----------FGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQK 646
                       G C  +   H+D ++SV          S SKD  V +WD      +  
Sbjct: 626 GDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLM 685

Query: 647 LAAHQSEVWALAISN------DARFVVSTSHDHSIRVW 678
           L  H++ V ++A++N      +     + S D   R+W
Sbjct: 686 LQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIW 723

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 83/174 (47%), Gaps = 14/174 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+  K +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 470 FSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 529

Query: 143 IWDLV-GEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET---- 195
           IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   VE     
Sbjct: 530 IWDLRNGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSE 587

Query: 196 ---HMAHTSECWGLAIHNDL--VITTSTESQIKIWNLDLDKDMGSKLIEKGIYE 244
                 H    + +    D   V++ S +  +K+WNL  D +   K    G  E
Sbjct: 588 NELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCE 641

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 112/242 (46%), Gaps = 30/242 (12%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL-PG-GA 437
           LQGH  D+ S+D     +KL++ + + T++IW+++   C  T      +T   + PG G 
Sbjct: 500 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGK 559

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADKTV 491
            +  G+    ++++D  +  L+E  +        H  +++S+  T DG  +V+GS D++V
Sbjct: 560 YIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSV 619

Query: 492 KFWDFKVD-----QELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLD 546
           K W+ + D     +  +PGT +      K F          +L+V  + +++++     D
Sbjct: 620 KLWNLRGDNNQDVKPNVPGTCEVTYTGHKDF----------VLSVATTQNDEYILSGSKD 669

Query: 547 NTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLF 606
             V  +   S    L L GH+  V+S+ ++    L        N+ ++    GDC   ++
Sbjct: 670 RGVLFWDTKSGNPLLMLQGHRNSVISVAVANGFPL------GPNVGVFATGSGDCKARIW 723

Query: 607 AH 608
            +
Sbjct: 724 KY 725

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 89/210 (42%), Gaps = 43/210 (20%)

Query: 45  VNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           V  WD++ G+ S  L+  DG+   AV     K               +A G  D  +++W
Sbjct: 528 VRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKY--------------IAAGSLDRAVRVW 573

Query: 103 DLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGE------ 149
           D  +  ++   +       GHK ++  + F   G  ++SGS D  + +W+L G+      
Sbjct: 574 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVK 633

Query: 150 ---VGLYKLR--SHKDSITGIWC-ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSEC 203
               G  ++    HKD +  +   +N+++++S SKD  +  WD K+   +     H +  
Sbjct: 634 PNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 693

Query: 204 WGLAIHNDLVI--------TTSTESQIKIW 225
             +A+ N   +        T S + + +IW
Sbjct: 694 ISVAVANGFPLGPNVGVFATGSGDCKARIW 723

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 64/151 (42%), Gaps = 19/151 (12%)

Query: 32  GSAGQILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNL 89
           G    I  G+L+  V  WD +TG L + L       + +   T   +S Y + +  + N 
Sbjct: 556 GDGKYIAAGSLDRAVRVWDSETGFLVERLD------SENELGTGHKDSVYSVVFTRDGNN 609

Query: 90  LAVGYADGVIKIWDL-----------ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKD 138
           +  G  D  +K+W+L           +  T  + + GHK  +  +        ++SGSKD
Sbjct: 610 VVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKD 669

Query: 139 SDIIIWDLVGEVGLYKLRSHKDSITGIWCEN 169
             ++ WD      L  L+ H++S+  +   N
Sbjct: 670 RGVLFWDTKSGNPLLMLQGHRNSVISVAVAN 700

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 116/263 (44%), Gaps = 52/263 (19%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKE-----DAHGAAIWSLDLTSDGK 480
           Y  +  F P G  +  G     ++++D+      EN++       H   I+SLD    G 
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDI------ENRKIVMILQGHEQDIYSLDYFPSGD 502

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKF 539
           +LV+GS D+TV+ WD +  Q  +                 TL + D +  V +S  D K+
Sbjct: 503 KLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKY 545

Query: 540 LAVSLLDNTVKVFFLNSMKFFL---------SLYGHKLPVLSIDISFDSKLLITSSADKN 590
           +A   LD  V+V+  +S   FL         S  GHK  V S+  + D + +++ S D++
Sbjct: 546 IAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRS 603

Query: 591 IKIWGL------------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDG 638
           +K+W L            + G C  +   H+D ++SV          S SKD  V +WD 
Sbjct: 604 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 663

Query: 639 DKFECVQKLAAHQSEVWALAISN 661
                +  L  H++ V ++A++N
Sbjct: 664 KSGNPLLMLQGHRNSVISVAVAN 686

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 79/159 (49%), Gaps = 9/159 (5%)

Query: 528 ILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSA 587
           I +V  S D KFLA    D  ++++ + + K  + L GH+  + S+D       L++ S 
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 588 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC-SKDGLVKYWDGDKFECVQK 646
           D+ ++IW L  G C  +L + +D + +V   P    + +  S D  V+ WD +    V++
Sbjct: 510 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 647 L-------AAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           L         H+  V+++  + D   VVS S D S+++W
Sbjct: 569 LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLW 607

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 80/157 (50%), Gaps = 14/157 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+ ++ +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 455 FSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 514

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCV------ 193
           IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   V      
Sbjct: 515 IWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSE 572

Query: 194 -ETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
            E+   H    + +    D   V++ S +  +K+WNL
Sbjct: 573 NESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNL 609

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 104/217 (47%), Gaps = 13/217 (5%)

Query: 374 NKLYTIELQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKF 432
           N+   + LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T      +T   
Sbjct: 478 NRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVA 537

Query: 433 L-PG-GALVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVT 484
           + PG G  +  G+    ++++D  +  L+E  +        H  +++S+  T DG+ +V+
Sbjct: 538 VSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVS 597

Query: 485 GSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSL 544
           GS D++VK W+ +          D   P       T +   D +L+V  + +++++    
Sbjct: 598 GSLDRSVKLWNLQNAN----NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGS 653

Query: 545 LDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL 581
            D  V  +   S    L L GH+  V+S+ ++  S L
Sbjct: 654 KDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPL 690

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 49/111 (44%)

Query: 568 LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
           L + S+  S D K L T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 448 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           S D  V+ WD    +C   L+             D +++ + S D ++RVW
Sbjct: 508 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 558

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 89/203 (43%), Gaps = 41/203 (20%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD++TG+ S  L+  DG+   AV     K               
Sbjct: 500 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKY-------------- 545

Query: 90  LAVGYADGVIKIWDLISKTVLI---------NFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +A G  D  +++WD  S+T  +         +  GHK ++  + F   G  ++SGS D  
Sbjct: 546 IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRS 603

Query: 141 IIIWDL----------VGEVGLYKLR--SHKDSITGIWC-ENEDWLISTSKDGLIKIWDL 187
           + +W+L              G  ++    HKD +  +   +N+++++S SKD  +  WD 
Sbjct: 604 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 663

Query: 188 KTQQCVETHMAHTSECWGLAIHN 210
           K+   +     H +    +A+ N
Sbjct: 664 KSGNPLLMLQGHRNSVISVAVAN 686

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 73/166 (43%), Gaps = 15/166 (9%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L Y P  + L  G  D  ++IWDL +    +  +      TV      G  + +GS D  
Sbjct: 495 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 554

Query: 141 IIIWDLVGEVGLYKLR---------SHKDSI-TGIWCENEDWLISTSKDGLIKIWDLK-T 189
           + +WD   E G    R          HKDS+ + ++  + + ++S S D  +K+W+L+  
Sbjct: 555 VRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNA 612

Query: 190 QQCVETHMAHTSECWGLAI-HNDLVITTSTESQIKIWNLDLDKDMG 234
               ++   ++  C    I H D V++ +T +Q   + L   KD G
Sbjct: 613 NNKSDSKTPNSGTCEVTYIGHKDFVLSVAT-TQNDEYILSGSKDRG 657

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 63/152 (41%), Gaps = 20/152 (13%)

Query: 32  GSAGQILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNL 89
           G    I  G+L+  V  WD +TG L + L       + +   T   +S Y + +  +   
Sbjct: 541 GDGKYIAAGSLDRAVRVWDSETGFLVERL------DSENESGTGHKDSVYSVVFTRDGES 594

Query: 90  LAVGYADGVIKIWDLI------------SKTVLINFNGHKSAITVLRFDPTGTRLISGSK 137
           +  G  D  +K+W+L             S T  + + GHK  +  +        ++SGSK
Sbjct: 595 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 654

Query: 138 DSDIIIWDLVGEVGLYKLRSHKDSITGIWCEN 169
           D  ++ WD      L  L+ H++S+  +   N
Sbjct: 655 DRGVLFWDKKSGNPLLMLQGHRNSVISVAVAN 686

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 127/293 (43%), Gaps = 34/293 (11%)

Query: 404 SNGTLKIWNIKTHA---CIRTFE-CGYALTC-KFLPGGALVVVGNRGGDLQLFDLAS--- 455
           S   +K+ N++T A   C+ TF      +TC +F     LV  G +   ++L+ L     
Sbjct: 462 SRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPL 521

Query: 456 -STLLENKEDA--------HGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGT 506
            S L    +DA        H   ++S+  + D + LV+ S DKTV+ W       L+   
Sbjct: 522 ESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV--- 578

Query: 507 VDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH 566
                        +    N  +  VK S    + A    D T +++  + +       GH
Sbjct: 579 -------------SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGH 625

Query: 567 KLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFS 626
              V  +    +   ++T S+DK  ++W +  GD  +    H  S++SV   P+     +
Sbjct: 626 LNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 685

Query: 627 CSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
            S+DG++  WD    + ++++  H +S V++L+ + +   +VS   D S+RVW
Sbjct: 686 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVW 738

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 120/295 (40%), Gaps = 66/295 (22%)

Query: 362 PYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIR 420
           P + + P++ A +   T+ L GH   V S+  S DN+ L +AS + T+++W++ T+ C+ 
Sbjct: 520 PLESQLPSK-AKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV 578

Query: 421 TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480
           +++                                          H   +W +  +  G 
Sbjct: 579 SYK-----------------------------------------GHNHPVWDVKFSPLGH 597

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540
              TGS D+T + W           + D   P L+IF      LN D+  V    +  ++
Sbjct: 598 YFATGSHDQTARLW-----------SCDHIYP-LRIFAG---HLN-DVDCVTFHPNGTYV 641

Query: 541 AVSLLDNTVKVFFL---NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD 597
                D T +++ +   +S++ FL   GH   V+S+ +S D + L T S D  I +W + 
Sbjct: 642 LTGSSDKTCRMWDIQTGDSVRLFL---GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIG 698

Query: 598 FGDCHKSLFAH-QDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQ 651
            G   K +  H + ++ S+ F  E +   S   D  V+ WD  KF     L   Q
Sbjct: 699 TGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPSLEPEQ 753

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/278 (20%), Positives = 116/278 (41%), Gaps = 26/278 (9%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + + P+   L     D  +++W L + T L+++ GH   +  ++F P G    +GS D  
Sbjct: 548 VSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQT 607

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETH 196
             +W       +Y LR     +  + C     N  ++++ S D   ++WD++T   V   
Sbjct: 608 ARLWSC---DHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 664

Query: 197 MAHTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSV 254
           + HT+    +A+  D   + T S +  I +W++   K +           KQ +  G S 
Sbjct: 665 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI-----------KQMRGHGKSA 713

Query: 255 EF-ITTSDGVNFFYIQNADKTVEIFRVR--TQEEISKALRKREKRLRDKGMADEKIQQNI 311
            + ++ +   N      AD++V ++ ++  T E    +L   +      G  +  + Q++
Sbjct: 714 VYSLSFNKEGNILVSGGADQSVRVWDLKKFTNE---PSLEPEQPYSGYLGDMEASVNQDV 770

Query: 312 KDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVL 349
           K+      + P Q + + F  K         ++  +VL
Sbjct: 771 KEYGRRRTVFPTQDLMASFHTKKTPIYTVKFTRTNLVL 808

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 55/135 (40%), Gaps = 16/135 (11%)

Query: 110 LINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRS------------ 157
           +  F+     +T LRF      + +G +DS I +W L G     +L S            
Sbjct: 480 MYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 158 -HKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH--NDLV 213
            H   +  + +  +  +L+S S+D  +++W L T  C+ ++  H    W +         
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 214 ITTSTESQIKIWNLD 228
            T S +   ++W+ D
Sbjct: 600 ATGSHDQTARLWSCD 614

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 79/344 (22%), Positives = 142/344 (41%), Gaps = 67/344 (19%)

Query: 384 HRTDVRSIDISDDNKLLATASNGTLKIWNIK-------------THACIRTFECG----- 425
           H + V  +  S+D + LAT  N T +I+ +              T     +   G     
Sbjct: 327 HSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPST 386

Query: 426 --YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLV 483
             Y  +  F P G  +  G     ++++D+    ++   +  H   ++SLD   +G++LV
Sbjct: 387 DLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLK-GHEQDVYSLDYFPNGEKLV 445

Query: 484 TGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKFLAV 542
           +GS D+TV+ WD +  Q  +                 TL +   +  V +S +D KF+A 
Sbjct: 446 SGSGDRTVRIWDLRTGQCSL-----------------TLSIEYGVTTVAVSPNDGKFIAA 488

Query: 543 SLLDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSKLLITSSADKNIKIWG 595
             LD  V+V      F +  +     L  GH+  V S+  + D   +++ S DK +K+W 
Sbjct: 489 GSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWN 548

Query: 596 L-----------DFGD----CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDK 640
           +           D G     C  +   H+D ++SV    +     S SKD  + +WD + 
Sbjct: 549 MRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKES 608

Query: 641 FECVQKLAAHQSEVWALAISNDARF------VVSTSHDHSIRVW 678
              +  L  H++ V ++A++N +          + S D   R+W
Sbjct: 609 GNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 106/229 (46%), Gaps = 16/229 (6%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFLPG--GA 437
           L+GH  DV S+D   +  KL++ + + T++IW+++T  C  T    Y +T   +    G 
Sbjct: 425 LKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGK 484

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADKTV 491
            +  G+    ++++D  +  L+E  +        H  +++S+  T DG  +V+GS DKTV
Sbjct: 485 FIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTV 544

Query: 492 KFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKV 551
           K W+ +        + DK          T +   D +L+V  S D+K++     D  +  
Sbjct: 545 KLWNMRHSGNSNNESNDKGSASATC-EVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILF 603

Query: 552 FFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
           +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 604 WDKESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 103/224 (45%), Gaps = 17/224 (7%)

Query: 35  GQIL-TGALENVNCWDIKTGEL-SKILTDGLPPGAVDAKSTKLAEST--YLQ---YHPET 87
           GQ L TG  +    + +  GEL +K+  D +      + ++    ST  Y++   + P+ 
Sbjct: 340 GQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDG 399

Query: 88  NLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL- 146
             LA G  D +I+IWD+  + +++   GH+  +  L + P G +L+SGS D  + IWDL 
Sbjct: 400 EFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLR 459

Query: 147 VGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVET-------HMAH 199
            G+  L     +  +   +   +  ++ + S D  +++WD  T   VE           H
Sbjct: 460 TGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGH 519

Query: 200 TSECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEKG 241
               + +    D   V++ S +  +K+WN+    +  ++  +KG
Sbjct: 520 RDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKG 563

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/212 (19%), Positives = 85/212 (40%), Gaps = 43/212 (20%)

Query: 45  VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDL 104
           V  WD++TG+ S  L+       ++   T +A S       +   +A G  D  +++WD 
Sbjct: 453 VRIWDLRTGQCSLTLS-------IEYGVTTVAVSPN-----DGKFIAAGSLDRAVRVWDS 500

Query: 105 ISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDIIIWDL----------- 146
            +  ++   +       GH+ ++  + F   G  ++SGS D  + +W++           
Sbjct: 501 TTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESN 560

Query: 147 ----VGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTS 201
                          HKD +  +    +D +++S SKD  I  WD ++   +     H +
Sbjct: 561 DKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRN 620

Query: 202 ECWGLAIHN--------DLVITTSTESQIKIW 225
               +A+ N        ++  T S + + +IW
Sbjct: 621 SVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 38.5 bits (88), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 69/173 (39%), Gaps = 30/173 (17%)

Query: 37  ILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNLLAVGY 94
           I  G+L+  V  WD  TG L + L       + +   T   +S Y + +  + N +  G 
Sbjct: 486 IAAGSLDRAVRVWDSTTGFLVERLD------SENELGTGHRDSVYSVVFTRDGNEVVSGS 539

Query: 95  ADGVIKIWDL---------------ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDS 139
            D  +K+W++                S T  + + GHK  +  +        ++SGSKD 
Sbjct: 540 LDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDR 599

Query: 140 DIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWL-------ISTSKDGLIKIW 185
            I+ WD      L  L+ H++S+  +   N   L        + S D   +IW
Sbjct: 600 GILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 121/280 (43%), Gaps = 45/280 (16%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTG 485
           Y  +  F P G  +  G     ++++D+A   ++   +  H   I+SLD    G +LV+G
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 496

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS-SDNKFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + D +  V +S  D K++A   
Sbjct: 497 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSLGDGKYIAAGS 539

Query: 545 LDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD 597
           LD  V+V      F +  +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 540 LDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLS 599

Query: 598 FGD-------------CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECV 644
            G              C  +   H+D ++SV          S SKD  V +WD      +
Sbjct: 600 SGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPL 659

Query: 645 QKLAAHQSEVWALAISN----DARFVV--STSHDHSIRVW 678
             L  H++ V ++A++N      ++ V  + S D   R+W
Sbjct: 660 LMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIW 699

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 78/157 (49%), Gaps = 14/157 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+  K +++   GH+  I  L + P+G +L+SGS D  + 
Sbjct: 444 FSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 503

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET---- 195
           IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   VE     
Sbjct: 504 IWDLRTGQCSL--TLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSE 561

Query: 196 ---HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
                 H    + +    D   V++ S +  +K+WNL
Sbjct: 562 NELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 598

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 103/229 (44%), Gaps = 18/229 (7%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
           LQGH  D+ S+D     +KL++ + + T++IW+++T  C  T   E G       L  G 
Sbjct: 474 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGK 533

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADKTV 491
            +  G+    ++++D  +  L+E  +        H  +++S+  T DG  +V+GS D++V
Sbjct: 534 YIAAGSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSV 593

Query: 492 KFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKV 551
           K W+    Q     T  +  P       T     D +L+V  + +++++     D  V  
Sbjct: 594 KLWNLSSGQN---NTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLF 650

Query: 552 FFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
           +   S    L L GH+  V+S+ ++    L        T S D   +IW
Sbjct: 651 WDTKSGNPLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIW 699

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 553 FLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSI 612
           F N+      LY     + S+  S D K L T + D+ I+IW +        L  H+  I
Sbjct: 427 FANTRTASSDLY-----IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDI 481

Query: 613 MSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS-NDARFVVSTSH 671
            S+ + P      S S D  V+ WD    +C   L+  +  V  +A+S  D +++ + S 
Sbjct: 482 YSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSLGDGKYIAAGSL 540

Query: 672 DHSIRVW 678
           D ++RVW
Sbjct: 541 DRAVRVW 547

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 97/225 (43%), Gaps = 46/225 (20%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD++TG+ S  L+  DG+   AV      L +  Y+        
Sbjct: 489 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SLGDGKYI-------- 535

Query: 90  LAVGYADGVIKIWDLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDII 142
            A G  D  +++WD  +  ++   +       GHK ++  + F   G  ++SGS D  + 
Sbjct: 536 -AAGSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVK 594

Query: 143 IWDLVG-----------EVGLYKLR--SHKDSITGIWC-ENEDWLISTSKDGLIKIWDLK 188
           +W+L               G  ++    HKD +  +    N+++++S SKD  +  WD K
Sbjct: 595 LWNLSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTK 654

Query: 189 TQQCVETHMAHTSECWGLAIHNDLVI--------TTSTESQIKIW 225
           +   +     H +    +A+ N   +        T S + + +IW
Sbjct: 655 SGNPLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIW 699

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 63/151 (41%), Gaps = 15/151 (9%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L Y P  + L  G  D  ++IWDL +    +  +      TV      G  + +GS D  
Sbjct: 484 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRA 543

Query: 141 IIIWDLVGEVGLYKLR---------SHKDSITG-IWCENEDWLISTSKDGLIKIWDLKTQ 190
           + +WD   E G    R          HKDS+   ++  +   ++S S D  +K+W+L + 
Sbjct: 544 VRVWD--AETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSG 601

Query: 191 Q---CVETHMAHTSECWGLAIHNDLVITTST 218
           Q     ET  A  +       H D V++ +T
Sbjct: 602 QNNTNAETKPAPGTCEVTYTGHKDFVLSVAT 632

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 72/180 (40%), Gaps = 28/180 (15%)

Query: 32  GSAGQILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNL 89
           G    I  G+L+  V  WD +TG L + L       + +   T   +S Y + +  + + 
Sbjct: 530 GDGKYIAAGSLDRAVRVWDAETGFLVERLD------SENELGTGHKDSVYSVVFTRDGHG 583

Query: 90  LAVGYADGVIKIWDLISK-------------TVLINFNGHKSAITVLRFDPTGTRLISGS 136
           +  G  D  +K+W+L S              T  + + GHK  +  +        ++SGS
Sbjct: 584 VVSGSLDRSVKLWNLSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGS 643

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWL-------ISTSKDGLIKIWDLKT 189
           KD  ++ WD      L  L+ H++S+  +   N   L        + S D   +IW   T
Sbjct: 644 KDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWKYTT 703

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 95/407 (23%), Positives = 175/407 (42%), Gaps = 59/407 (14%)

Query: 285 EISKALRKREKRLRDKGMADEKIQQNIKDSYVSVIMHPFQT-IRSPFKIKAATWAVTTTS 343
           E+ K+   R+   RD+   ++K   N+ D   S++  P +  + SP    A +  + T +
Sbjct: 361 EVKKSDTNRDGSNRDEATTNDKDDVNLDDR-TSLLTKPKEADMMSP---SADSIPLPTKT 416

Query: 344 KLEMVLTTSNNTVEYYSIPYQKREPTR--PAPNKLYTIELQG-HRT--DVRSIDISDDNK 398
            L++ L       E   +  + RE  R    PN L ++ +   H T  D+ S++ SDD +
Sbjct: 417 ALDIRL-------EIQKV-RESRESIRLDTNPNSLPSVCMYTFHNTNQDMTSLEFSDDCR 468

Query: 399 LLATA-SNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASST 457
           L +T   +  +KIW++           G +L  KF          N+  +       S T
Sbjct: 469 LASTGFQDSYIKIWSLD----------GTSLNTKF-------TQANKDRNRITITDRSLT 511

Query: 458 LLENKEDA----HGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPK 513
            ++N+  A    H   ++S   + D + L++GS DKTV+ W       L+          
Sbjct: 512 HMDNELSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALV---------- 561

Query: 514 LKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLY-GHKLPVLS 572
                 +    N  I  V+ S    + A +  D T +++  + + F L ++ GH   V  
Sbjct: 562 ------SYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCDHI-FPLRIFAGHLNDVDC 614

Query: 573 IDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGL 632
           +    +   + T S+DK  ++W +  GD  +    H  +++S    P+     + S DG 
Sbjct: 615 VSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGT 674

Query: 633 VKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
           +  WD    + ++ L  H ++ V++L  S +   +VS+  D S+RVW
Sbjct: 675 INVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVW 721

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 100/221 (45%), Gaps = 23/221 (10%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALT---CKFLPGG 436
           L GH   V S   S DN+ L + S + T+++W++ TH  + +++ G+       +F P G
Sbjct: 521 LIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYK-GHNHPIWDVQFSPLG 579

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
                 +     +L+       L      H   +  +    +G  + TGS+DKT + WD 
Sbjct: 580 HYFATASHDQTARLWSCDHIFPLRIFA-GHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDI 638

Query: 497 KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNS 556
                +          +L + H +       +++  +S D ++L     D T+ V+ + S
Sbjct: 639 STGDSV----------RLFLGHTSA------VVSTAVSPDGRWLTTGSDDGTINVWDIGS 682

Query: 557 MKFFLSLYGH-KLPVLSIDISFDSKLLITSSADKNIKIWGL 596
            K   SL GH K  V S+  S +  LL++S AD+++++W L
Sbjct: 683 GKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 3/156 (1%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L  G  D  +++W L + T L+++ GH   I  ++F P G    + S D    
Sbjct: 533 FSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTAR 592

Query: 143 IWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS 201
           +W       L     H + +  + +  N  ++ + S D   ++WD+ T   V   + HTS
Sbjct: 593 LWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTS 652

Query: 202 ECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGS 235
                A+  D   + T S +  I +W++   K + S
Sbjct: 653 AVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKS 688

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 2/109 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    +  G +D   ++WD+ +   +  F GH SA+      P G  L +GS D  
Sbjct: 615 VSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGT 674

Query: 141 IIIWDLVGEVGLYKLRSH-KDSITGI-WCENEDWLISTSKDGLIKIWDL 187
           I +WD+     L  LR H K+++  + + +  + L+S+  D  +++WDL
Sbjct: 675 INVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 67/151 (44%), Gaps = 4/151 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +Q+ P  +  A    D   ++W       L  F GH + +  + F P G  + +GS D  
Sbjct: 573 VQFSPLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKT 632

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +WD+     +     H  ++       +  WL + S DG I +WD+ + + +++   H
Sbjct: 633 CRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGH 692

Query: 200 -TSECWGLAI--HNDLVITTSTESQIKIWNL 227
             +  + L      +L++++  +  +++W+L
Sbjct: 693 GKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 133/307 (43%), Gaps = 40/307 (13%)

Query: 376 LYTIELQGHRT--DVRSIDISDDNKLLATA-SNGTLKIWNIKTHACIRTFECGYALTCKF 432
           LYT     H T  D+ S+D S+D++L A    +  +K+W++           G +L  K+
Sbjct: 512 LYTF----HNTNRDMTSLDFSEDSRLAAGGFQDSYIKLWSLD----------GSSLK-KY 556

Query: 433 LPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
               +         D    D  ++TL+      H  A++S   + D K L++GS DKTV+
Sbjct: 557 GDVSSSPSPSATTADKYSKDFTNTTLI-----GHSGAVYSTSFSPDNKYLISGSEDKTVR 611

Query: 493 FWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVF 552
            W    +  L+                +    N  +  VK S    + A +  D T +++
Sbjct: 612 LWSLDTNTTLV----------------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLW 655

Query: 553 FLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSI 612
             + +       GH   V  +    +   + T S+DK  ++W +  GD  +    H   +
Sbjct: 656 SCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 715

Query: 613 MSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSH 671
           +S    P+     + S+DG++  WD    + ++ +  H ++ +++L+ S +   +VS+  
Sbjct: 716 ISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGA 775

Query: 672 DHSIRVW 678
           DHS+RVW
Sbjct: 776 DHSVRVW 782

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 69/157 (43%), Gaps = 9/157 (5%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L  G  D  +++W L + T L+++ GH   +  ++F P G    + S D    
Sbjct: 594 FSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTAR 653

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           +W       +Y LR     ++ + C     N  ++ + S D   ++WD+ T   V   + 
Sbjct: 654 LWSC---DHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 710

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDM 233
           HT+     A+  D   + T S +  I +W++   K +
Sbjct: 711 HTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRL 747

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 69/151 (45%), Gaps = 4/151 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +++ P  +  A    D   ++W       L  F GH S +  + F P G  + +GS D  
Sbjct: 634 VKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKT 693

Query: 141 IIIWDL-VGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +WD+  G+     L      I+     +  WL + S+DG+I +WD+ T + ++    H
Sbjct: 694 CRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGH 753

Query: 200 TSEC-WGLAI--HNDLVITTSTESQIKIWNL 227
                + L+     ++++++  +  +++W+L
Sbjct: 754 GKNAIYSLSYSKEGNVLVSSGADHSVRVWDL 784

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 60/116 (51%), Gaps = 2/116 (1%)

Query: 75  LAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLIS 134
           L++   + +HP    +  G +D   ++WD+ +   +  F GH + +      P G  L +
Sbjct: 670 LSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLST 729

Query: 135 GSKDSDIIIWDLVGEVGLYKLRSH-KDSITGI-WCENEDWLISTSKDGLIKIWDLK 188
           GS+D  I +WD+     L  +R H K++I  + + +  + L+S+  D  +++WDLK
Sbjct: 730 GSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 68/151 (45%), Gaps = 5/151 (3%)

Query: 381 LQGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
             GH +DV  +    +   + T +S+ T ++W++ T   +R F       ++    P G 
Sbjct: 666 FAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGR 725

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +  G+  G + ++D+ +   L+        AI+SL  + +G  LV+  AD +V+ WD K
Sbjct: 726 WLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

Query: 498 VDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
             +     + +   P +    D T  +N DI
Sbjct: 786 --KATAEPSAEPEEPFVGYLGDVTASINQDI 814

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 67/180 (37%), Gaps = 34/180 (18%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIWDL----------------------------ISKTVL 110
           T L +  ++ L A G+ D  IK+W L                             + T L
Sbjct: 523 TSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNTTL 582

Query: 111 INFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCEN 169
           I   GH  A+    F P    LISGS+D  + +W L     L   + H   +  + +   
Sbjct: 583 I---GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPL 639

Query: 170 EDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
             +  + S D   ++W       +     H S+   ++ H +   V T S++   ++W++
Sbjct: 640 GHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDV 699

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/368 (22%), Positives = 143/368 (38%), Gaps = 78/368 (21%)

Query: 371 PAPNKLYTIELQ---GHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACI-------- 419
           PA  +   +EL     H + V  +  S D + LAT  N T +++ + T   I        
Sbjct: 426 PALPRTLDVELHKSLDHSSVVCCVKFSYDGEFLATGCNKTTQVYRVSTGELIAKLSDDNV 485

Query: 420 -----RTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLD 474
                 T    Y  +  F P G  +  G     ++++D+    ++   +  H   ++SLD
Sbjct: 486 KLDSNSTSTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLK-GHEQDVYSLD 544

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
              DG++LV+GS D+TV+ WD +  Q  +                 TL + D +  V +S
Sbjct: 545 YFPDGQKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVS 587

Query: 535 S-DNKFLAVSLLDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSKLLITSS 586
             D +F+A   LD  V+V      F +  +     L  GH+  V S+  + D   +++ S
Sbjct: 588 PHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGS 647

Query: 587 ADKNIKIWGLDF------------------------------GDCHKSLFAHQDSIMSVK 616
            DK++K+W L                                  C  +   H+D ++SV 
Sbjct: 648 LDKSVKLWNLGNDVNSNNNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVT 707

Query: 617 FVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARF------VVSTS 670
                    S SKD  V +WD      +  L  H++ V ++A++N            + S
Sbjct: 708 TSQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGS 767

Query: 671 HDHSIRVW 678
            D   R+W
Sbjct: 768 GDCKARIW 775

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 94/206 (45%), Gaps = 21/206 (10%)

Query: 37  ILTGALENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQ---YHPETNLLAVG 93
           + TG  +    + + TGEL   L+D      V   S   +   Y++   + P+   LA G
Sbjct: 458 LATGCNKTTQVYRVSTGELIAKLSDD----NVKLDSNSTSTDLYIRSVCFSPDGKFLATG 513

Query: 94  YADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-VGEVGL 152
             D +I+IWD+    +++   GH+  +  L + P G +L+SGS D  + IWDL  G+  L
Sbjct: 514 AEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSL 573

Query: 153 YKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET-------HMAHTSEC 203
               S +D +T +     D  ++ + S D  +++WD  T   VE           H    
Sbjct: 574 --TLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSV 631

Query: 204 WGLAIHND--LVITTSTESQIKIWNL 227
           + +    D   V++ S +  +K+WNL
Sbjct: 632 YSVVFTRDGNEVVSGSLDKSVKLWNL 657

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 92/229 (40%), Gaps = 62/229 (27%)

Query: 45  VNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           V  WD++TG+ S  L+  DG+         T +A S +     +   +A G  D  +++W
Sbjct: 561 VRIWDLRTGQCSLTLSIEDGV---------TTVAVSPH-----DGRFIAAGSLDRAVRVW 606

Query: 103 DLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLV-------- 147
           D  +  ++   +       GH+ ++  + F   G  ++SGS D  + +W+L         
Sbjct: 607 DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGNDVNSNNN 666

Query: 148 --------------------GEVGLYKLR--SHKDSITGIW-CENEDWLISTSKDGLIKI 184
                               G     ++    HKD +  +   +N+++++S SKD  +  
Sbjct: 667 GNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGVLF 726

Query: 185 WDLKTQQCVETHMAHTSECWGLAIHN--------DLVITTSTESQIKIW 225
           WD K+   +     H +    +A+ N        ++  T S + + +IW
Sbjct: 727 WDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIW 775

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 121/281 (43%), Gaps = 26/281 (9%)

Query: 342 TSKLEMVLTTSNNTVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLA 401
           TS  +++    +  V  Y I       T P P        +GHR +V SI    DNK + 
Sbjct: 41  TSDKKLLAAAGHQNVRLYDI-----RTTNPNP----VASFEGHRGNVTSISFQQDNKWMV 91

Query: 402 TAS-NGTLKIWNIKTHACIRTFECGYALTCKFL-PGGALVVVGNRGGDLQLFDLASSTLL 459
           ++S +GT+K+W+++  +  R ++    +    + P    ++  +R G+++++DL  +   
Sbjct: 92  SSSEDGTIKVWDVRAPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCT 151

Query: 460 ENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVD--KFVPKLKIF 517
                     + SL L SDG  LV  ++      W+       +P   D     P  K  
Sbjct: 152 HQLTPEDDTPLQSLSLASDGSMLVAANSKGNCYVWE-------MPNRTDASNLKPVTKFR 204

Query: 518 HDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL-NSMKFFLSLYGHKLPVLSIDIS 576
              T      I  + +SSD K LA    D+T +V+ + N+ +   +L GH+  V     S
Sbjct: 205 SHATY-----ITRILLSSDVKHLATCSADHTARVWSIDNNFELETTLDGHQRWVWDCAFS 259

Query: 577 FDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 617
            DS  L+T+S+D  +++W L   +  +    H    + V  
Sbjct: 260 ADSAYLVTASSDHYVRLWDLSTKEIVRQYGGHHKGAVCVAL 300

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 124/292 (42%), Gaps = 28/292 (9%)

Query: 381 LQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKT--HACIRTFEC--GYALTCKFLPGG 436
           +Q   + V  ++I+ D KLLA A +  +++++I+T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITSDKKLLAAAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSISFQQDN 87

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
             +V  +  G ++++D+ + ++  N +  H A +  + +  +   L++   D  ++ WD 
Sbjct: 88  KWMVSSSEDGTIKVWDVRAPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 497 KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL-- 554
             +Q                 H  T E +  + ++ ++SD   L  +       V+ +  
Sbjct: 146 GENQ---------------CTHQLTPEDDTPLQSLSLASDGSMLVAANSKGNCYVWEMPN 190

Query: 555 ----NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG-DCHKSLFAHQ 609
               +++K       H   +  I +S D K L T SAD   ++W +D   +   +L  HQ
Sbjct: 191 RTDASNLKPVTKFRSHATYITRILLSSDVKHLATCSADHTARVWSIDNNFELETTLDGHQ 250

Query: 610 DSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN 661
             +    F  +S    + S D  V+ WD    E V++   H      +A+++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTKEIVRQYGGHHKGAVCVALND 302

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 118/291 (40%), Gaps = 29/291 (9%)

Query: 399 LLATASNGTLKIWNIKTHACIRTFECGYALTCKF-LPGGALVVVGNRGGDLQLFDLASST 457
           L++   + T++ W   T  C RT +   +   +  +     ++      +++L+D+ ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKKLLAAAGHQNVRLYDIRTTN 64

Query: 458 LLENKE-DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKI 516
                  + H   + S+    D K +V+ S D T+K WD +     +P       P  ++
Sbjct: 65  PNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPS--VPRNYKHNAPVNEV 122

Query: 517 -FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK-LPVLSID 574
             H    EL        IS D         D  ++++ L   +    L      P+ S+ 
Sbjct: 123 VIHPNQGEL--------ISCDR--------DGNIRIWDLGENQCTHQLTPEDDTPLQSLS 166

Query: 575 ISFDSKLLITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFVPESHNFFSCS 628
           ++ D  +L+ +++  N  +W +       +L       +H   I  +    +  +  +CS
Sbjct: 167 LASDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRSHATYITRILLSSDVKHLATCS 226

Query: 629 KDGLVKYWDGDK-FECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            D   + W  D  FE    L  HQ  VW  A S D+ ++V+ S DH +R+W
Sbjct: 227 ADHTARVWSIDNNFELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 90/219 (41%), Gaps = 18/219 (8%)

Query: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           L A G+ +  ++++D+   +   + +F GH+  +T + F      ++S S+D  I +WD+
Sbjct: 47  LAAAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDV 104

Query: 147 VGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS----- 201
                    + +      +   N+  LIS  +DG I+IWDL   QC  TH          
Sbjct: 105 RAPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC--THQLTPEDDTPL 162

Query: 202 ECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGS-KLIEKGIYEKQSKQRGVSVEFITTS 260
           +   LA    +++  +++    +W +    D  + K + K       +     +  I  S
Sbjct: 163 QSLSLASDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTK------FRSHATYITRILLS 216

Query: 261 DGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRD 299
             V      +AD T  ++ +    E+   L   ++ + D
Sbjct: 217 SDVKHLATCSADHTARVWSIDNNFELETTLDGHQRWVWD 255

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 71/144 (49%), Gaps = 8/144 (5%)

Query: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-- 146
           L++ GY D  I+ W+ ++           S +  L    +  +L++ +   ++ ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TSDKKLLAAAGHQNVRLYDIRT 62

Query: 147 VGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWG 205
                +     H+ ++T I + ++  W++S+S+DG IK+WD++    V  +  H +    
Sbjct: 63  TNPNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPS-VPRNYKHNAPVNE 121

Query: 206 LAIHNDL--VITTSTESQIKIWNL 227
           + IH +   +I+   +  I+IW+L
Sbjct: 122 VVIHPNQGELISCDRDGNIRIWDL 145

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 86/205 (41%), Gaps = 21/205 (10%)

Query: 43  ENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           +NV  +DI+T            P  V +        T + +  +   +     DG IK+W
Sbjct: 53  QNVRLYDIRTTN----------PNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVW 102

Query: 103 DLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSI 162
           D+ + +V  N+  H + +  +   P    LIS  +D +I IWDL      ++L    D+ 
Sbjct: 103 DVRAPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTP 161

Query: 163 TGIWCENED--WLISTSKDGLIKIWDLKTQ------QCVETHMAHTSECWGLAIHNDL-- 212
                   D   L++ +  G   +W++  +      + V    +H +    + + +D+  
Sbjct: 162 LQSLSLASDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRSHATYITRILLSSDVKH 221

Query: 213 VITTSTESQIKIWNLDLDKDMGSKL 237
           + T S +   ++W++D + ++ + L
Sbjct: 222 LATCSADHTARVWSIDNNFELETTL 246

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 579 SKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWD- 637
           S LL+++  D  I+ W    G C +++  H DS ++   +       + +    V+ +D 
Sbjct: 2   SVLLVSAGYDHTIRFWEALTGVCSRTI-QHSDSQVNRLEITSDKKLLAAAGHQNVRLYDI 60

Query: 638 -GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
                  V     H+  V +++   D +++VS+S D +I+VW
Sbjct: 61  RTTNPNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVW 102

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/354 (22%), Positives = 139/354 (39%), Gaps = 77/354 (21%)

Query: 384 HRTDVRSIDISDDNKLLATASNGTLKIWNIKT----------HACIRTFECG-------- 425
           H + V  +  S+D + LAT  N T +++ + T           A   +   G        
Sbjct: 375 HSSVVCCVRFSNDGEYLATGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAEN 434

Query: 426 ---------------YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAI 470
                          Y  +  F P G  +  G     ++++DL +  ++   +  H   I
Sbjct: 435 AEQTPAVSTSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQ-GHEQDI 493

Query: 471 WSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILA 530
           +SLD    G +LV+GS D+TV+ WD +  Q  +                 TL + D +  
Sbjct: 494 YSLDYFPSGDKLVSGSGDRTVRIWDLRAGQCSL-----------------TLSIEDGVTT 536

Query: 531 VKIS-SDNKFLAVSLLDNTVKV------FFLNSMKFFLSL-YGHKLPVLSIDISFDSKLL 582
           V +S  D K +A   LD TV++      F +  +     L  GHK  V S+  + D   +
Sbjct: 537 VAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGV 596

Query: 583 ITSSADKNIKIWGL------------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKD 630
           ++ S D+++K+W L            +      +   H+D ++SV          S SKD
Sbjct: 597 VSGSLDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKD 656

Query: 631 GLVKYWDGDKFECVQKLAAHQSEVWALAISNDARF------VVSTSHDHSIRVW 678
             V +WD      +  L  H++ V ++A++ND           + S D   R+W
Sbjct: 657 RGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 710

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 100/222 (45%), Gaps = 33/222 (14%)

Query: 37  ILTGALENVNCWDIKTGELSKILTD---GLPPG-------------AVDAKSTKLAESTY 80
           + TG  +    + + TGEL   L++     P G                A ST  +   Y
Sbjct: 391 LATGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVSTSASSDLY 450

Query: 81  LQ---YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSK 137
           ++   + P+   LA G  D +I+IWDL ++ +++   GH+  I  L + P+G +L+SGS 
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 510

Query: 138 DSDIIIWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVE 194
           D  + IWDL  G+  L    S +D +T +     D   + + S D  ++IWD +T   VE
Sbjct: 511 DRTVRIWDLRAGQCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVE 568

Query: 195 T-------HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
                      H    + +    D   V++ S +  +K+WNL
Sbjct: 569 RLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 610

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 106/231 (45%), Gaps = 19/231 (8%)

Query: 379 IELQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL-PG- 435
           + LQGH  D+ S+D     +KL++ + + T++IW+++   C  T      +T   + PG 
Sbjct: 484 MTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGD 543

Query: 436 GALVVVGNRGGDLQLFDLASSTLLENKED------AHGAAIWSLDLTSDGKRLVTGSADK 489
           G L+  G+    ++++D  +  L+E  +        H  +++S+  T DG  +V+GS D+
Sbjct: 544 GKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDR 603

Query: 490 TVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTV 549
           +VK W+ +       G   +          T     D +L+V  + +++F+     D  V
Sbjct: 604 SVKLWNLRSAN----GGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGV 659

Query: 550 KVFFLNSMKFFLSLYGHKLPVLSIDISFDSKL------LITSSADKNIKIW 594
             +   S    L L GH+  V+S+ ++ D  L        T S D   +IW
Sbjct: 660 LFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 710

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 86/211 (40%), Gaps = 44/211 (20%)

Query: 45  VNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           V  WD++ G+ S  L+  DG+   AV     KL              +A G  D  ++IW
Sbjct: 514 VRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKL--------------IAAGSLDRTVRIW 559

Query: 103 DLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVG---- 151
           D  +  ++   +       GHK ++  + F   G  ++SGS D  + +W+L    G    
Sbjct: 560 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTE 619

Query: 152 --------LYKLRSHKDSITGIWC-ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSE 202
                         HKD +  +   +N+++++S SKD  +  WD  +   +     H + 
Sbjct: 620 GKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNS 679

Query: 203 CWGLAIHND--------LVITTSTESQIKIW 225
              +A+ ND        +  T S + + +IW
Sbjct: 680 VISVAVANDHPLGPEYGVFATGSGDCKARIW 710

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 70/170 (41%), Gaps = 27/170 (15%)

Query: 37  ILTGALE-NVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTY-LQYHPETNLLAVGY 94
           I  G+L+  V  WD +TG L + L       + +   T   +S Y + +  + + +  G 
Sbjct: 547 IAAGSLDRTVRIWDSETGFLVERLD------SENELGTGHKDSVYSVVFTRDGHGVVSGS 600

Query: 95  ADGVIKIWDLISK------------TVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
            D  +K+W+L S                + + GHK  +  +        ++SGSKD  ++
Sbjct: 601 LDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVL 660

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWCENEDWL-------ISTSKDGLIKIW 185
            WD      L  L+ H++S+  +   N+  L        + S D   +IW
Sbjct: 661 FWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 710

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 117/252 (46%), Gaps = 23/252 (9%)

Query: 373 PNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK 431
           PN + + E  GH+ +V S+    DNK + ++S +GT+K+W++++ +  R ++    +   
Sbjct: 65  PNPVASFE--GHKGNVTSLSFQQDNKWMVSSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122

Query: 432 FL-PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT 490
            + P    ++  +R G+++++DL  +             + S+ + SDG  LV  +    
Sbjct: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDIPLQSISVASDGSMLVAANTKGN 182

Query: 491 VKFWDFKVDQELIPGTVD----KFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLD 546
              W+       +P   D    K V K K         ND I  + +SSD K LA    D
Sbjct: 183 CFVWE-------MPNHTDASNLKPVTKFKAH-------NDYITRILLSSDVKHLATCSAD 228

Query: 547 NTVKVFFL-NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSL 605
           +T +V+ + N+ K   +L GH+  V     S DS  L+T+S+D  +++W L   +  +  
Sbjct: 229 HTTRVWSIDNNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREVVRQY 288

Query: 606 FAHQDSIMSVKF 617
             H   ++ V  
Sbjct: 289 GGHHKGVVCVAL 300

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 119/291 (40%), Gaps = 29/291 (9%)

Query: 399 LLATASNGTLKIWNIKTHACIRTFECGYALTCKF-LPGGALVVVGNRGGDLQLFDLASST 457
           L++   + T++ W   T  C RT +   +   +  +     ++      +++L+D+ ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTN 64

Query: 458 LLENKE-DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKI 516
                  + H   + SL    D K +V+ S D T+K WD +     IP       P  ++
Sbjct: 65  PNPVASFEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVWDVR--SPSIPRNYKHNAPVNEV 122

Query: 517 -FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK-LPVLSID 574
             H    EL        IS D         D  ++++ L   +    L     +P+ SI 
Sbjct: 123 VIHPNQGEL--------ISCDR--------DGNIRIWDLGENQCTHQLTPEDDIPLQSIS 166

Query: 575 ISFDSKLLITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFVPESHNFFSCS 628
           ++ D  +L+ ++   N  +W + +  D           AH D I  +    +  +  +CS
Sbjct: 167 VASDGSMLVAANTKGNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILLSSDVKHLATCS 226

Query: 629 KDGLVKYWDGDK-FECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            D   + W  D  F+    L  HQ  VW  A S D+ ++V+ S DH +R+W
Sbjct: 227 ADHTTRVWSIDNNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 125/292 (42%), Gaps = 28/292 (9%)

Query: 381 LQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKT--HACIRTFEC--GYALTCKFLPGG 436
           +Q   + V  ++I++D KLLA A +  +++++I+T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTNPNPVASFEGHKGNVTSLSFQQDN 87

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
             +V  +  G ++++D+ S ++  N +  H A +  + +  +   L++   D  ++ WD 
Sbjct: 88  KWMVSSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 497 KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL-- 554
             +Q                 H  T E +  + ++ ++SD   L  +       V+ +  
Sbjct: 146 GENQ---------------CTHQLTPEDDIPLQSISVASDGSMLVAANTKGNCFVWEMPN 190

Query: 555 ----NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG-DCHKSLFAHQ 609
               +++K       H   +  I +S D K L T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASNLKPVTKFKAHNDYITRILLSSDVKHLATCSADHTTRVWSIDNNFKLESTLDGHQ 250

Query: 610 DSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN 661
             +    F  +S    + S D  V+ WD    E V++   H   V  +A+++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREVVRQYGGHHKGVVCVALND 302

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 6/109 (5%)

Query: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           L A G+ +  ++++D+   +   + +F GHK  +T L F      ++S S+D  I +WD 
Sbjct: 47  LAAAGHQN--VRLYDIRTTNPNPVASFEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVWD- 103

Query: 147 VGEVGLYKLRSHKDSITGIWCE-NEDWLISTSKDGLIKIWDLKTQQCVE 194
           V    + +   H   +  +    N+  LIS  +DG I+IWDL   QC  
Sbjct: 104 VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH 152

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 85/207 (41%), Gaps = 25/207 (12%)

Query: 43  ENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           +NV  +DI+T            P  V +        T L +  +   +     DG IK+W
Sbjct: 53  QNVRLYDIRTTN----------PNPVASFEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVW 102

Query: 103 DLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKD-- 160
           D+ S ++  N+  H + +  +   P    LIS  +D +I IWDL      ++L    D  
Sbjct: 103 DVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDIP 161

Query: 161 --SITGIWCENEDWLISTSKDGLIKIWDLKTQ------QCVETHMAHTSECWGLAIHNDL 212
             SI+     +   L++ +  G   +W++         + V    AH      + + +D+
Sbjct: 162 LQSISV--ASDGSMLVAANTKGNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILLSSDV 219

Query: 213 --VITTSTESQIKIWNLDLDKDMGSKL 237
             + T S +   ++W++D +  + S L
Sbjct: 220 KHLATCSADHTTRVWSIDNNFKLESTL 246

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 116/252 (46%), Gaps = 23/252 (9%)

Query: 373 PNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK 431
           PN + + E  GHR +V S+    DNK +AT+S +GT+K+W+++  +  R ++    +   
Sbjct: 65  PNPVASFE--GHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAPVNEV 122

Query: 432 FL-PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT 490
            + P    ++  +R G ++++DL  +             + SL L SDG  LV  +    
Sbjct: 123 VIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANNKGN 182

Query: 491 VKFWDFKVDQELIPGTVD----KFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLD 546
              W+       +P   D    K V K +  H+T       I  + +SSD K LA    D
Sbjct: 183 CYVWE-------MPNRTDASNLKPVTKFR-SHNTY------ITRILLSSDVKHLATCSAD 228

Query: 547 NTVKVFFLN-SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSL 605
           +T +V+ ++ + K   +L GH+  V     S DS  L+T+S+D  +++W L   +  +  
Sbjct: 229 HTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDLSTREIVRQY 288

Query: 606 FAHQDSIMSVKF 617
             H    + V  
Sbjct: 289 GGHHKGAVCVAL 300

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/290 (19%), Positives = 116/290 (40%), Gaps = 27/290 (9%)

Query: 399 LLATASNGTLKIWNIKTHACIRTFECGYALTCKF-LPGGALVVVGNRGGDLQLFDLASST 457
           L++   + T++ W   T  C RT +   +   +  +     ++      +++L+D+ ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTN 64

Query: 458 LLENKE-DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKI 516
                  + H   + S+    D K + T S D T+K WD +             +P+   
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPS----------IPR--- 111

Query: 517 FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK-LPVLSIDI 575
                 +LN  +  V I  +   L     D  ++++ L   +    L      P+ S+ +
Sbjct: 112 ----NYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSL 167

Query: 576 SFDSKLLITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFVPESHNFFSCSK 629
           + D  +L+ ++   N  +W +       +L       +H   I  +    +  +  +CS 
Sbjct: 168 ASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSA 227

Query: 630 DGLVKYWD-GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           D   + W   D F+    L  HQ  VW  A S D+ ++++ S DH +R+W
Sbjct: 228 DHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLW 277

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/292 (19%), Positives = 122/292 (41%), Gaps = 28/292 (9%)

Query: 381 LQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKT--HACIRTFEC--GYALTCKFLPGG 436
           +Q   + V  ++I++D KLLA A +  +++++I+T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
             +   +  G ++++D+ + ++  N +    A +  + +  +   L++   D  ++ WD 
Sbjct: 88  KWMATSSEDGTIKVWDVRAPSIPRNYK--LNAPVNEVVIHPNQGELISCDRDGHIRIWDL 145

Query: 497 KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL-- 554
             +Q                 H  T E +  + ++ ++SD   L  +       V+ +  
Sbjct: 146 GENQ---------------CTHQLTPEDDTPLQSLSLASDGSMLVAANNKGNCYVWEMPN 190

Query: 555 ----NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG-DCHKSLFAHQ 609
               +++K       H   +  I +S D K L T SAD   ++W +D       +L  HQ
Sbjct: 191 RTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSADHTARVWSVDDNFKLETTLDGHQ 250

Query: 610 DSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN 661
             +    F  +S    + S D  V+ WD    E V++   H      +A+++
Sbjct: 251 RWVWDCAFSADSAYLMTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 8/110 (7%)

Query: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           L A G+ +  ++++D+   +   + +F GH+  +T + F      + + S+D  I +WD+
Sbjct: 47  LAAAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDV 104

Query: 147 VGEV--GLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
                   YKL +  + +  +   N+  LIS  +DG I+IWDL   QC  
Sbjct: 105 RAPSIPRNYKLNAPVNEV--VIHPNQGELISCDRDGHIRIWDLGENQCTH 152

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 80/196 (40%), Gaps = 21/196 (10%)

Query: 43  ENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           +NV  +DI+T            P  V +        T + +  +   +A    DG IK+W
Sbjct: 53  QNVRLYDIRTTN----------PNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVW 102

Query: 103 DLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSI 162
           D+ + ++  N+  +     V+   P    LIS  +D  I IWDL      ++L    D+ 
Sbjct: 103 DVRAPSIPRNYKLNAPVNEVV-IHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTP 161

Query: 163 TGIWCENED--WLISTSKDGLIKIWDLKTQ------QCVETHMAHTSECWGLAIHNDL-- 212
                   D   L++ +  G   +W++  +      + V    +H +    + + +D+  
Sbjct: 162 LQSLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKH 221

Query: 213 VITTSTESQIKIWNLD 228
           + T S +   ++W++D
Sbjct: 222 LATCSADHTARVWSVD 237

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 104/235 (44%), Gaps = 21/235 (8%)

Query: 453 LASSTLLENKEDAHGAAIWSLDL-TSDGKR--LVTGSADKTVKFWDFKVDQELIPGTVDK 509
           +AS+ +L  +    G   W   L TS G+   L++ S DKT+  W    D +     V  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 510 FVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLP 569
           F     I  D TL           ++D  +   +  D T++++ + + + +    GHK  
Sbjct: 61  FKGHSHIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 570 VLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVP------ESHN 623
           V+S+DI   + ++I+ S DK IK+W +  G C  +L  H D +  V+ VP      +S  
Sbjct: 110 VMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVT 168

Query: 624 FFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             S   D +VK W+ ++F+       H S +  L  S D   + S   D  I +W
Sbjct: 169 IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 67/147 (45%), Gaps = 10/147 (6%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++WD+ +      F GHKS +  +  D   + +ISGS+D  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDSITGIWC-------ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAI 208
             H D ++ +         ++   +IS   D ++K W+L   Q     + H S    L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 209 HND--LVITTSTESQIKIWNLDLDKDM 233
             D  L+ +   + +I +WNL   K M
Sbjct: 205 SPDGTLIASAGKDGEIMLWNLAAKKAM 231

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D ++K W+L    +  +F GH S I  L   P GT + S  KD +I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 156 RSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
            +  +  +  +  N  WL + +  G IK++ L  Q  V+
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 91/209 (43%), Gaps = 25/209 (11%)

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LT+DG   ++ S DKT++ WD    +     T  +FV               D+++V I 
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGE-----TYQRFVGH-----------KSDVMSVDID 116

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI------SFDSKLLITSSAD 588
                +     D T+KV+ +   +   +L GH   V  + +        DS  +I++  D
Sbjct: 117 KKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGND 175

Query: 589 KNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLA 648
           K +K W L+          H  +I ++   P+     S  KDG +  W+    + +  L+
Sbjct: 176 KMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLS 235

Query: 649 AHQSEVWALAISNDARFVVSTSHDHSIRV 677
           A Q EV++LA S + R+ ++ +    I+V
Sbjct: 236 A-QDEVFSLAFSPN-RYWLAAATATGIKV 262

 Score = 38.5 bits (88), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 10/126 (7%)

Query: 112 NFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE- 170
           +F GH   +        G   +S S D  + +WD+       +   HK  +  +  + + 
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 171 DWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHND--------LVITTSTESQI 222
             +IS S+D  IK+W +K  QC+ T + H      + +  +         +I+   +  +
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMV 178

Query: 223 KIWNLD 228
           K WNL+
Sbjct: 179 KAWNLN 184

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 46/234 (19%), Positives = 89/234 (38%), Gaps = 47/234 (20%)

Query: 383 GHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTF--ECGYALTCKFLPGG--- 436
           GH++DV S+DI     ++ + S + T+K+W IK   C+ T      +    + +P     
Sbjct: 105 GHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQ-CLATLLGHNDWVSQVRVVPNEKAD 163

Query: 437 ----ALVVVGN----RGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSAD 488
                ++  GN    +  +L  F + +  +       H + I +L  + DG  + +   D
Sbjct: 164 DDSVTIISAGNDKMVKAWNLNQFQIEADFI------GHNSNINTLTASPDGTLIASAGKD 217

Query: 489 KTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNT 548
             +  W+    + +                  TL   D++ ++  S +  +LA +     
Sbjct: 218 GEIMLWNLAAKKAMY-----------------TLSAQDEVFSLAFSPNRYWLAAATATG- 259

Query: 549 VKVFFLNSMKF-------FLSLYGHKLP-VLSIDISFDSKLLITSSADKNIKIW 594
           +KVF L+           F        P  +S+  S D + L     D  I++W
Sbjct: 260 IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVW 313

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 48/117 (41%), Gaps = 9/117 (7%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDP--------TGTRL 132
           L   P+  L+A    DG I +W+L +K  +   +      + L F P        T T +
Sbjct: 202 LTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS-LAFSPNRYWLAAATATGI 260

Query: 133 ISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKT 189
              S D   ++ DL  E   Y   +   +++  W  +   L +   D +I++W + T
Sbjct: 261 KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 104/235 (44%), Gaps = 21/235 (8%)

Query: 453 LASSTLLENKEDAHGAAIWSLDL-TSDGKR--LVTGSADKTVKFWDFKVDQELIPGTVDK 509
           +AS+ +L  +    G   W   L TS G+   L++ S DKT+  W    D +     V  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 510 FVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLP 569
           F     I  D TL           ++D  +   +  D T++++ + + + +    GHK  
Sbjct: 61  FKGHSHIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 570 VLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVP------ESHN 623
           V+S+DI   + ++I+ S DK IK+W +  G C  +L  H D +  V+ VP      +S  
Sbjct: 110 VMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVT 168

Query: 624 FFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             S   D +VK W+ ++F+       H S +  L  S D   + S   D  I +W
Sbjct: 169 IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 67/147 (45%), Gaps = 10/147 (6%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++WD+ +      F GHKS +  +  D   + +ISGS+D  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDSITGIWC-------ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAI 208
             H D ++ +         ++   +IS   D ++K W+L   Q     + H S    L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 209 HND--LVITTSTESQIKIWNLDLDKDM 233
             D  L+ +   + +I +WNL   K M
Sbjct: 205 SPDGTLIASAGKDGEIMLWNLAAKKAM 231

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D ++K W+L    +  +F GH S I  L   P GT + S  KD +I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 156 RSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
            +  +  +  +  N  WL + +  G IK++ L  Q  V+
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 91/209 (43%), Gaps = 25/209 (11%)

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LT+DG   ++ S DKT++ WD    +     T  +FV               D+++V I 
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGE-----TYQRFVGH-----------KSDVMSVDID 116

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI------SFDSKLLITSSAD 588
                +     D T+KV+ +   +   +L GH   V  + +        DS  +I++  D
Sbjct: 117 KKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGND 175

Query: 589 KNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLA 648
           K +K W L+          H  +I ++   P+     S  KDG +  W+    + +  L+
Sbjct: 176 KMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLS 235

Query: 649 AHQSEVWALAISNDARFVVSTSHDHSIRV 677
           A Q EV++LA S + R+ ++ +    I+V
Sbjct: 236 A-QDEVFSLAFSPN-RYWLAAATATGIKV 262

 Score = 38.5 bits (88), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 10/126 (7%)

Query: 112 NFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE- 170
           +F GH   +        G   +S S D  + +WD+       +   HK  +  +  + + 
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 171 DWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHND--------LVITTSTESQI 222
             +IS S+D  IK+W +K  QC+ T + H      + +  +         +I+   +  +
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMV 178

Query: 223 KIWNLD 228
           K WNL+
Sbjct: 179 KAWNLN 184

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 46/234 (19%), Positives = 89/234 (38%), Gaps = 47/234 (20%)

Query: 383 GHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTF--ECGYALTCKFLPGG--- 436
           GH++DV S+DI     ++ + S + T+K+W IK   C+ T      +    + +P     
Sbjct: 105 GHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQ-CLATLLGHNDWVSQVRVVPNEKAD 163

Query: 437 ----ALVVVGN----RGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSAD 488
                ++  GN    +  +L  F + +  +       H + I +L  + DG  + +   D
Sbjct: 164 DDSVTIISAGNDKMVKAWNLNQFQIEADFI------GHNSNINTLTASPDGTLIASAGKD 217

Query: 489 KTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNT 548
             +  W+    + +                  TL   D++ ++  S +  +LA +     
Sbjct: 218 GEIMLWNLAAKKAMY-----------------TLSAQDEVFSLAFSPNRYWLAAATATG- 259

Query: 549 VKVFFLNSMKF-------FLSLYGHKLP-VLSIDISFDSKLLITSSADKNIKIW 594
           +KVF L+           F        P  +S+  S D + L     D  I++W
Sbjct: 260 IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVW 313

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 48/117 (41%), Gaps = 9/117 (7%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDP--------TGTRL 132
           L   P+  L+A    DG I +W+L +K  +   +      + L F P        T T +
Sbjct: 202 LTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS-LAFSPNRYWLAAATATGI 260

Query: 133 ISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKT 189
              S D   ++ DL  E   Y   +   +++  W  +   L +   D +I++W + T
Sbjct: 261 KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 104/235 (44%), Gaps = 21/235 (8%)

Query: 453 LASSTLLENKEDAHGAAIWSLDL-TSDGKR--LVTGSADKTVKFWDFKVDQELIPGTVDK 509
           +AS+ +L  +    G   W   L TS G+   L++ S DKT+  W    D +     V  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 510 FVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLP 569
           F     I  D TL           ++D  +   +  D T++++ + + + +    GHK  
Sbjct: 61  FKGHSHIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 570 VLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVP------ESHN 623
           V+S+DI   + ++I+ S DK IK+W +  G C  +L  H D +  V+ VP      +S  
Sbjct: 110 VMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVT 168

Query: 624 FFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             S   D +VK W+ ++F+       H S +  L  S D   + S   D  I +W
Sbjct: 169 IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 67/147 (45%), Gaps = 10/147 (6%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++WD+ +      F GHKS +  +  D   + +ISGS+D  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDSITGIWC-------ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAI 208
             H D ++ +         ++   +IS   D ++K W+L   Q     + H S    L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 209 HND--LVITTSTESQIKIWNLDLDKDM 233
             D  L+ +   + +I +WNL   K M
Sbjct: 205 SPDGTLIASAGKDGEIMLWNLAAKKAM 231

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D ++K W+L    +  +F GH S I  L   P GT + S  KD +I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 156 RSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
            +  +  +  +  N  WL + +  G IK++ L  Q  V+
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 91/209 (43%), Gaps = 25/209 (11%)

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LT+DG   ++ S DKT++ WD    +     T  +FV               D+++V I 
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGE-----TYQRFVGH-----------KSDVMSVDID 116

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI------SFDSKLLITSSAD 588
                +     D T+KV+ +   +   +L GH   V  + +        DS  +I++  D
Sbjct: 117 KKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGND 175

Query: 589 KNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLA 648
           K +K W L+          H  +I ++   P+     S  KDG +  W+    + +  L+
Sbjct: 176 KMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLS 235

Query: 649 AHQSEVWALAISNDARFVVSTSHDHSIRV 677
           A Q EV++LA S + R+ ++ +    I+V
Sbjct: 236 A-QDEVFSLAFSPN-RYWLAAATATGIKV 262

 Score = 38.5 bits (88), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 10/126 (7%)

Query: 112 NFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE- 170
           +F GH   +        G   +S S D  + +WD+       +   HK  +  +  + + 
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 171 DWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHND--------LVITTSTESQI 222
             +IS S+D  IK+W +K  QC+ T + H      + +  +         +I+   +  +
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMV 178

Query: 223 KIWNLD 228
           K WNL+
Sbjct: 179 KAWNLN 184

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 46/234 (19%), Positives = 89/234 (38%), Gaps = 47/234 (20%)

Query: 383 GHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTF--ECGYALTCKFLPGG--- 436
           GH++DV S+DI     ++ + S + T+K+W IK   C+ T      +    + +P     
Sbjct: 105 GHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQ-CLATLLGHNDWVSQVRVVPNEKAD 163

Query: 437 ----ALVVVGN----RGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSAD 488
                ++  GN    +  +L  F + +  +       H + I +L  + DG  + +   D
Sbjct: 164 DDSVTIISAGNDKMVKAWNLNQFQIEADFI------GHNSNINTLTASPDGTLIASAGKD 217

Query: 489 KTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNT 548
             +  W+    + +                  TL   D++ ++  S +  +LA +     
Sbjct: 218 GEIMLWNLAAKKAMY-----------------TLSAQDEVFSLAFSPNRYWLAAATATG- 259

Query: 549 VKVFFLNSMKF-------FLSLYGHKLP-VLSIDISFDSKLLITSSADKNIKIW 594
           +KVF L+           F        P  +S+  S D + L     D  I++W
Sbjct: 260 IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVW 313

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 48/117 (41%), Gaps = 9/117 (7%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDP--------TGTRL 132
           L   P+  L+A    DG I +W+L +K  +   +      + L F P        T T +
Sbjct: 202 LTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS-LAFSPNRYWLAAATATGI 260

Query: 133 ISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKT 189
              S D   ++ DL  E   Y   +   +++  W  +   L +   D +I++W + T
Sbjct: 261 KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 104/235 (44%), Gaps = 21/235 (8%)

Query: 453 LASSTLLENKEDAHGAAIWSLDL-TSDGKR--LVTGSADKTVKFWDFKVDQELIPGTVDK 509
           +AS+ +L  +    G   W   L TS G+   L++ S DKT+  W    D +     V  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 510 FVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLP 569
           F     I  D TL           ++D  +   +  D T++++ + + + +    GHK  
Sbjct: 61  FKGHSHIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 570 VLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVP------ESHN 623
           V+S+DI   + ++I+ S DK IK+W +  G C  +L  H D +  V+ VP      +S  
Sbjct: 110 VMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVT 168

Query: 624 FFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             S   D +VK W+ ++F+       H S +  L  S D   + S   D  I +W
Sbjct: 169 IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 67/147 (45%), Gaps = 10/147 (6%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++WD+ +      F GHKS +  +  D   + +ISGS+D  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDSITGIWC-------ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAI 208
             H D ++ +         ++   +IS   D ++K W+L   Q     + H S    L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 209 HND--LVITTSTESQIKIWNLDLDKDM 233
             D  L+ +   + +I +WNL   K M
Sbjct: 205 SPDGTLIASAGKDGEIMLWNLAAKKAM 231

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D ++K W+L    +  +F GH S I  L   P GT + S  KD +I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 156 RSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
            +  +  +  +  N  WL + +  G IK++ L  Q  V+
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 91/209 (43%), Gaps = 25/209 (11%)

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LT+DG   ++ S DKT++ WD    +     T  +FV               D+++V I 
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGE-----TYQRFVGH-----------KSDVMSVDID 116

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI------SFDSKLLITSSAD 588
                +     D T+KV+ +   +   +L GH   V  + +        DS  +I++  D
Sbjct: 117 KKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGND 175

Query: 589 KNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLA 648
           K +K W L+          H  +I ++   P+     S  KDG +  W+    + +  L+
Sbjct: 176 KMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLS 235

Query: 649 AHQSEVWALAISNDARFVVSTSHDHSIRV 677
           A Q EV++LA S + R+ ++ +    I+V
Sbjct: 236 A-QDEVFSLAFSPN-RYWLAAATATGIKV 262

 Score = 38.5 bits (88), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 10/126 (7%)

Query: 112 NFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE- 170
           +F GH   +        G   +S S D  + +WD+       +   HK  +  +  + + 
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 171 DWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHND--------LVITTSTESQI 222
             +IS S+D  IK+W +K  QC+ T + H      + +  +         +I+   +  +
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMV 178

Query: 223 KIWNLD 228
           K WNL+
Sbjct: 179 KAWNLN 184

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 46/234 (19%), Positives = 89/234 (38%), Gaps = 47/234 (20%)

Query: 383 GHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTF--ECGYALTCKFLPGG--- 436
           GH++DV S+DI     ++ + S + T+K+W IK   C+ T      +    + +P     
Sbjct: 105 GHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQ-CLATLLGHNDWVSQVRVVPNEKAD 163

Query: 437 ----ALVVVGN----RGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSAD 488
                ++  GN    +  +L  F + +  +       H + I +L  + DG  + +   D
Sbjct: 164 DDSVTIISAGNDKMVKAWNLNQFQIEADFI------GHNSNINTLTASPDGTLIASAGKD 217

Query: 489 KTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNT 548
             +  W+    + +                  TL   D++ ++  S +  +LA +     
Sbjct: 218 GEIMLWNLAAKKAMY-----------------TLSAQDEVFSLAFSPNRYWLAAATATG- 259

Query: 549 VKVFFLNSMKF-------FLSLYGHKLP-VLSIDISFDSKLLITSSADKNIKIW 594
           +KVF L+           F        P  +S+  S D + L     D  I++W
Sbjct: 260 IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVW 313

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 48/117 (41%), Gaps = 9/117 (7%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDP--------TGTRL 132
           L   P+  L+A    DG I +W+L +K  +   +      + L F P        T T +
Sbjct: 202 LTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS-LAFSPNRYWLAAATATGI 260

Query: 133 ISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKT 189
              S D   ++ DL  E   Y   +   +++  W  +   L +   D +I++W + T
Sbjct: 261 KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 123/294 (41%), Gaps = 39/294 (13%)

Query: 387 DVRSIDISDDNKLLATA-SNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRG 445
           D+  ++ SDD +L AT   +  +KIW++           G +L    LP      +   G
Sbjct: 481 DMSCLEFSDDCRLAATGFQDSFIKIWSLD----------GSSLVTNKLPSYKKEEILTTG 530

Query: 446 GDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPG 505
                 D  SS L+      H  A++S   + D K L++GS DKTV+ W       L+  
Sbjct: 531 ------DETSSLLI-----GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLV-- 577

Query: 506 TVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYG 565
                         +    N  +  VK S    + A +  D T +++  + +       G
Sbjct: 578 --------------SYKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAG 623

Query: 566 HKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFF 625
           H   V ++    +   + T SADK  ++W +  GD  +    H   +++    P+     
Sbjct: 624 HLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLC 683

Query: 626 SCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
           +  +DG++  WD    + ++++  H ++ + + + + +   ++S   DHS+RVW
Sbjct: 684 TGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVW 737

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 77/182 (42%), Gaps = 24/182 (13%)

Query: 517 FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLS-------------- 562
           FH+T    N D+  ++ S D +  A    D+ +K++ L+      +              
Sbjct: 475 FHNT----NKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEILTTG 530

Query: 563 ------LYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVK 616
                 L GH   V S   S D+K L++ S DK +++W +D      S   H   +  VK
Sbjct: 531 DETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVK 590

Query: 617 FVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIR 676
           F P  H F + S D   + W  D    ++  A H ++V  ++   +  +V + S D + R
Sbjct: 591 FSPMGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCR 650

Query: 677 VW 678
           +W
Sbjct: 651 MW 652

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 109/287 (37%), Gaps = 71/287 (24%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCKFLPGGALV 439
           L GH   V S   S DNK L + S + T+++W++ TH  + +++                
Sbjct: 537 LIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYK---------------- 580

Query: 440 VVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVD 499
                                     H   +W +  +  G    T S D+T + W     
Sbjct: 581 -------------------------GHNHPVWDVKFSPMGHYFATASHDQTARLW----- 610

Query: 500 QELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL---NS 556
                 + D   P L+IF      LN D+  V    +  ++     D T +++ +   +S
Sbjct: 611 ------SCDHIYP-LRIFAG---HLN-DVETVSFHPNGCYVFTGSADKTCRMWDISTGDS 659

Query: 557 MKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMSV 615
           ++ FL   GH  PVL+  ++ D + L T   D  I +W +  G   K +  H +++I S 
Sbjct: 660 VRLFL---GHTAPVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSF 716

Query: 616 KFVPESHNFFSCSKDGLVKYWDGDK------FECVQKLAAHQSEVWA 656
            F  E +   S   D  V+ WD  K       E  Q  A +  +V A
Sbjct: 717 SFNKEGNILISGGADHSVRVWDLKKATPEPSAEPEQPFAGYVGDVTA 763

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 66/154 (42%), Gaps = 3/154 (1%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L  G  D  +++W + + T L+++ GH   +  ++F P G    + S D    
Sbjct: 549 FSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTAR 608

Query: 143 IWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS 201
           +W       L     H + +  + +  N  ++ + S D   ++WD+ T   V   + HT+
Sbjct: 609 LWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTA 668

Query: 202 ECWGLAIHND--LVITTSTESQIKIWNLDLDKDM 233
                A+  D   + T   +  I +W++   K +
Sbjct: 669 PVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKRL 702

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 78/194 (40%), Gaps = 14/194 (7%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
             GH  DV ++    +   + T S + T ++W+I T   +R F       LT    P G 
Sbjct: 621 FAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGR 680

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +  G   G + ++D+ +   L+        AI S     +G  L++G AD +V+ WD K
Sbjct: 681 WLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

Query: 498 VDQELIPGTVDKFVPKLKIFHDTTLELNDDI------LAVKISSDNKFLAVSLLDNTVKV 551
             +     + +   P      D T  +N DI       A+  +SD   L  S       V
Sbjct: 741 --KATPEPSAEPEQPFAGYVGDVTASVNQDIKEFGRRRAIVPTSD---LVASFFTKKTPV 795

Query: 552 FFLNSMKFFLSLYG 565
           F +   +  L+L G
Sbjct: 796 FNVKFTRTNLALAG 809

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    +  G AD   ++WD+ +   +  F GH + +      P G  L +G +D  
Sbjct: 631 VSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGV 690

Query: 141 IIIWDLVGEVGLYKLRSH-KDSITGIWCENE-DWLISTSKDGLIKIWDLK 188
           I +WD+     L ++R H K++I       E + LIS   D  +++WDLK
Sbjct: 691 INVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 67/155 (43%), Gaps = 12/155 (7%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +++ P  +  A    D   ++W       L  F GH + +  + F P G  + +GS D  
Sbjct: 589 VKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKT 648

Query: 141 IIIWDLVGEVGLYKLRSHKDSI-TGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +WD+     +     H   + T     +  WL +  +DG+I +WD+ T + ++    H
Sbjct: 649 CRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKRLKQMRGH 708

Query: 200 TSECWGLAIHN-------DLVITTSTESQIKIWNL 227
                  AIH+       +++I+   +  +++W+L
Sbjct: 709 GKN----AIHSFSFNKEGNILISGGADHSVRVWDL 739

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 65/170 (38%), Gaps = 23/170 (13%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLIN--------------------FNGHKSAI 120
           L++  +  L A G+ D  IKIW L   +++ N                      GH  A+
Sbjct: 485 LEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEILTTGDETSSLLIGHSGAV 544

Query: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKD 179
               F P    L+SGS+D  + +W +     L   + H   +  + +     +  + S D
Sbjct: 545 YSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHD 604

Query: 180 GLIKIWDLKTQQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
              ++W       +     H ++   ++ H +   V T S +   ++W++
Sbjct: 605 QTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDI 654

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 127/305 (41%), Gaps = 42/305 (13%)

Query: 376 LYTIELQGHRTDVRSIDISDDNKLLATA-SNGTLKIWNIKTHACIRTFECGYALTCKFLP 434
           +YT   Q    D+  +D SDD ++ A    +  +KIW++           G +L      
Sbjct: 459 MYT--FQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLD----------GSSLNNP--- 503

Query: 435 GGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFW 494
                +V N   + +  D    TL+      H   ++S   + D K L++GS DKTV+ W
Sbjct: 504 ----NIVLNNETNYKDDDPTCKTLV-----GHSGTVYSTSFSPDNKYLLSGSEDKTVRLW 554

Query: 495 DFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL 554
                  L+                +    N  +  V  S    + A +  D T +++  
Sbjct: 555 SMDTHTALV----------------SYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSC 598

Query: 555 NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMS 614
           + +       GH   V  +    +   L T S+DK  ++W +  GD  +    H   ++S
Sbjct: 599 DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVIS 658

Query: 615 VKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDH 673
           +   P+     + S+DG++  WD    + ++++  H ++ +++L+ S +   ++S   DH
Sbjct: 659 IAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADH 718

Query: 674 SIRVW 678
           S+RVW
Sbjct: 719 SVRVW 723

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 68/157 (43%), Gaps = 9/157 (5%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L  G  D  +++W + + T L+++ GH   +  + F P G    + S D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           +W       +Y LR     +  + C     N  +L + S D   ++W++ T   V   + 
Sbjct: 595 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLG 651

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDM 233
           HT+    +A+  D   + T S +  I +W++   K +
Sbjct: 652 HTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRL 688

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 5/151 (3%)

Query: 381 LQGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
             GH  DV  +    +   L T +S+ T ++WN+ T   +R F       ++    P G 
Sbjct: 607 FAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGR 666

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +  G+  G + ++D+ +   L+        AI+SL  + +G  L++G AD +V+ WD K
Sbjct: 667 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

Query: 498 VDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
             +     + +   P +    D T  +N DI
Sbjct: 727 --KATTEPSAEPDEPFIGYLGDVTASINQDI 755

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    L  G +D   ++W++ +   +  F GH + +  +   P G  L +GS+D  
Sbjct: 617 VSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGI 676

Query: 141 IIIWDLVGEVGLYKLRSH-KDSITGI-WCENEDWLISTSKDGLIKIWDLK 188
           I +WD+     L ++R H K++I  + + +  + LIS   D  +++WDLK
Sbjct: 677 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 66/151 (43%), Gaps = 4/151 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + + P  +  A    D   ++W       L  F GH + +  + F P G  L +GS D  
Sbjct: 575 VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKT 634

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +W++     +     H   +  I    +  WL + S+DG+I +WD+ T + ++    H
Sbjct: 635 CRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 694

Query: 200 TSEC-WGLAI--HNDLVITTSTESQIKIWNL 227
                + L+     +++I+   +  +++W+L
Sbjct: 695 GKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 64/170 (37%), Gaps = 24/170 (14%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFN--------------------GHKSAI 120
           L +  +  + A G+ D  IKIW L   + L N N                    GH   +
Sbjct: 472 LDFSDDCRVAAAGFQDSYIKIWSL-DGSSLNNPNIVLNNETNYKDDDPTCKTLVGHSGTV 530

Query: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKD 179
               F P    L+SGS+D  + +W +     L   + H   +  + +     +  + S D
Sbjct: 531 YSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHD 590

Query: 180 GLIKIWDLKTQQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
              ++W       +     H ++   ++ H +   + T S++   ++WN+
Sbjct: 591 QTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNV 640

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 98/228 (42%), Gaps = 20/228 (8%)

Query: 458 LLENKEDAHGAAIWSLDLTSDGKR--LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLK 515
           +L    + H   + SL  TS G+   L++GS DKT+  W    D +     V  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 IFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI 575
           I  D TL           + D  +   +  D T++++ + + + +    GHK  V+S+ I
Sbjct: 67  IVQDCTL-----------TQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 576 SFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN-----FFSCSKD 630
              + ++I+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   D
Sbjct: 116 DRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGND 174

Query: 631 GLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            +VK W+ ++F+       H   V A+  S D   + S   D  I +W
Sbjct: 175 KMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLW 222

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 93/208 (44%), Gaps = 24/208 (11%)

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LT DG   ++ S DKT++ WD    +     T  +FV               D+++V I 
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGE-----TYQRFVGH-----------KSDVMSVAID 116

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH-----KLPVLSIDISFDSKLLITSSADK 589
                +     D T+KV+ +   +   +L GH     ++ +   D + D+  +I++  DK
Sbjct: 117 RKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDK 175

Query: 590 NIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAA 649
            +K W L+          H  ++ +V   P+     S  KDG +  W+  + + +  L+A
Sbjct: 176 MVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSA 235

Query: 650 HQSEVWALAISNDARFVVSTSHDHSIRV 677
            Q EV++LA S + R+ ++ +    I++
Sbjct: 236 -QDEVFSLAFSPN-RYWLAAATASGIKI 261

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 9/146 (6%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++WD+ +      F GHKS +  +  D   + +ISGS+D  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDSITGIWC----ENEDW--LISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH 209
             H D ++ +      +N+D   +IS   D ++K W+L   Q     + H      +   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 210 ND--LVITTSTESQIKIWNLDLDKDM 233
            D  L+ +   + +I +WNL   K M
Sbjct: 205 PDGTLIASAGKDGEIMLWNLAEKKAM 230

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D ++K W+L    +  +F GH   +  +   P GT + S  KD +I++W+L  +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 156 RSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
            +  +  +  +  N  WL + +  G IKI+ L  Q  ++
Sbjct: 234 SAQDEVFSLAFSPNRYWLAAATASG-IKIFCLDPQSLID 271

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 63/134 (47%), Gaps = 14/134 (10%)

Query: 104 LISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGE-----VGLYKLRSH 158
           L+ +  L   NG  +++      P    L+SGS+D  +I W L G+     V +   + H
Sbjct: 7   LVLRGTLEGHNGWVTSLATSAGQPN--LLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGH 64

Query: 159 KDSITGIWC---ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHN--DLV 213
              +    C   ++  + +S S D  +++WD+ T +  +  + H S+   +AI     ++
Sbjct: 65  SHIVQD--CTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMI 122

Query: 214 ITTSTESQIKIWNL 227
           I+ S +  IK+W +
Sbjct: 123 ISGSRDKTIKVWTI 136

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 113/278 (40%), Gaps = 46/278 (16%)

Query: 380 ELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGY---ALTCKFLPG 435
             +GH   V+   ++ D     +AS + TL++W++ T    + F  G+    ++      
Sbjct: 60  SFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRF-VGHKSDVMSVAIDRK 118

Query: 436 GALVVVGNRGGDLQLFDLAS---STLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
            ++++ G+R   ++++ +     +TLL + +      I   D   D   +++   DK VK
Sbjct: 119 ASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVK 178

Query: 493 FWD---FKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTV 549
            W+   F+++ + +              H      N ++ AV  S D   +A +  D  +
Sbjct: 179 AWNLNQFQIEADFVG-------------H------NGNVNAVTASPDGTLIASAGKDGEI 219

Query: 550 KVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD-----------F 598
            ++ L   K   +L      V S+  S +   L  ++A   IKI+ LD           F
Sbjct: 220 MLWNLAEKKAMYTLSAQD-EVFSLAFSPNRYWLAAATA-SGIKIFCLDPQSLIDDLRPEF 277

Query: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYW 636
              +KS   H    +S+ +  +    F+   D +++ W
Sbjct: 278 AGYNKSAEPHA---VSLAWSADGQTLFAGYTDSVIRVW 312

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 45/113 (39%), Gaps = 9/113 (7%)

Query: 85  PETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSK------- 137
           P+  L+A    DG I +W+L  K  +   +      + L F P    L + +        
Sbjct: 205 PDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFS-LAFSPNRYWLAAATASGIKIFC 263

Query: 138 -DSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKT 189
            D   +I DL  E   Y   +   +++  W  +   L +   D +I++W + T
Sbjct: 264 LDPQSLIDDLRPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQVMT 316

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 85/374 (22%), Positives = 142/374 (37%), Gaps = 84/374 (22%)

Query: 371 PAPNKLYTIELQG---HRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIRTFECG-- 425
           PA  +   +EL     H + V  +  S+D + LAT  N T +I+ + T   I        
Sbjct: 292 PALPRNLDVELHASLDHSSVVCCVKFSNDGEYLATGCNKTSQIYKVSTGELIAKLSDDNA 351

Query: 426 ---------------------------------YALTCKFLPGGALVVVGNRGGDLQLFD 452
                                            Y  +  F P G  +  G     ++++D
Sbjct: 352 NSAVSSNNNDQNAPANVNGANANSGNNTNSNDLYIRSVCFSPDGKFLATGAEDKLIRIWD 411

Query: 453 LASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVP 512
           +    ++   +  H   ++SLD    G +LV+GS D+TV+ WD K  Q  +         
Sbjct: 412 IQQRKIVMVLQ-GHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSL--------- 461

Query: 513 KLKIFHDTTLELNDDILAVKIS-SDNKFLAVSLLDNTVKV------FFLNSMKFFLSL-Y 564
                   TL + D +  V +S  D KF+A   LD  V+V      F +  +     L  
Sbjct: 462 --------TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGT 513

Query: 565 GHKLPVLSIDISFDSKLLITSSADKNIKIWGL--------------DFGDCHKSLFAHQD 610
           GHK  V S+  + D   +++ S D+++K+W L                  C  +   H+D
Sbjct: 514 GHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKSNATCDVTYVGHKD 573

Query: 611 SIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDA------R 664
            ++SV          S SKD  V +WD      +  L  H++ V ++A++N        +
Sbjct: 574 FVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANRTPLGPKYQ 633

Query: 665 FVVSTSHDHSIRVW 678
              + S D   R+W
Sbjct: 634 VFATGSGDCRARIW 647

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 77/157 (49%), Gaps = 14/157 (8%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+  + +++   GH   +  L + P+G +L+SGS D  + 
Sbjct: 391 FSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVR 450

Query: 143 IWDL-VGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQCVET---- 195
           IWDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   VE     
Sbjct: 451 IWDLKTGQCSL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSE 508

Query: 196 ---HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
                 H    + +    D   V++ S +  +K+WNL
Sbjct: 509 NELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL 545

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 96/232 (41%), Gaps = 59/232 (25%)

Query: 33  SAGQILTGALE-NVNCWDIKTGELSKILT--DGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  ++++G+ +  V  WD+KTG+ S  L+  DG+   AV     K               
Sbjct: 436 SGDKLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKF-------------- 481

Query: 90  LAVGYADGVIKIWDLISKTVLINFN-------GHKSAITVLRFDPTGTRLISGSKDSDII 142
           +A G  D  +++WD  +  ++   +       GHK ++  + F   G +++SGS D  + 
Sbjct: 482 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVK 541

Query: 143 IWDL--------------------VGEVGLYKLRSHKDSITGIWC-ENEDWLISTSKDGL 181
           +W+L                    V  VG      HKD +  +    N+++++S SKD  
Sbjct: 542 LWNLRDNNANSSSNNSNKSNATCDVTYVG------HKDFVLSVTTTANDEYILSGSKDRG 595

Query: 182 IKIWDLKTQQCVETHMAHTSECWGLAIHN--------DLVITTSTESQIKIW 225
           +  WD K+   +     H +    +A+ N         +  T S + + +IW
Sbjct: 596 VLFWDTKSGNPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIW 647

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 118/296 (39%), Gaps = 61/296 (20%)

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTG 485
           Y  +  F P G  +  G     ++++D+    ++    + H   I+SLD    G ++V+G
Sbjct: 368 YIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVM-ILNGHEQDIYSLDYFPSGDKIVSG 426

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLL 545
           S D+TV+ WD    Q L+                 TL + D +  V +S D KF+A   L
Sbjct: 427 SGDRTVRIWDLNTGQCLL-----------------TLSIEDGVTTVAVSPDGKFIAAGSL 469

Query: 546 DNTVKV------FFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGL--- 596
           D  V+V      F +  +       GH+  V S+  + D K +++ S DK +K+W L   
Sbjct: 470 DRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQ 529

Query: 597 ----------------------------DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCS 628
                                       +   C  +   H+D ++SV    +     S S
Sbjct: 530 TTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGS 589

Query: 629 KDGLVKYWDGDKFECVQKLAAHQSEVWALAISN------DARFVVSTSHDHSIRVW 678
           KD  V +WD      +  L  H++ V ++A++N      +     + S D   R+W
Sbjct: 590 KDRSVLFWDTKSGNPLLMLQGHRNSVISVAVANGIPLGPNYGIFATGSGDCKARIW 645

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 124/270 (45%), Gaps = 42/270 (15%)

Query: 381 LQGHRTDVRSID-ISDDNKLLATASNGTLKIWNIKTHACIRTFECGYALTCKFL-PGGAL 438
           L GH  D+ S+D     +K+++ + + T++IW++ T  C+ T      +T   + P G  
Sbjct: 404 LNGHEQDIYSLDYFPSGDKIVSGSGDRTVRIWDLNTGQCLLTLSIEDGVTTVAVSPDGKF 463

Query: 439 VVVGNRGGDLQLFDLASSTLLENKED-----AHGAAIWSLDLTSDGKRLVTGSADKTVKF 493
           +  G+    ++++D  +  L+E  +       H  +++S+  T DGK +V+GS DKTVK 
Sbjct: 464 IAAGSLDRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKL 523

Query: 494 WDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFF 553
           W+ K                       T   ND   A KI+ ++     S LD+ +    
Sbjct: 524 WNLK---------------------QQTTSSND---ASKINQNSN----SHLDSKINKSN 555

Query: 554 LNSMKFFLSLY-GHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSI 612
            N+       Y GHK  VLS+  + D +++++ S D+++  W    G+    L  H++S+
Sbjct: 556 NNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGSKDRSVLFWDTKSGNPLLMLQGHRNSV 615

Query: 613 MSVKF---VPESHN---FFSCSKDGLVKYW 636
           +SV     +P   N   F + S D   + W
Sbjct: 616 ISVAVANGIPLGPNYGIFATGSGDCKARIW 645

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 77/154 (50%), Gaps = 10/154 (6%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   LA G  D +I+IWD+  K +++  NGH+  I  L + P+G +++SGS D  + 
Sbjct: 374 FSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSGDRTVR 433

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST-SKDGLIKIWDLKTQQCVET------ 195
           IWDL     L  L S +D +T +    +   I+  S D  +++WD +T   VE       
Sbjct: 434 IWDLNTGQCLLTL-SIEDGVTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVERLDSNEL 492

Query: 196 HMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
              H    + +    D   V++ S +  +K+WNL
Sbjct: 493 GTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNL 526

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 1/111 (0%)

Query: 568 LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
           L + S+  S D K L T + D+ I+IW +        L  H+  I S+ + P      S 
Sbjct: 367 LYIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSG 426

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           S D  V+ WD +  +C+  L+  +  V  +A+S D +F+ + S D ++RVW
Sbjct: 427 SGDRTVRIWDLNTGQCLLTLSI-EDGVTTVAVSPDGKFIAAGSLDRAVRVW 476

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 58/119 (48%), Gaps = 12/119 (10%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L Y P  + +  G  D  ++IWDL +   L+  +  +  +T +   P G  + +GS D  
Sbjct: 414 LDYFPSGDKIVSGSGDRTVRIWDLNTGQCLLTLS-IEDGVTTVAVSPDGKFIAAGSLDRA 472

Query: 141 IIIWDLVGEVGLYKLR--------SHKDSI-TGIWCENEDWLISTSKDGLIKIWDLKTQ 190
           + +WD   E G    R         H+DS+ + ++ ++   ++S S D  +K+W+LK Q
Sbjct: 473 VRVWD--AETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQ 529

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/250 (20%), Positives = 97/250 (38%), Gaps = 64/250 (25%)

Query: 33  SAGQILTGALE-NVNCWDIKTGE--LSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNL 89
           S  +I++G+ +  V  WD+ TG+  L+  + DG+               T +   P+   
Sbjct: 419 SGDKIVSGSGDRTVRIWDLNTGQCLLTLSIEDGV---------------TTVAVSPDGKF 463

Query: 90  LAVGYADGVIKIWDLISKTVLINFN------GHKSAITVLRFDPTGTRLISGSKDSDIII 143
           +A G  D  +++WD  +  ++   +      GH+ ++  + F   G  ++SGS D  + +
Sbjct: 464 IAAGSLDRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKL 523

Query: 144 WDLVGEVGLYKLRS-------------------------------HKDSITGIWCENEDW 172
           W+L  +       S                               HKD +  +   N+D 
Sbjct: 524 WNLKQQTTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQ 583

Query: 173 LI-STSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVI--------TTSTESQIK 223
           +I S SKD  +  WD K+   +     H +    +A+ N + +        T S + + +
Sbjct: 584 MILSGSKDRSVLFWDTKSGNPLLMLQGHRNSVISVAVANGIPLGPNYGIFATGSGDCKAR 643

Query: 224 IWNLDLDKDM 233
           IW   L  D+
Sbjct: 644 IWKYKLLGDI 653

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 99/454 (21%), Positives = 180/454 (39%), Gaps = 104/454 (22%)

Query: 67  AVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFD 126
           A+   S+ +  ST+  +   ++ +  G  D   +IWD  ++T +    GH + +  + + 
Sbjct: 165 AIAGHSSTILCSTFAPH--TSSRMVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVAWS 222

Query: 127 PTGTRLISGSKDSDIIIWDL-VGEVGLYKLRSHKDSITGIWCE--------NEDWLISTS 177
             G  + +GS D+ I +WD   G+     LR H   IT +  E        N+  + S S
Sbjct: 223 ADGEVIATGSMDNTIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASAS 282

Query: 178 KDGLIKIWDLKTQQCVETHMAHTSEC----WGLAIHNDLVITTSTESQIKIWNLDLDKDM 233
           KDG IK+WD   +QC+ T   HTS      WG      ++ T S +  I+ W    D + 
Sbjct: 283 KDGTIKVWDTVRRQCILTLSGHTSSVSCIKWG---GQGVIYTGSHDRTIRCW----DMNA 335

Query: 234 GSKLIEKGIYEKQS---KQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISK-A 289
           G K I   I +  +       +S ++       +  Y + A          T EE  K A
Sbjct: 336 GGKCIN--ILKSHAHWVNHLSLSTDYALKVGAFDHTYSRPA----------TAEEAQKRA 383

Query: 290 LRKREKRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVL 349
           L+  EK  +  G+ +                                         E++ 
Sbjct: 384 LKNYEKVAKRNGVLE-----------------------------------------ELIA 402

Query: 350 TTSNNTVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTL 408
           T S++   Y   P +  +P            + GH+  V  +  S D + + +AS + ++
Sbjct: 403 TASDDFTMYLWNPLKGTKP---------LTRMTGHQKLVNHVAFSPDGRYIVSASFDNSI 453

Query: 409 KIWNIKTHACIRTF--------ECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLE 460
           K+W   +   I TF        +  ++  C+ L      V  ++   L+++D+ +  L  
Sbjct: 454 KLWEGSSGKFISTFRGHVASVYQVAWSSDCRLL------VSCSKDTTLKVWDVRTRKLAV 507

Query: 461 NKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFW 494
           +    H   ++++D ++DGK + +G  DK V+ W
Sbjct: 508 DLP-GHNDEVYTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 133/309 (43%), Gaps = 31/309 (10%)

Query: 381 LQGHRTDVRSID------ISDDNK-LLATAS-NGTLKIWNIKTHACIRTFECGY--ALTC 430
           L+GH   + S+       ++  NK  +A+AS +GT+K+W+     CI T   G+  +++C
Sbjct: 252 LRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQCILTLS-GHTSSVSC 310

Query: 431 KFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT 490
               G  ++  G+    ++ +D+ +     N   +H   +  L L++D   L  G+ D T
Sbjct: 311 IKWGGQGVIYTGSHDRTIRCWDMNAGGKCINILKSHAHWVNHLSLSTD-YALKVGAFDHT 369

Query: 491 VKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVK 550
                        P T ++   +    ++   + N  +         + +A +  D T+ 
Sbjct: 370 YSR----------PATAEEAQKRALKNYEKVAKRNGVL--------EELIATASDDFTMY 411

Query: 551 VF-FLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQ 609
           ++  L   K    + GH+  V  +  S D + ++++S D +IK+W    G    +   H 
Sbjct: 412 LWNPLKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWEGSSGKFISTFRGHV 471

Query: 610 DSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVST 669
            S+  V +  +     SCSKD  +K WD    +    L  H  EV+ +  S D + V S 
Sbjct: 472 ASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLAVDLPGHNDEVYTVDWSADGKSVCSG 531

Query: 670 SHDHSIRVW 678
             D  +R+W
Sbjct: 532 GKDKMVRLW 540

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 64/141 (45%), Gaps = 9/141 (6%)

Query: 546 DNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCH-KS 604
           DN  +++  ++     +L GH   VL +  S D +++ T S D  I++W    GD    +
Sbjct: 192 DNNARIWDCDTQTPIYTLKGHTNWVLCVAWSADGEVIATGSMDNTIRLWDAQTGDSKGDA 251

Query: 605 LFAHQDSIMSVKFVP-------ESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 657
           L  H   I S+ + P             S SKDG +K WD  + +C+  L+ H S V  +
Sbjct: 252 LRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQCILTLSGHTSSVSCI 311

Query: 658 AISNDARFVVSTSHDHSIRVW 678
                   + + SHD +IR W
Sbjct: 312 KWGGQG-VIYTGSHDRTIRCW 331

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 91/227 (40%), Gaps = 33/227 (14%)

Query: 32  GSAGQILTGALE-NVNCWDIKTG---------------ELSKILTDGLPPGAVDAKSTKL 75
           G  G I TG+ +  + CWD+  G                LS      L  GA D   ++ 
Sbjct: 314 GGQGVIYTGSHDRTIRCWDMNAGGKCINILKSHAHWVNHLSLSTDYALKVGAFDHTYSRP 373

Query: 76  AESTYLQYHPETNLLAVGYADGVIK-------------IWDLISKT-VLINFNGHKSAIT 121
           A +   Q     N   V   +GV++             +W+ +  T  L    GH+  + 
Sbjct: 374 ATAEEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVN 433

Query: 122 VLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDG 180
            + F P G  ++S S D+ I +W+      +   R H  S+  + W  +   L+S SKD 
Sbjct: 434 HVAFSPDGRYIVSASFDNSIKLWEGSSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDT 493

Query: 181 LIKIWDLKTQQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIW 225
            +K+WD++T++       H  E + +    D   V +   +  +++W
Sbjct: 494 TLKVWDVRTRKLAVDLPGHNDEVYTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/293 (20%), Positives = 116/293 (39%), Gaps = 52/293 (17%)

Query: 428 LTCKFLP-GGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGS 486
           L   F P   + +V G+   + +++D  + T +   +  H   +  +  ++DG+ + TGS
Sbjct: 174 LCSTFAPHTSSRMVTGSGDNNARIWDCDTQTPIYTLK-GHTNWVLCVAWSADGEVIATGS 232

Query: 487 ADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLD 546
            D T++ WD +        T D     L+        ++ + + +    +   +A +  D
Sbjct: 233 MDNTIRLWDAQ--------TGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKD 284

Query: 547 NTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD-CHKSL 605
            T+KV+     +  L+L GH   V  I       ++ T S D+ I+ W ++ G  C   L
Sbjct: 285 GTIKVWDTVRRQCILTLSGHTSSVSCIKWG-GQGVIYTGSHDRTIRCWDMNAGGKCINIL 343

Query: 606 FAHQDSI--------MSVKFVPESHNF-------------------------------FS 626
            +H   +         ++K     H +                                +
Sbjct: 344 KSHAHWVNHLSLSTDYALKVGAFDHTYSRPATAEEAQKRALKNYEKVAKRNGVLEELIAT 403

Query: 627 CSKDGLVKYWDGDK-FECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            S D  +  W+  K  + + ++  HQ  V  +A S D R++VS S D+SI++W
Sbjct: 404 ASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW 456

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 102/216 (47%), Gaps = 18/216 (8%)

Query: 465 AHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLEL 524
            H   +  + L   GK L + S D T + WD +  +E++          L+  H      
Sbjct: 273 GHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEIL----------LQEGH------ 316

Query: 525 NDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLIT 584
           + +I ++   +D    A +  D+   ++ L S K  ++L GH  P+ S+D + +   L T
Sbjct: 317 SKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLAT 376

Query: 585 SSADKNIKIWGLDFGDCH-KSLFAHQDSIMSVKFVPESHNF-FSCSKDGLVKYWDGDKFE 642
            S D  IKIW L   + +  S+FAH++ + SV++   +  F FS   D L+K  D   +E
Sbjct: 377 GSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYE 436

Query: 643 CVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            V  L  H  ++  L  S  +  +VS+  D ++++W
Sbjct: 437 SVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIW 472

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 78/153 (50%), Gaps = 5/153 (3%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L +H + +L A    D +  IWDL S   ++N  GH   I  L + P G +L +GS D  
Sbjct: 323 LAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGT 382

Query: 141 IIIWDLVG-EVGLYKLRSHKDSITGIWCE--NEDWLISTSKDGLIKIWDLKTQQCVETHM 197
           I IWDL   E     + +HK+ +T +  E  N  ++ S   D LIKI D KT + V T  
Sbjct: 383 IKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYESVATLE 442

Query: 198 AHTSECWGLAIH--NDLVITTSTESQIKIWNLD 228
            HT +   L     ++L++++  +  +KIW+ D
Sbjct: 443 GHTEKILTLDTSPISNLIVSSGWDRTVKIWDND 475

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 102/251 (40%), Gaps = 18/251 (7%)

Query: 430 CKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADK 489
            K  P   L+  G+  G + + D  +     + + AH   I  ++ ++D   L TG  D 
Sbjct: 194 VKLAPQSKLLASGSWDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDC 253

Query: 490 TVKFWDF-KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNT 548
            VK + + K D   I               DT       +  VK+    K+L  S  DNT
Sbjct: 254 LVKVFGYEKNDLTSI---------------DTLKGHQGRVSDVKLHPLGKYLGSSSFDNT 298

Query: 549 VKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAH 608
            +++ +   K  L   GH   + S+    D  L  T+  D    IW L  G    +L  H
Sbjct: 299 WRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGH 358

Query: 609 QDSIMSVKFVPESHNFFSCSKDGLVKYWD-GDKFECVQKLAAHQSEVWALAIS-NDARFV 666
              I S+ + P  +   + S DG +K WD  +K      + AH++ V ++    N+  FV
Sbjct: 359 AKPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFV 418

Query: 667 VSTSHDHSIRV 677
            S  +D  I++
Sbjct: 419 FSAGYDKLIKI 429

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 103/229 (44%), Gaps = 21/229 (9%)

Query: 374 NKLYTIE-LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNI--KTHACIRTFECGYALT 429
           N L +I+ L+GH+  V  + +    K L ++S + T ++W+I  K    ++        +
Sbjct: 263 NDLTSIDTLKGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFS 322

Query: 430 CKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADK 489
             F   G+L           ++DL S   + N    H   I+SLD   +G +L TGS D 
Sbjct: 323 LAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLI-GHAKPIYSLDWAPNGYQLATGSGDG 381

Query: 490 TVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNK-FLAVSLLDNT 548
           T+K WD +          +K      IF    L     + +V+   +N  F+  +  D  
Sbjct: 382 TIKIWDLR----------NKESNCASIFAHKNL-----VTSVQYEKNNGGFVFSAGYDKL 426

Query: 549 VKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD 597
           +K+    + +   +L GH   +L++D S  S L+++S  D+ +KIW  D
Sbjct: 427 IKIHDSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWDND 475

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 82/201 (40%), Gaps = 12/201 (5%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           ++ HP    L     D   ++WD+  K  ++   GH   I  L F   G+   +   DS 
Sbjct: 281 VKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSI 340

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
            +IWDL     +  L  H   I  + W  N   L + S DG IKIWDL+ ++        
Sbjct: 341 GMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKE-------- 392

Query: 200 TSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSVEFIT- 258
            S C  +  H +LV +   E     +      D   K+ +   YE  +   G + + +T 
Sbjct: 393 -SNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYESVATLEGHTEKILTL 451

Query: 259 -TSDGVNFFYIQNADKTVEIF 278
            TS   N       D+TV+I+
Sbjct: 452 DTSPISNLIVSSGWDRTVKIW 472

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 110/269 (40%), Gaps = 34/269 (12%)

Query: 50  IKTGELSKILTDGLPPGAVD-AKSTKLAESTYLQ-----------YHPETNLLAVGYADG 97
           +K    SK+L  G   GA+    +  L   T+ Q           +  +   L  G  D 
Sbjct: 194 VKLAPQSKLLASGSWDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDC 253

Query: 98  VIKIW-----DLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGL 152
           ++K++     DL S   L    GH+  ++ ++  P G  L S S D+   +WD+  +  +
Sbjct: 254 LVKVFGYEKNDLTSIDTL---KGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEI 310

Query: 153 YKLRSHKDSITGIWCENEDWLISTSK-DGLIKIWDLKTQQCVETHMAHTSECWGL--AIH 209
                H   I  +    +  L +T+  D +  IWDL++ + +   + H    + L  A +
Sbjct: 311 LLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPN 370

Query: 210 NDLVITTSTESQIKIWNL-DLDKDMGSKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYI 268
              + T S +  IKIW+L + + +  S    K +          SV++   + G  F + 
Sbjct: 371 GYQLATGSGDGTIKIWDLRNKESNCASIFAHKNLV--------TSVQYEKNNGG--FVFS 420

Query: 269 QNADKTVEIFRVRTQEEISKALRKREKRL 297
              DK ++I   +T E ++      EK L
Sbjct: 421 AGYDKLIKIHDSKTYESVATLEGHTEKIL 449

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 102/235 (43%), Gaps = 21/235 (8%)

Query: 453 LASSTLLENKEDAHGAAIWSLDL-TSDGKR--LVTGSADKTVKFWDFKVDQELIPGTVDK 509
           +AS+ +L  +    G   W   L TS G+   LV+ S DKT+  W    D + +   V  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRS 60

Query: 510 FVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLP 569
           F     I  D TL           + D  +   +  D T++++ + + + F    GHK  
Sbjct: 61  FKGHSHIVQDVTL-----------TPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSD 109

Query: 570 VLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVP------ESHN 623
           V+S+ I   + ++I+ S DK+IK+W +  G C  +L  H D +  V+  P      E+  
Sbjct: 110 VMSVAIDRKASMIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVT 168

Query: 624 FFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             S   D +VK W+ ++F+       H   V  +  S D   + S   D  I +W
Sbjct: 169 VISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLW 223

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 10/141 (7%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++W++ +      F GHKS +  +  D   + +ISGS+D  I +W + G+  L  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 156 RSHKDSITGIWCENED-------WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAI 208
             H D ++ +     D        +IS   D ++K W+L   Q     + H      +  
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 209 HND--LVITTSTESQIKIWNL 227
             D  L+ +   + +I +WNL
Sbjct: 205 SPDGSLIASAGKDGEIMLWNL 225

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D ++K W+L    +  +F GH   +  +   P G+ + S  KD +I++W+L  +V +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTL 234

Query: 156 RSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
            +  +     +  N  WL + +  G IK++ L  Q  ++
Sbjct: 235 NAQDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALID 272

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 92/220 (41%), Gaps = 27/220 (12%)

Query: 465 AHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLEL 524
            H   +  + LT DG   ++ S DKT++ W+    +     T  +FV             
Sbjct: 63  GHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGE-----TFQRFVGH----------- 106

Query: 525 NDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSK---- 580
             D+++V I      +     D ++KV+ +   +   +L GH   V  + ++ + K    
Sbjct: 107 KSDVMSVAIDRKASMIISGSRDKSIKVWTIKG-QCLATLLGHNDWVSQVRVAPNDKDDDE 165

Query: 581 --LLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWD- 637
              +I++  DK +K W L+          H  ++ ++   P+     S  KDG +  W+ 
Sbjct: 166 TVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNL 225

Query: 638 GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRV 677
            DK       A  Q EV+ALA S + R+ ++ +    I+V
Sbjct: 226 ADKVPMYTLNA--QDEVFALAFSPN-RYWLAAATASGIKV 262

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 65/157 (41%), Gaps = 15/157 (9%)

Query: 86  ETNLLAVGYADGVIKIWDLISK-----TVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + NLL     D  +  W L          + +F GH   +  +   P G   +S S D  
Sbjct: 29  QPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKT 88

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENE-DWLISTSKDGLIKIWDLKTQQCVETHMAH 199
           + +W++       +   HK  +  +  + +   +IS S+D  IK+W +K  QC+ T + H
Sbjct: 89  LRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIK-GQCLATLLGH 147

Query: 200 TSECWGLAIH-ND-------LVITTSTESQIKIWNLD 228
                 + +  ND        VI+   +  +K WNL+
Sbjct: 148 NDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLN 184

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 46/113 (40%), Gaps = 9/113 (7%)

Query: 85  PETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISG--------S 136
           P+ +L+A    DG I +W+L  K  +   N     +  L F P    L +         S
Sbjct: 206 PDGSLIASAGKDGEIMLWNLADKVPMYTLNAQDE-VFALAFSPNRYWLAAATASGIKVFS 264

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKT 189
            D   +I DL  E   Y   +   +++  W  +   L +   D +I++W + T
Sbjct: 265 LDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 52/122 (42%), Gaps = 12/122 (9%)

Query: 383 GHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFEC-GYALTCKFLPGGALVV 440
           GH  +V +I  S D  L+A+A  +G + +WN+     + T           F P    + 
Sbjct: 194 GHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNAQDEVFALAFSPNRYWLA 253

Query: 441 VGNRGGDLQLFDLASSTLLEN--------KEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
                G +++F L    L+++         + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 254 AATASG-IKVFSLDPQALIDDLRPEFAGYNKAAEPHAV-SLTWSADGQTLFAGYTDNVIR 311

Query: 493 FW 494
            W
Sbjct: 312 VW 313

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 81/178 (45%), Gaps = 17/178 (9%)

Query: 514 LKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKF-------------F 560
           +  FH+T    N ++  V+ S D +  A    D+T+KV++L+                  
Sbjct: 491 MYTFHNT----NGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNS 546

Query: 561 LSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE 620
            +L GH  PV S+  S D++ L+++S DK +++W LD   C      H   +  VKF P 
Sbjct: 547 ATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPL 606

Query: 621 SHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            H F + S D   + W  D    ++  + H ++V       +  +V + S D + R+W
Sbjct: 607 GHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMW 664

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 91/208 (43%), Gaps = 7/208 (3%)

Query: 473 LDLTSDGKRLVTGSADKTVKFW--DFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILA 530
           ++ + D +    G  D T+K W  D    Q ++P        K +    T +  +  + +
Sbjct: 504 VEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKA-----KDQSNSATLVGHSGPVYS 558

Query: 531 VKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKN 590
           V  S DN++L  +  D TV+++ L++    +   GH  PV  +  S      IT+S D+ 
Sbjct: 559 VAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQT 618

Query: 591 IKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH 650
            ++W  D     +    H + +    F P     F+ S D   + WD    + V+    H
Sbjct: 619 ARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGH 678

Query: 651 QSEVWALAISNDARFVVSTSHDHSIRVW 678
            S V AL +S D R++ + S D +I VW
Sbjct: 679 TSPVTALEVSPDGRWLTTGSEDGTIIVW 706

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/314 (21%), Positives = 129/314 (41%), Gaps = 73/314 (23%)

Query: 362 PYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIR 420
           P Q   P++ A ++  +  L GH   V S+  S DN+ L +AS + T+++W++ T  C+ 
Sbjct: 531 PLQSILPSK-AKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLV 589

Query: 421 TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480
            ++                                          H   +W +  +  G 
Sbjct: 590 CYK-----------------------------------------GHNHPVWYVKFSPLGH 608

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540
             +T S D+T + W           + D   P L+IF   +  LN D+       +  ++
Sbjct: 609 YFITASHDQTARLW-----------SCDHIYP-LRIF---SGHLN-DVDCSTFHPNGCYV 652

Query: 541 AVSLLDNTVKVFFL---NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD 597
                D T +++ +   +S++ FL   GH  PV ++++S D + L T S D  I +W + 
Sbjct: 653 FTGSSDKTCRMWDIQTGDSVRLFL---GHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIG 709

Query: 598 FGDCHKSLFAH-QDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKF------ECVQKLAAH 650
            G   K +  H ++ I S+ F  E +   +   D  V+ WD  +F      E  Q+   +
Sbjct: 710 TGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIKRFTNEPGMEPEQQFNTY 769

Query: 651 QSEVWALAISNDAR 664
             ++  L+++ND +
Sbjct: 770 SGDM-ELSVNNDIK 782

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/293 (20%), Positives = 125/293 (42%), Gaps = 34/293 (11%)

Query: 404 SNGTLKIWNIKTHA---CIRTFE-CGYALTC-KFLPGGALVVVGNRGGDLQLFDLASSTL 458
           S  ++++ N++T A   C+ TF      +TC +F     L   G +   ++++ L  S L
Sbjct: 473 SRDSIQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPL 532

Query: 459 ---LENKED---------AHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGT 506
              L +K            H   ++S+  + D + L++ S DKTV+ W           +
Sbjct: 533 QSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLW-----------S 581

Query: 507 VDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH 566
           +D F   L  +       N  +  VK S    +   +  D T +++  + +       GH
Sbjct: 582 LDTFT-CLVCYKGH----NHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGH 636

Query: 567 KLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFS 626
              V       +   + T S+DK  ++W +  GD  +    H   + +++  P+     +
Sbjct: 637 LNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTT 696

Query: 627 CSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
            S+DG +  WD    + ++++  H ++ ++++  + +   +V+   D S+RVW
Sbjct: 697 GSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVW 749

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 88/208 (42%), Gaps = 21/208 (10%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + + P+   L     D  +++W L + T L+ + GH   +  ++F P G   I+ S D  
Sbjct: 559 VAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQT 618

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCE----NEDWLISTSKDGLIKIWDLKTQQCVETH 196
             +W       +Y LR     +  + C     N  ++ + S D   ++WD++T   V   
Sbjct: 619 ARLWSC---DHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLF 675

Query: 197 MAHTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSV 254
           + HTS    L +  D   + T S +  I +W++   K +           KQ K  G + 
Sbjct: 676 LGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRI-----------KQMKGHGKNP 724

Query: 255 EF-ITTSDGVNFFYIQNADKTVEIFRVR 281
            + IT +   N      AD++V ++ ++
Sbjct: 725 IYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/152 (19%), Positives = 67/152 (44%), Gaps = 4/152 (2%)

Query: 80  YLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDS 139
           Y+++ P  +       D   ++W       L  F+GH + +    F P G  + +GS D 
Sbjct: 600 YVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDK 659

Query: 140 DIIIWDLVGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMA 198
              +WD+     +     H   +T +    +  WL + S+DG I +WD+ T + ++    
Sbjct: 660 TCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKG 719

Query: 199 H-TSECWGLAIH--NDLVITTSTESQIKIWNL 227
           H  +  + +  +   + ++T   +  +++W++
Sbjct: 720 HGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 14/112 (12%)

Query: 37  ILTGALE-NVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYA 95
           + TG+ +     WDI+TG+  ++      P             T L+  P+   L  G  
Sbjct: 652 VFTGSSDKTCRMWDIQTGDSVRLFLGHTSP------------VTALEVSPDGRWLTTGSE 699

Query: 96  DGVIKIWDLISKTVLINFNGH-KSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           DG I +WD+ +   +    GH K+ I  + F+  G  L++G  D  + +WD+
Sbjct: 700 DGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 38.5 bits (88), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 54/135 (40%), Gaps = 16/135 (11%)

Query: 110 LINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVG----EVGLYKLRSHKDSITGI 165
           +  F+     +T + F        +G +DS I +W L G     +   K +   +S T +
Sbjct: 491 MYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLV 550

Query: 166 ----------WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH--NDLV 213
                     +  +  +L+S S+D  +++W L T  C+  +  H    W +         
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYF 610

Query: 214 ITTSTESQIKIWNLD 228
           IT S +   ++W+ D
Sbjct: 611 ITASHDQTARLWSCD 625

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 121/296 (40%), Gaps = 45/296 (15%)

Query: 387 DVRSIDISDDNKLLATA-SNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRG 445
           D+ S++ SDD +L A    +  +KIW+                    L G +L+      
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWS--------------------LDGSSLINPKYSS 514

Query: 446 GDLQLF--DLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELI 503
                F  D   STL+      H   ++S   + D   LV+GS DKTVK W       L+
Sbjct: 515 SQFDRFSQDNTCSTLV-----GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALV 569

Query: 504 PGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSL 563
                                N  +  VK S    + A +  D T +++  + +      
Sbjct: 570 ----------------NYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIF 613

Query: 564 YGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN 623
            GH   V ++    +   + T S+DK  ++W +  GD  +    H   ++S +  P+   
Sbjct: 614 AGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRW 673

Query: 624 FFSCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
             + S+DG++  WD    + ++++  H ++ V +L+ + +   ++S   DHS+RVW
Sbjct: 674 LATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVW 729

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 78/183 (42%), Gaps = 22/183 (12%)

Query: 514 LKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFF------------- 560
           +  FH+T    N D+ +++ S D +  A    D+ +K++ L+                  
Sbjct: 466 MYTFHNT----NRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFS 521

Query: 561 -----LSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSV 615
                 +L GH   V S   S D+  L++ S DK +K+W +D      +   H   +  V
Sbjct: 522 QDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDV 581

Query: 616 KFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSI 675
           KF P  H F S S D   + W  D    ++  A H ++V  ++   +  +V + S D + 
Sbjct: 582 KFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTC 641

Query: 676 RVW 678
           R+W
Sbjct: 642 RMW 644

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 109/265 (41%), Gaps = 28/265 (10%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L  G  D  +K+W + + T L+N+ GH   +  ++F P G    S S D    
Sbjct: 541 FSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTAR 600

Query: 143 IWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS 201
           +W       L     H + +  + +  N  ++ + S D   ++WD+ T   V   + HT+
Sbjct: 601 LWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 660

Query: 202 ECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGV-SVEFIT 258
                 +  D   + T S +  I +W++   K +           KQ +  G  +V  ++
Sbjct: 661 PVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRI-----------KQMRGHGKNAVHSLS 709

Query: 259 TSDGVNFFYIQNADKTVEIFRVR--TQEEISKALRKREKRLRDKGMADEKIQQNIKDSYV 316
            +   N      AD +V ++ V+  T E+  +  +     + D   +   I Q+IKD   
Sbjct: 710 FNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDITAS---INQDIKDYGR 766

Query: 317 SVIMHP-------FQTIRSP-FKIK 333
              + P       F T RSP FK+K
Sbjct: 767 RRTIIPTNDLVASFYTKRSPVFKVK 791

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 61/119 (51%), Gaps = 5/119 (4%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    +  G +D   ++WD+ +   +  F GH + +   +  P G  L +GS+D  
Sbjct: 623 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGV 682

Query: 141 IIIWDLVGEVGLYKLRSH-KDSITGIWCENE-DWLISTSKDGLIKIWDLK---TQQCVE 194
           I +WD+     + ++R H K+++  +    E + LIS   D  +++WD+K   T+Q  E
Sbjct: 683 ICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPE 741

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 76/165 (46%), Gaps = 14/165 (8%)

Query: 372 APNKLYTIEL-QGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTF--ECGYA 427
           A + +Y + +  GH  DV ++    +   + T +S+ T ++W++ T   +R F       
Sbjct: 603 ACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 662

Query: 428 LTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSA 487
           L+ +  P G  +  G+  G + L+D+ +   ++        A+ SL    +G  L++G A
Sbjct: 663 LSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGA 722

Query: 488 DKTVKFWDFKVDQELIPGTVDKFVPKLKIFH----DTTLELNDDI 528
           D +V+ WD K       GT ++     + F+    D T  +N DI
Sbjct: 723 DHSVRVWDVKH------GTTEQGPEPEQPFNAHVGDITASINQDI 761

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 67/171 (39%), Gaps = 23/171 (13%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIWDLISKTVLIN-------------------FNGHKSA 119
           T L++  +  L A G+ D  IKIW L   + LIN                     GH   
Sbjct: 477 TSLEFSDDCRLAAAGFQDSYIKIWSLDGSS-LINPKYSSSQFDRFSQDNTCSTLVGHSGT 535

Query: 120 ITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSK 178
           +    F P    L+SGS+D  + +W +     L   + H   +  + +     +  S S 
Sbjct: 536 VYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASH 595

Query: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
           D   ++W       +     HT++   ++ H +   V T S++   ++W++
Sbjct: 596 DQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDV 646

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 113/249 (45%), Gaps = 17/249 (6%)

Query: 373 PNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK 431
           PN + + E  GHR +V SI    +NK + ++S +GT+K+W+++  +  R ++   A+   
Sbjct: 65  PNPVTSFE--GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAAVNEV 122

Query: 432 FL-PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT 490
            + P    ++  ++ G+++++DL  +  +          + SL + SDG  LV G+    
Sbjct: 123 VIHPNQGELISCDQDGNIKIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182

Query: 491 VKFWDFKVDQELI-PGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTV 549
              W      +   P  V KF    K            I  V +SSD K LA    D+T 
Sbjct: 183 CYVWQMPHQTDAANPRPVTKFRSHAKY-----------ITRVLLSSDVKHLATCSADHTA 231

Query: 550 KVFFLN-SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAH 608
           +V+ ++ + +   +L GH+  V     S DS  L+T+ +D  +++W L   +  +    H
Sbjct: 232 RVWSIDDNFQLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

Query: 609 QDSIMSVKF 617
               + V  
Sbjct: 292 HKGAICVAL 300

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 60/295 (20%), Positives = 117/295 (39%), Gaps = 36/295 (12%)

Query: 399 LLATAS-NGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGG-DLQLFDLASS 456
           +LA+A  + T++ W   T  C RT +   +   +         +   G  +++L+D+ ++
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKRFLAAAGHLNVRLYDIRTT 63

Query: 457 TLLE-NKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLK 515
                   + H   + S+    + K +V+ S D T+K WD +              P ++
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-------------PSVQ 110

Query: 516 IFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK-LPVLSID 574
             +     +N+    V I  +   L     D  +K++ L   +    L      P+ S+ 
Sbjct: 111 RNYKHHAAVNE----VVIHPNQGELISCDQDGNIKIWDLGENQCVHQLAPEDDTPLQSLS 166

Query: 575 ISFDSKLLITSSADKNIKIWGLDFGDCHKS----------LFAHQDSIMSVKFVPESHNF 624
           ++ D  +L+  +   N  +W +     H++            +H   I  V    +  + 
Sbjct: 167 VASDGSMLVAGNNKGNCYVWQMP----HQTDAANPRPVTKFRSHAKYITRVLLSSDVKHL 222

Query: 625 FSCSKDGLVKYWD-GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            +CS D   + W   D F+    L  HQ  VW  A S D+ ++V+   DH +R+W
Sbjct: 223 ATCSADHTARVWSIDDNFQLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLW 277

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 4/108 (3%)

Query: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           L A G+ +  ++++D+   +   + +F GH+  +T + F      ++S S+D  I +WD+
Sbjct: 47  LAAAGHLN--VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV 104

Query: 147 VGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
                    + H      +   N+  LIS  +DG IKIWDL   QCV 
Sbjct: 105 RAPSVQRNYKHHAAVNEVVIHPNQGELISCDQDGNIKIWDLGENQCVH 152

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 11/118 (9%)

Query: 44  NVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWD 103
           NV  +DI+T            P  V +        T + +  E   +     DG IK+WD
Sbjct: 54  NVRLYDIRTTN----------PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD 103

Query: 104 LISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDS 161
           + + +V  N+  H +A+  +   P    LIS  +D +I IWDL     +++L    D+
Sbjct: 104 VRAPSVQRNYK-HHAAVNEVVIHPNQGELISCDQDGNIKIWDLGENQCVHQLAPEDDT 160

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-- 146
           L + GY D  I+ W+ ++           S +  L    +  R ++ +   ++ ++D+  
Sbjct: 5   LASAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TSDKRFLAAAGHLNVRLYDIRT 62

Query: 147 VGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWG 205
                +     H+ ++T I  + E+ W++S+S+DG IK+WD++    V+ +  H +    
Sbjct: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHHAAVNE 121

Query: 206 LAIHNDL--VITTSTESQIKIWNL 227
           + IH +   +I+   +  IKIW+L
Sbjct: 122 VVIHPNQGELISCDQDGNIKIWDL 145

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 100/234 (42%), Gaps = 20/234 (8%)

Query: 453 LASSTLLENKEDAHGAAIWSLDL-TSDGKR--LVTGSADKTVKFWDFKVDQELIPGTVDK 509
           +AS+ +L  +    G   W   L TS G+   L++ S DKT+  W    D +     V  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 510 FVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLP 569
           F     I  D TL           + D  +   +  D T++++ + + + +    GHK  
Sbjct: 61  FKGHSHIVQDCTL-----------TQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 570 VLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN-----F 624
           V+S+ I   + ++I+ S DK IK+W +  G C  +L  H D +  V+  P   N      
Sbjct: 110 VMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDTVTV 168

Query: 625 FSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            S   D +VK W+ ++F+       H   V A+  S D   + S   D  I +W
Sbjct: 169 ISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLW 222

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 92/208 (44%), Gaps = 24/208 (11%)

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LT DG   ++ S DKT++ WD    +     T  +FV               D+++V I 
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGE-----TYQRFVGH-----------KSDVMSVAID 116

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH-----KLPVLSIDISFDSKLLITSSADK 589
                +     D T+KV+ +   +   +L GH     ++ +   D + D+  +I++  DK
Sbjct: 117 RKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDK 175

Query: 590 NIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAA 649
            +K W L+          H  ++ +V   P+     S  KDG +  W+  +   +  L+A
Sbjct: 176 MVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSA 235

Query: 650 HQSEVWALAISNDARFVVSTSHDHSIRV 677
            Q EV+ALA S + R+ ++ +    +++
Sbjct: 236 -QDEVFALAFSPN-RYWLAAATASGVKI 261

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++WD+ +      F GHKS +  +  D   + +ISGS+D  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDSITGIWC----ENED--WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH 209
             H D ++ +      +N+D   +IS   D ++K W+L   Q     + H      +   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 210 ND--LVITTSTESQIKIWNL 227
            D  L+ +   + +I +WNL
Sbjct: 205 PDGSLIASAGKDGEIMLWNL 224

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D ++K W+L    +  +F GH   +  +   P G+ + S  KD +I++W+L+ +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTL 233

Query: 156 RSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
            +  +     +  N  WL + +  G +KI+ L  Q  ++
Sbjct: 234 SAQDEVFALAFSPNRYWLAAATASG-VKIFSLDPQSLID 271

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 62/134 (46%), Gaps = 14/134 (10%)

Query: 104 LISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGE-----VGLYKLRSH 158
           L+ +  L   NG  +++      P    L+S S+D  +I W L G+     V +   + H
Sbjct: 7   LVLRGTLEGHNGWVTSLATSAGQPN--LLLSASRDKTLISWKLTGDDQKFGVPVRSFKGH 64

Query: 159 KDSITGIWC---ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHN--DLV 213
              +    C   ++  + +S S D  +++WD+ T +  +  + H S+   +AI     ++
Sbjct: 65  SHIVQD--CTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMI 122

Query: 214 ITTSTESQIKIWNL 227
           I+ S +  IK+W +
Sbjct: 123 ISGSRDKTIKVWTI 136

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 48/113 (42%), Gaps = 9/113 (7%)

Query: 85  PETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISG--------S 136
           P+ +L+A    DG I +W+L+ KT +   +     +  L F P    L +         S
Sbjct: 205 PDGSLIASAGKDGEIMLWNLLEKTAMYTLSAQDE-VFALAFSPNRYWLAAATASGVKIFS 263

Query: 137 KDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKT 189
            D   +I DL  E   Y   +   +++  W  +   L +   D +I++W + T
Sbjct: 264 LDPQSLIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRVWQVMT 316

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 12/122 (9%)

Query: 383 GHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFEC-GYALTCKFLPGGALVV 440
           GH  +V ++  S D  L+A+A  +G + +WN+     + T           F P    + 
Sbjct: 193 GHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSAQDEVFALAFSPNRYWLA 252

Query: 441 VGNRGGDLQLFDLASSTLLEN--------KEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
                G +++F L   +L+++         + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 253 AATASG-VKIFSLDPQSLIDDLRPEFAGYNKAAEPHAV-SLTWSADGQTLFAGYTDNVIR 310

Query: 493 FW 494
            W
Sbjct: 311 VW 312

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 97/228 (42%), Gaps = 20/228 (8%)

Query: 458 LLENKEDAHGAAIWSLDLTSDGKR--LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLK 515
           +L    + H   + SL  TS G+   L++GS DKT+  W    D +     V  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 IFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI 575
           I  D TL           + D  +   +  D T++++ + + + +    GHK  V+S+ I
Sbjct: 67  IVQDCTL-----------TQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 576 SFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHN-----FFSCSKD 630
              + ++I+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   D
Sbjct: 116 DRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGND 174

Query: 631 GLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            +VK W+ ++F+       H   V  +  S D   + S   D  I +W
Sbjct: 175 KMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLW 222

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 93/208 (44%), Gaps = 24/208 (11%)

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LT DG   ++ S DKT++ WD    +     T  +FV               D+++V I 
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGE-----TYQRFVGH-----------KSDVMSVAID 116

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH-----KLPVLSIDISFDSKLLITSSADK 589
                +     D T+KV+ +   +   +L GH     ++ +   D + DS  +I++  DK
Sbjct: 117 RKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDK 175

Query: 590 NIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAA 649
            +K W L+          H  ++ +V   P+     S  KDG +  W+  + + +  L+A
Sbjct: 176 MVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSA 235

Query: 650 HQSEVWALAISNDARFVVSTSHDHSIRV 677
            Q EV+ALA S + R+ ++ +    I++
Sbjct: 236 -QDEVFALAFSPN-RYWLAAATASGIKI 261

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 9/146 (6%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++WD+ +      F GHKS +  +  D   + +ISGS+D  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDSITGIWC----ENED--WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH 209
             H D ++ +      +N+D   +IS   D ++K W+L   Q     + H      +   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTAS 204

Query: 210 ND--LVITTSTESQIKIWNLDLDKDM 233
            D  L+ +   + +I +WNL   K M
Sbjct: 205 PDGTLIASAGKDGEIMLWNLAEKKAM 230

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D ++K W+L    +  +F GH   +  +   P GT + S  KD +I++W+L  +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 156 RSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
            +  +     +  N  WL + +  G IKI+ L  Q  V+
Sbjct: 234 SAQDEVFALAFSPNRYWLAAATASG-IKIFCLDPQSLVD 271

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 63/134 (47%), Gaps = 14/134 (10%)

Query: 104 LISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGE-----VGLYKLRSH 158
           L+ +  L   NG  +++      P    L+SGS+D  +I W L G+     V +   + H
Sbjct: 7   LVLRGTLEGHNGWVTSLATSAGQPN--LLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGH 64

Query: 159 KDSITGIWC---ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHN--DLV 213
              +    C   ++  + +S S D  +++WD+ T +  +  + H S+   +AI     ++
Sbjct: 65  SHIVQD--CTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMI 122

Query: 214 ITTSTESQIKIWNL 227
           I+ S +  IK+W +
Sbjct: 123 ISGSRDKTIKVWTI 136

 Score = 35.0 bits (79), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 12/122 (9%)

Query: 383 GHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFEC-GYALTCKFLPGGALVV 440
           GH  +V ++  S D  L+A+A  +G + +WN+     + T           F P    + 
Sbjct: 193 GHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPNRYWLA 252

Query: 441 VGNRGGDLQLFDLASSTLLEN--------KEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
                G +++F L   +L+++         + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 253 AATASG-IKIFCLDPQSLVDDLRPEFAGYNKSAEPHAV-SLAWSADGQTLFAGYTDSVIR 310

Query: 493 FW 494
            W
Sbjct: 311 VW 312

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 53/278 (19%), Positives = 112/278 (40%), Gaps = 46/278 (16%)

Query: 380 ELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGY---ALTCKFLPG 435
             +GH   V+   ++ D     +AS + TL++W++ T    + F  G+    ++      
Sbjct: 60  SFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRF-VGHKSDVMSVAIDRK 118

Query: 436 GALVVVGNRGGDLQLFDLAS---STLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
            ++++ G+R   ++++ +     +TLL + +      I   D   D   +++   DK VK
Sbjct: 119 ASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVK 178

Query: 493 FWD---FKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTV 549
            W+   F+++ + +              H      N ++  V  S D   +A +  D  +
Sbjct: 179 AWNLNQFQIEADFVG-------------H------NGNVNTVTASPDGTLIASAGKDGEI 219

Query: 550 KVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD-----------F 598
            ++ L   K   +L      V ++  S +   L  ++A   IKI+ LD           F
Sbjct: 220 MLWNLAEKKAMYTLSAQD-EVFALAFSPNRYWLAAATA-SGIKIFCLDPQSLVDDLRPEF 277

Query: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYW 636
              +KS   H    +S+ +  +    F+   D +++ W
Sbjct: 278 AGYNKSAEPHA---VSLAWSADGQTLFAGYTDSVIRVW 312

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 45/113 (39%), Gaps = 9/113 (7%)

Query: 85  PETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSK------- 137
           P+  L+A    DG I +W+L  K  +   +     +  L F P    L + +        
Sbjct: 205 PDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDE-VFALAFSPNRYWLAAATASGIKIFC 263

Query: 138 -DSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKT 189
            D   ++ DL  E   Y   +   +++  W  +   L +   D +I++W + T
Sbjct: 264 LDPQSLVDDLRPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQVMT 316

>KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON}
           Anc_1.399 YNL006W
          Length = 303

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 115/252 (45%), Gaps = 23/252 (9%)

Query: 373 PNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK 431
           PN + T E  GH+ +V S+    DN+ + T+S +GT+K+W++++ +  R ++    +   
Sbjct: 65  PNPVATFE--GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 122

Query: 432 FL-PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT 490
            + P    ++  +R G+++++DL  +             + SL + SDG  LV  ++   
Sbjct: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182

Query: 491 VKFWDFKVDQELIPGTVD----KFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLD 546
              W+       +P   D    K V K K         ++ I  + +SSD K LA    D
Sbjct: 183 CYVWE-------MPNHTDASNLKPVTKFKAH-------SNYITRILLSSDVKHLATCSAD 228

Query: 547 NTVKVFFLN-SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSL 605
            T + + L+ + K   +L GH+  V     S DS  L+T+S+D  +++W L   +  +  
Sbjct: 229 KTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288

Query: 606 FAHQDSIMSVKF 617
             H    + V  
Sbjct: 289 GGHHKGAICVAL 300

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 123/292 (42%), Gaps = 28/292 (9%)

Query: 381 LQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKT--HACIRTFEC--GYALTCKFLPGG 436
           +Q   + V  ++I++D KLL  A +  +++++I+T     + TFE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDN 87

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
             +V  +  G ++++D+ S ++  N +  H A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 497 KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL-- 554
             +Q                 H  T E N  + ++ ++SD   L  +       V+ +  
Sbjct: 146 GENQ---------------CTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPN 190

Query: 555 ----NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG-DCHKSLFAHQ 609
               +++K       H   +  I +S D K L T SADK  + W LD       +L  HQ
Sbjct: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQ 250

Query: 610 DSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN 661
             +    F  +S    + S D  V+ WD    E V++   H      +A+++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALND 302

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 120/291 (41%), Gaps = 29/291 (9%)

Query: 399 LLATASNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGG-DLQLFDLASST 457
           L++   + T++ W   T  C RT +   +   +        ++G  G  +++L+D+ ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64

Query: 458 LLENKE-DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKI 516
                  + H   + SL    D + +VT S D T+K WD +     +P       P  ++
Sbjct: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR--SPSVPRNYKHNAPVNEV 122

Query: 517 -FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH-KLPVLSID 574
             H    EL        IS D         D  ++++ L   +    L      P+ S+ 
Sbjct: 123 VIHPNQGEL--------ISCDR--------DGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166

Query: 575 ISFDSKLLITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFVPESHNFFSCS 628
           ++ D  +L+ +++  N  +W + +  D           AH + I  +    +  +  +CS
Sbjct: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226

Query: 629 KDGLVKYWD-GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            D   + W   D F+    L  HQ  VW  A S D+ ++V+ S DH +R+W
Sbjct: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 53/109 (48%), Gaps = 6/109 (5%)

Query: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           L A G+ +  ++++D+   +   +  F GHK  +T L F      +++ S+D  I +WD 
Sbjct: 47  LGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWD- 103

Query: 147 VGEVGLYKLRSHKDSITGIWCE-NEDWLISTSKDGLIKIWDLKTQQCVE 194
           V    + +   H   +  +    N+  LIS  +DG I+IWDL   QC  
Sbjct: 104 VRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH 152

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 17/115 (14%)

Query: 32  GSAGQILTGALENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLA 91
           G+AG       +NV  +DI+T   + + T     G V          T L +  +   + 
Sbjct: 48  GAAGH------QNVRLYDIRTTNPNPVATFEGHKGNV----------TSLSFQQDNRWMV 91

Query: 92  VGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
               DG IK+WD+ S +V  N+  H + +  +   P    LIS  +D +I IWDL
Sbjct: 92  TSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 60/142 (42%), Gaps = 47/142 (33%)

Query: 132 LISGSKDSDIIIWD---------------------------LVGEVG-----LYKLRS-- 157
           L+S   D  I  W+                           L+G  G     LY +R+  
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64

Query: 158 ---------HKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLA 207
                    HK ++T +  + ++ W++++S+DG IK+WD+++   V  +  H +    + 
Sbjct: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS-VPRNYKHNAPVNEVV 123

Query: 208 IHNDL--VITTSTESQIKIWNL 227
           IH +   +I+   +  I+IW+L
Sbjct: 124 IHPNQGELISCDRDGNIRIWDL 145

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 126/294 (42%), Gaps = 39/294 (13%)

Query: 387 DVRSIDISDDNKLLATA-SNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRG 445
           D+ S++ SDD +L A    +  +KI+++           G +L  K      L     + 
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLD----------GSSLNSK------LTESNKKT 541

Query: 446 GDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPG 505
             L   D ++STL+      H   ++S   + D + LV+GS DKTV+ W       L+  
Sbjct: 542 NKLLNNDESTSTLI-----GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLV-- 594

Query: 506 TVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYG 565
                         +    N  +  V+ S    + A +  D+T +++  + +       G
Sbjct: 595 --------------SYKGHNHPVWDVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAG 640

Query: 566 HKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFF 625
           H   V  +    +   L T S+DK  ++W +  GD  +        +MS    P+     
Sbjct: 641 HLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLS 700

Query: 626 SCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
           + S+DG++  WD    + ++++  H ++ +++L+ + +   ++S   DHS+RVW
Sbjct: 701 TGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVW 754

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 81/185 (43%), Gaps = 24/185 (12%)

Query: 514 LKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVF--------------------F 553
           +  FH+T    + D+ +++ S D +  A    D+ +K+F                     
Sbjct: 489 MYTFHNT----DRDMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKL 544

Query: 554 LNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 613
           LN+ +   +L GH   V S   S D++ L++ S DK +++W +D      S   H   + 
Sbjct: 545 LNNDESTSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVW 604

Query: 614 SVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDH 673
            V+F P  H F + S D   + W  D    ++  A H ++V  ++   +  ++ + S D 
Sbjct: 605 DVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDK 664

Query: 674 SIRVW 678
           + R+W
Sbjct: 665 TCRMW 669

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 104/269 (38%), Gaps = 65/269 (24%)

Query: 374 NKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCKF 432
           N   T  L GH   V S   S DN+ L + S + T+++W++ TH  + +++         
Sbjct: 547 NDESTSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYK--------- 597

Query: 433 LPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
                                            H   +W ++ +  G    T S D T +
Sbjct: 598 --------------------------------GHNHPVWDVEFSPLGHYFATASHDHTAR 625

Query: 493 FWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVF 552
            W           + D   P L+IF      LN D+  V    +  +L     D T +++
Sbjct: 626 LW-----------SCDHIYP-LRIFAG---HLN-DVDCVSFHPNGCYLFTGSSDKTCRMW 669

Query: 553 FL---NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAH- 608
            +   +S++ FL L     PV+S  +S D + L T S D  I +W +  G   K +  H 
Sbjct: 670 DITTGDSVRLFLGLTA---PVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHG 726

Query: 609 QDSIMSVKFVPESHNFFSCSKDGLVKYWD 637
           +++I S+ +  E +   S   D  V+ WD
Sbjct: 727 KNAIYSLSYNKEGNVLISGGADHSVRVWD 755

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 66/157 (42%), Gaps = 9/157 (5%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L  G  D  +++W + + T L+++ GH   +  + F P G    + S D    
Sbjct: 566 FSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTAR 625

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           +W       +Y LR     +  + C     N  +L + S D   ++WD+ T   V   + 
Sbjct: 626 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLG 682

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDM 233
            T+     ++  D   + T S +  I +W++   K +
Sbjct: 683 LTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRL 719

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 5/149 (3%)

Query: 383 GHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTFE--CGYALTCKFLPGGALV 439
           GH  DV  +    +   L T +S+ T ++W+I T   +R F       ++    P G  +
Sbjct: 640 GHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWL 699

Query: 440 VVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVD 499
             G+  G + ++D+ +   L+        AI+SL    +G  L++G AD +V+ WD K  
Sbjct: 700 STGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK-- 757

Query: 500 QELIPGTVDKFVPKLKIFHDTTLELNDDI 528
           +       +   P +    D T  +N DI
Sbjct: 758 KATTESGAEPEEPFVGYLGDVTTSINQDI 786

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    L  G +D   ++WD+ +   +  F G  + +      P G  L +GS+D  
Sbjct: 648 VSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGV 707

Query: 141 IIIWDLVGEVGLYKLRSH-KDSITGIWCENE-DWLISTSKDGLIKIWDLK 188
           I +WD+     L ++R H K++I  +    E + LIS   D  +++WDLK
Sbjct: 708 INVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK 757

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 69/151 (45%), Gaps = 4/151 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +++ P  +  A    D   ++W       L  F GH + +  + F P G  L +GS D  
Sbjct: 606 VEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKT 665

Query: 141 IIIWDL-VGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +WD+  G+     L      ++     +  WL + S+DG+I +WD+ T + ++    H
Sbjct: 666 CRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGH 725

Query: 200 TSEC-WGLAIH--NDLVITTSTESQIKIWNL 227
                + L+ +   +++I+   +  +++W+L
Sbjct: 726 GKNAIYSLSYNKEGNVLISGGADHSVRVWDL 756

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/172 (18%), Positives = 68/172 (39%), Gaps = 23/172 (13%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIWDLISKTV-------------LINFN-------GHKS 118
           T L++  +  L A G+ D  IKI+ L   ++             L+N +       GH  
Sbjct: 500 TSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGHSG 559

Query: 119 AITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTS 177
            +    F P    L+SGS+D  + +W +     L   + H   +  + +     +  + S
Sbjct: 560 TVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATAS 619

Query: 178 KDGLIKIWDLKTQQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
            D   ++W       +     H ++   ++ H +   + T S++   ++W++
Sbjct: 620 HDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 671

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 106/254 (41%), Gaps = 29/254 (11%)

Query: 438 LVVVGNRGGDLQLFDLASSTLLEN-----KEDA-------HGAAIWSLDLTSDGKRLVTG 485
           L   G +   ++LF L  S L         EDA       H   ++S   + D + LV+ 
Sbjct: 510 LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSPDNRYLVSS 569

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLL 545
           S DKTV+ W       L+                +    N  +  VK S    + A +  
Sbjct: 570 SEDKTVRLWSLDTHSALV----------------SYKGHNHPVWDVKFSPLGHYFATASH 613

Query: 546 DNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSL 605
           D+T +++  + +       GH   V  +    +   L T S+DK  ++W +  GDC +  
Sbjct: 614 DHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF 673

Query: 606 FAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDAR 664
                 ++S    P+     + S+DG++  WD    + ++++  H ++ +++LA   +  
Sbjct: 674 LGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGN 733

Query: 665 FVVSTSHDHSIRVW 678
            ++S   DHS+RVW
Sbjct: 734 ALISGGADHSVRVW 747

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 514 LKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKF-------------F 560
           +  FH+T    N D+ +++ S D +  A    D+ +K+F L+                  
Sbjct: 489 MYTFHNT----NRDMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATS 544

Query: 561 LSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE 620
            +L GH   V S   S D++ L++SS DK +++W LD      S   H   +  VKF P 
Sbjct: 545 KTLVGHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPL 604

Query: 621 SHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            H F + S D   + W  D    ++  A H ++V  ++   +  ++ + S D + R+W
Sbjct: 605 GHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMW 662

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 104/270 (38%), Gaps = 65/270 (24%)

Query: 373 PNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK 431
           P    +  L GH   V S   S DN+ L ++S + T+++W++ TH+ + +++        
Sbjct: 539 PEDATSKTLVGHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYK-------- 590

Query: 432 FLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTV 491
                                             H   +W +  +  G    T S D T 
Sbjct: 591 ---------------------------------GHNHPVWDVKFSPLGHYFATASHDHTA 617

Query: 492 KFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKV 551
           + W           + D   P L+IF      LN D+  V    +  +L     D T ++
Sbjct: 618 RLW-----------SCDHIYP-LRIFAG---HLN-DVDCVSFHPNGCYLFTGSSDKTCRM 661

Query: 552 FFL---NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAH 608
           + +   + ++ FL L     PV+S  +S D + L T S D  I +W +  G   K +  H
Sbjct: 662 WDIATGDCVRLFLGLTA---PVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 718

Query: 609 -QDSIMSVKFVPESHNFFSCSKDGLVKYWD 637
            +++I S+ +  E +   S   D  V+ WD
Sbjct: 719 GKNAIYSLAYCKEGNALISGGADHSVRVWD 748

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 69/155 (44%), Gaps = 13/155 (8%)

Query: 381 LQGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTFECGYALTCKFL-----P 434
             GH  DV  +    +   L T +S+ T ++W+I T  C+R F     LT   +     P
Sbjct: 631 FAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF---LGLTAPVISTCVSP 687

Query: 435 GGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFW 494
            G  +  G+  G + ++D+ +   L+        AI+SL    +G  L++G AD +V+ W
Sbjct: 688 DGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVW 747

Query: 495 DF-KVDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
           D  K   E  P     FV  L    D T  +N DI
Sbjct: 748 DLKKATTESGPEPEQAFVGYLG---DVTGSINQDI 779

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    L  G +D   ++WD+ +   +  F G  + +      P G  L +GS+D  
Sbjct: 641 VSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGI 700

Query: 141 IIIWDLVGEVGLYKLRSH-KDSITGI-WCENEDWLISTSKDGLIKIWDLK 188
           I +WD+     L ++R H K++I  + +C+  + LIS   D  +++WDLK
Sbjct: 701 INVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 87/215 (40%), Gaps = 18/215 (8%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +++ P  +  A    D   ++W       L  F GH + +  + F P G  L +GS D  
Sbjct: 599 VKFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKT 658

Query: 141 IIIWDLV-GEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +WD+  G+     L      I+     +  WL + S+DG+I +WD+ T + ++    H
Sbjct: 659 CRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 718

Query: 200 TSEC-WGLAI--HNDLVITTSTESQIKIWNLDLDKDMGSKLIEK----------GIYEKQ 246
                + LA     + +I+   +  +++W+L           E+          G   + 
Sbjct: 719 GKNAIYSLAYCKEGNALISGGADHSVRVWDLKKATTESGPEPEQAFVGYLGDVTGSINQD 778

Query: 247 SKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVR 281
            K+ G     I T+D V  FY     K   +F+V+
Sbjct: 779 IKEYGRRRTVIPTNDLVASFYT----KKTPVFKVK 809

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 66/157 (42%), Gaps = 9/157 (5%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L     D  +++W L + + L+++ GH   +  ++F P G    + S D    
Sbjct: 559 FSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTAR 618

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           +W       +Y LR     +  + C     N  +L + S D   ++WD+ T  CV   + 
Sbjct: 619 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLG 675

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDM 233
            T+      +  D   + T S +  I +W++   K +
Sbjct: 676 LTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRL 712

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/169 (18%), Positives = 66/169 (39%), Gaps = 24/169 (14%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIW-----------------DLISKTVLINFNGHKSAIT 121
           T L++  +  L A G+ D  IK++                 D  SKT++    GH   + 
Sbjct: 500 TSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLV----GHSGTVY 555

Query: 122 VLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDG 180
              F P    L+S S+D  + +W L     L   + H   +  + +     +  + S D 
Sbjct: 556 STSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDH 615

Query: 181 LIKIWDLKTQQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIWNL 227
             ++W       +     H ++   ++ H +   + T S++   ++W++
Sbjct: 616 TARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 664

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 99/216 (45%), Gaps = 19/216 (8%)

Query: 465 AHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLEL 524
            H  AI+S   + D K LV+ S DKT++ W       L+                T    
Sbjct: 551 GHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV----------------TYKGH 594

Query: 525 NDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLY-GHKLPVLSIDISFDSKLLI 583
           N  +  V+ S    + A +  D T +++  + + F L ++ GH   V  +    +   + 
Sbjct: 595 NHPVWDVQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFHPNGCYIF 653

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFEC 643
           T S+DK  ++W +  G+  +    H   I+SV   P+     + S+DG++  WD    + 
Sbjct: 654 TGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKS 713

Query: 644 VQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
           ++KL  H +S V +L+ + ++  +VS   D+S+R+W
Sbjct: 714 LKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIW 749

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 105/273 (38%), Gaps = 59/273 (21%)

Query: 367 EPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECG 425
           E TR     + T++L GH   + S   S DNKLL +AS + T+++W++ T   + T++  
Sbjct: 535 EKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYK-- 592

Query: 426 YALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTG 485
                                                   H   +W +  +  G    T 
Sbjct: 593 ---------------------------------------GHNHPVWDVQFSPVGHYFATA 613

Query: 486 SADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLL 545
           S D+T + W           + D   P L+IF         D+  V    +  ++     
Sbjct: 614 SHDQTARLW-----------SCDHIFP-LRIFSGHI----SDVDCVTFHPNGCYIFTGSS 657

Query: 546 DNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSL 605
           D T +++ + + +      GH  P+LS+ ++ D   L T S D  I IW +  G   K L
Sbjct: 658 DKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKL 717

Query: 606 FAH-QDSIMSVKFVPESHNFFSCSKDGLVKYWD 637
             H + ++ S+ +  ES+   S   D  V+ WD
Sbjct: 718 IGHGKSAVNSLSYNKESNILVSGGSDNSVRIWD 750

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 75/165 (45%), Gaps = 10/165 (6%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+  LL     D  I++W + ++T L+ + GH   +  ++F P G    + S D    
Sbjct: 561 FSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTAR 620

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           +W       ++ LR     I+ + C     N  ++ + S D   ++WD+ T + V   + 
Sbjct: 621 LWSC---DHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIG 677

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEKG 241
           HT+    +A+  D   + T S +  I IW++   K +  KLI  G
Sbjct: 678 HTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSL-KKLIGHG 721

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 84/204 (41%), Gaps = 38/204 (18%)

Query: 511 VPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKF----------- 559
           +P + +F  T L  N+++L++  S+D +  A    D+ +KV+ L+               
Sbjct: 463 LPSVCMF--TFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTLESKATKIQPSK 520

Query: 560 -------------------------FLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594
                                     + L GH   + S   S D+KLL+++S DK I++W
Sbjct: 521 SQAALRAGLDNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLW 580

Query: 595 GLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654
            +D      +   H   +  V+F P  H F + S D   + W  D    ++  + H S+V
Sbjct: 581 SMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCDHIFPLRIFSGHISDV 640

Query: 655 WALAISNDARFVVSTSHDHSIRVW 678
             +    +  ++ + S D + R+W
Sbjct: 641 DCVTFHPNGCYIFTGSSDKTCRMW 664

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (48%), Gaps = 2/109 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    +  G +D   ++WD+ +   +  F GH + I  +   P G RL +GS+D  
Sbjct: 643 VTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGV 702

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENED--WLISTSKDGLIKIWDL 187
           I IWD+     L KL  H  S       N++   L+S   D  ++IWDL
Sbjct: 703 IHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 70/151 (46%), Gaps = 4/151 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           +Q+ P  +  A    D   ++W       L  F+GH S +  + F P G  + +GS D  
Sbjct: 601 VQFSPVGHYFATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKT 660

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST-SKDGLIKIWDLKTQQCVETHMAH 199
             +WD+     +     H   I  +    +   ++T S+DG+I IWD+ T + ++  + H
Sbjct: 661 CRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGH 720

Query: 200 TSECWGLAIHN---DLVITTSTESQIKIWNL 227
                    +N   +++++  +++ ++IW+L
Sbjct: 721 GKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 381 LQGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
             GH +DV  +    +   + T +S+ T ++W+I T   +R F       L+    P G 
Sbjct: 633 FSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGL 692

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHG-AAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
            +  G+  G + ++D+ +   L+ K   HG +A+ SL    +   LV+G +D +V+ WD 
Sbjct: 693 RLATGSEDGVIHIWDIGTGKSLK-KLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

Query: 497 KV 498
            V
Sbjct: 752 TV 753

 Score = 35.0 bits (79), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 14/71 (19%)

Query: 36  QILTGALENV-NCWDIKTGE-LSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVG 93
           ++ TG+ + V + WDI TG+ L K++  G    AV++          L Y+ E+N+L  G
Sbjct: 693 RLATGSEDGVIHIWDIGTGKSLKKLIGHG--KSAVNS----------LSYNKESNILVSG 740

Query: 94  YADGVIKIWDL 104
            +D  ++IWDL
Sbjct: 741 GSDNSVRIWDL 751

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 123/299 (41%), Gaps = 26/299 (8%)

Query: 388 VRSIDISDDNKLLATAS-NG---TLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGN 443
           + S+  S D+K LA  S +G   T+   ++   + +     G      +   G L+  G 
Sbjct: 181 ISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGG 240

Query: 444 RGGDLQLFDLASSTLLENKE-DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQEL 502
             G ++LF + S  L +  +   H   +        G+ + + S D T + WD + + EL
Sbjct: 241 EDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHEL 300

Query: 503 IPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLS 562
           +          L+  H        ++  +   SD   L  + LD T  ++ + S    + 
Sbjct: 301 L----------LQEGH------GKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMV 344

Query: 563 LYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESH 622
           L GH  P+ S+D S     + T+S D  + IW +   +  + L AH   +  ++F  E H
Sbjct: 345 LSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRF--EKH 402

Query: 623 N---FFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           N     SC  D  +  + GD +  +  L  H  ++ AL +      VVS   D S++ W
Sbjct: 403 NGKFLMSCGYDKNINVYSGDSWNKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSW 461

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 99/236 (41%), Gaps = 30/236 (12%)

Query: 375 KLYTIE---------LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKT-HACIRTFE 423
           KL+T++         LQGH   V         + +A+AS + T ++W+ +T H  +    
Sbjct: 246 KLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHELLLQEG 305

Query: 424 CGYALTC-KFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRL 482
            G  + C  F   G+L+          ++D+ S          H   I+S+D +  G  +
Sbjct: 306 HGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAM-VLSGHTKPIYSVDWSPRGFEV 364

Query: 483 VTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDN-KFLA 541
            T S D TV  WD +   +          P++ + H++ +        ++    N KFL 
Sbjct: 365 ATASGDGTVNIWDIRKTNQ----------PQVLLAHNSIVS------GIRFEKHNGKFLM 408

Query: 542 VSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD 597
               D  + V+  +S      L GH   +L++D+      ++++  D+++K W +D
Sbjct: 409 SCGYDKNINVYSGDSWNKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 84/202 (41%), Gaps = 16/202 (7%)

Query: 33  SAGQILTGALEN--VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLL 90
           S+G +L    E+  V  + +++GEL ++         +     ++A     ++HP    +
Sbjct: 231 SSGDLLATGGEDGLVKLFTVQSGELRQV-------ADLQGHERRVAG---CRFHPFGRYI 280

Query: 91  AVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEV 150
           A    D   ++WD  +   L+   GH   +  L F   G+ L S   D   +IWD+    
Sbjct: 281 ASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGN 340

Query: 151 GLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAI- 208
               L  H   I  + W      + + S DG + IWD++     +  +AH S   G+   
Sbjct: 341 CAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFE 400

Query: 209 -HND-LVITTSTESQIKIWNLD 228
            HN   +++   +  I +++ D
Sbjct: 401 KHNGKFLMSCGYDKNINVYSGD 422

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 65/152 (42%), Gaps = 4/152 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L +  + +LL     D    IWD+ S    +  +GH   I  + + P G  + + S D  
Sbjct: 313 LAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATASGDGT 372

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCE--NEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           + IWD+        L +H   ++GI  E  N  +L+S   D  I ++   +   +     
Sbjct: 373 VNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNKITILKG 432

Query: 199 HTSECWG--LAIHNDLVITTSTESQIKIWNLD 228
           HT +     L  H+  V++   +  +K WN+D
Sbjct: 433 HTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 74/164 (45%), Gaps = 8/164 (4%)

Query: 69  DAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTV--LINFNGHKSAITVLRFD 126
           +A + K+ E   + ++   +LLA G  DG++K++ + S  +  + +  GH+  +   RF 
Sbjct: 218 NAHTGKVGE---VDWNSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFH 274

Query: 127 PTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLI-STSKDGLIKIW 185
           P G  + S S D+   +WD      L     H   +  +  +++  L+ S   D    IW
Sbjct: 275 PFGRYIASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIW 334

Query: 186 DLKTQQCVETHMAHTSECWGL--AIHNDLVITTSTESQIKIWNL 227
           D+++  C      HT   + +  +     V T S +  + IW++
Sbjct: 335 DIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDI 378

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 108/243 (44%), Gaps = 19/243 (7%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCKFL-PGGAL 438
            +GHR +V S+    DNK + T+S +GT+K+W+I++ +  R ++    +    + P    
Sbjct: 71  FEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHPNQGE 130

Query: 439 VVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKV 498
           ++  +R G+++++DL  +             + SL + SDG  LV  +       W+   
Sbjct: 131 LISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVWEMPN 190

Query: 499 DQE---LIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL- 554
             +   L P T  K  P               I  V +SSD K +A    D+T +++ + 
Sbjct: 191 HTDASNLKPATKFKAHPSY-------------ITRVLLSSDVKHMATCSADHTARIWSVE 237

Query: 555 NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMS 614
           ++     +L GH+  V     S DS  L+T+S+D  +++W L   D  +    H    + 
Sbjct: 238 DNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVC 297

Query: 615 VKF 617
           V  
Sbjct: 298 VAL 300

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 119/291 (40%), Gaps = 29/291 (9%)

Query: 399 LLATASNGTLKIWNIKTHACIRTFECGYALTCKF-LPGGALVVVGNRGGDLQLFDLASST 457
           L++   + T++ W   T  C+RT +   +   +  +     ++      +++L+D+ +S 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTSN 64

Query: 458 LLENKE-DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKI 516
                  + H   + S+    D K +VT S D T+K WD +     +P       P  ++
Sbjct: 65  SNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIR--SPSVPRNYKHNAPVNEV 122

Query: 517 -FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK-LPVLSID 574
             H    EL        IS D         D  ++++ L   +    L     +P+ S+ 
Sbjct: 123 VIHPNQGEL--------ISCDR--------DGNIRIWDLGENQCTHQLTPEDDVPLQSLS 166

Query: 575 ISFDSKLLITSSADKNIKIWGL----DFGDCHKS--LFAHQDSIMSVKFVPESHNFFSCS 628
           ++ D  +L+ ++   N  +W +    D  +   +    AH   I  V    +  +  +CS
Sbjct: 167 VASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCS 226

Query: 629 KDGLVKYWD-GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            D   + W   D F     L  HQ  VW  A S D+ ++V+ S DH +R+W
Sbjct: 227 ADHTARIWSVEDNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 125/292 (42%), Gaps = 28/292 (9%)

Query: 381 LQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHAC--IRTFEC--GYALTCKFLPGG 436
           +Q   + V  ++I++D KLLA A +  +++++IKT     + +FE   G   +  F    
Sbjct: 28  IQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQDN 87

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496
             +V  +  G ++++D+ S ++  N +  H A +  + +  +   L++   D  ++ WD 
Sbjct: 88  KWMVTSSEDGTIKVWDIRSPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 497 KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL-- 554
             +Q                 H  T E +  + ++ ++SD   L  +       V+ +  
Sbjct: 146 GENQ---------------CTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVWEMPN 190

Query: 555 ----NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGL-DFGDCHKSLFAHQ 609
               +++K       H   +  + +S D K + T SAD   +IW + D  +   +L  HQ
Sbjct: 191 HTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNFNLESTLDGHQ 250

Query: 610 DSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN 661
             +    F  +S    + S D  V+ WD    + +++   H      +A+++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCVALND 302

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 52/108 (48%), Gaps = 4/108 (3%)

Query: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           L A G+ +  I+++D+   +   + +F GH+  +T + F      +++ S+D  I +WD+
Sbjct: 47  LAAAGHQN--IRLYDIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDI 104

Query: 147 VGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
                    + +      +   N+  LIS  +DG I+IWDL   QC  
Sbjct: 105 RSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH 152

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 72/144 (50%), Gaps = 8/144 (5%)

Query: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-- 146
           L++ GY D  I+ W+ ++   L       S +  L       +L++ +   +I ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCLRTIQHPDSQVNRLEI-TNDKKLLAAAGHQNIRLYDIKT 62

Query: 147 VGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWG 205
                +     H+ ++T + + ++  W++++S+DG IK+WD+++   V  +  H +    
Sbjct: 63  SNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPS-VPRNYKHNAPVNE 121

Query: 206 LAIHNDL--VITTSTESQIKIWNL 227
           + IH +   +I+   +  I+IW+L
Sbjct: 122 VVIHPNQGELISCDRDGNIRIWDL 145

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 11/104 (10%)

Query: 43  ENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           +N+  +DIKT   + + +     G V          T + +  +   +     DG IK+W
Sbjct: 53  QNIRLYDIKTSNSNPVASFEGHRGNV----------TSVSFQQDNKWMVTSSEDGTIKVW 102

Query: 103 DLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           D+ S +V  N+  H + +  +   P    LIS  +D +I IWDL
Sbjct: 103 DIRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 123/293 (41%), Gaps = 34/293 (11%)

Query: 404 SNGTLKIWNIKTHA---CIRTFE-CGYALTC-KFLPGGALVVVGNRGGDLQLFDLASSTL 458
           S   +K+ N+++ A   C+ TF      +TC +F     L   G +   ++L+ L  + L
Sbjct: 396 SRDAIKLDNLQSAAPSVCMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPL 455

Query: 459 ---LENKED---------AHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGT 506
              L +K+           H   ++S   + D K L++ S DKTV+ W       L+   
Sbjct: 456 DSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLV--- 512

Query: 507 VDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH 566
                        +    N  +  V  S    + A +  D T +++  + +       GH
Sbjct: 513 -------------SYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGH 559

Query: 567 KLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFS 626
              V  +    +   + T S DK  ++W +  GD  +    H   ++S    P+     +
Sbjct: 560 LNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLST 619

Query: 627 CSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
            S+DG++  WD    + ++++  H ++ V++L+ S +   +VS   DHS+RVW
Sbjct: 620 GSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVW 672

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/282 (22%), Positives = 112/282 (39%), Gaps = 72/282 (25%)

Query: 361 IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACI 419
           +P ++RE       K+    L GH   V S   S DNK L +AS + T+++W++ T++ +
Sbjct: 459 LPSKQRE-------KINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSL 511

Query: 420 RTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDG 479
            +++                                          H   +W +  +  G
Sbjct: 512 VSYK-----------------------------------------GHNHPVWDVSFSPLG 530

Query: 480 KRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKF 539
               T S D+T + W           + D   P L+IF      LN D+  V    +  +
Sbjct: 531 HYFATASHDQTARLW-----------SCDHIYP-LRIFAG---HLN-DVDCVSFHPNGTY 574

Query: 540 LAVSLLDNTVKVFFL---NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGL 596
           +     D T +++ +   +S++ FL   GH  PV+S  +S D + L T S D  I +W +
Sbjct: 575 VFTGSTDKTCRMWDIGTGDSVRLFL---GHTAPVISTAVSPDGRWLSTGSEDGIINVWDI 631

Query: 597 DFGDCHKSLFAH-QDSIMSVKFVPESHNFFSCSKDGLVKYWD 637
             G   K +  H ++++ S+ +  E     S   D  V+ WD
Sbjct: 632 GTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD 673

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 67/151 (44%), Gaps = 5/151 (3%)

Query: 381 LQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
             GH  DV  +    +   + T S + T ++W+I T   +R F       ++    P G 
Sbjct: 556 FAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGR 615

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +  G+  G + ++D+ +   L+        A++SL  + +G  LV+G AD +V+ WD K
Sbjct: 616 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

Query: 498 VDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
             +       +   P    F D T  +N+DI
Sbjct: 676 --RSTAEPNTEPEQPFTSYFGDATTSVNNDI 704

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 66/157 (42%), Gaps = 9/157 (5%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L     D  +++W + + + L+++ GH   +  + F P G    + S D    
Sbjct: 484 FSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTAR 543

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           +W       +Y LR     +  + C     N  ++ + S D   ++WD+ T   V   + 
Sbjct: 544 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLG 600

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDM 233
           HT+     A+  D   + T S +  I +W++   K +
Sbjct: 601 HTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRL 637

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 69/151 (45%), Gaps = 4/151 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + + P  +  A    D   ++W       L  F GH + +  + F P GT + +GS D  
Sbjct: 524 VSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKT 583

Query: 141 IIIWDL-VGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +WD+  G+     L      I+     +  WL + S+DG+I +WD+ T + ++    H
Sbjct: 584 CRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 643

Query: 200 -TSECWGLAIHND--LVITTSTESQIKIWNL 227
             +  + L+   +  ++++   +  +++W+L
Sbjct: 644 GKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    +  G  D   ++WD+ +   +  F GH + +      P G  L +GS+D  
Sbjct: 566 VSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 625

Query: 141 IIIWDLVGEVGLYKLRSH-KDSITGI-WCENEDWLISTSKDGLIKIWDLK 188
           I +WD+     L ++R H K+++  + + +    L+S   D  +++WDLK
Sbjct: 626 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 64/168 (38%), Gaps = 22/168 (13%)

Query: 79  TYLQYHPETNLLAVGYADGVIKIWDL----------------ISKTVLINFNGHKSAITV 122
           T L++  +  L A G+ D  IK+W L                I+ T LI   GH   +  
Sbjct: 425 TCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI---GHSGTVYS 481

Query: 123 LRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGL 181
             F P    L+S S+D  + +W +     L   + H   +  + +     +  + S D  
Sbjct: 482 TSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQT 541

Query: 182 IKIWDLKTQQCVETHMAHTS--ECWGLAIHNDLVITTSTESQIKIWNL 227
            ++W       +     H +  +C     +   V T ST+   ++W++
Sbjct: 542 ARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDI 589

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 54/135 (40%), Gaps = 16/135 (11%)

Query: 110 LINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRS------------ 157
           +  F+     +T L F    T   +G +DS I +W L G     KL S            
Sbjct: 414 MYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI 473

Query: 158 -HKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH--NDLV 213
            H  ++    +  +  +L+S S+D  +++W + T   + ++  H    W ++        
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 214 ITTSTESQIKIWNLD 228
            T S +   ++W+ D
Sbjct: 534 ATASHDQTARLWSCD 548

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 100/229 (43%), Gaps = 21/229 (9%)

Query: 458 LLENKEDAHGAAIWSLDLTSDGKR--LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLK 515
           +L    + H   + SL  TS G+   LV+ S DKT+  W    D +     V  F     
Sbjct: 7   VLRGTLEGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNH 65

Query: 516 IFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI 575
           I  D  L           ++D  +   +  D T++++ + + + +    GHK  V+S+ I
Sbjct: 66  IVQDCAL-----------TADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAI 114

Query: 576 SFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVP------ESHNFFSCSK 629
              + ++I+ S DK IK+W +  GDC  +L  H D +  V+  P      ++    S   
Sbjct: 115 DRKASMIISGSRDKTIKVWSIK-GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGS 173

Query: 630 DGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           D +VK W+ ++F+       H + + ++  S D   V S   D  I +W
Sbjct: 174 DKMVKAWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLW 222

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 92/210 (43%), Gaps = 25/210 (11%)

Query: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534
           LT+DG   ++ S DKT++ W+    +     T  +F                D+++V I 
Sbjct: 72  LTADGAYALSASWDKTLRLWNVATGE-----TYQRFTGH-----------KSDVMSVAID 115

Query: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSK------LLITSSAD 588
                +     D T+KV+ +       +L GH   V  + ++ + K       LI++ +D
Sbjct: 116 RKASMIISGSRDKTIKVWSIKG-DCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSD 174

Query: 589 KNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLA 648
           K +K W ++          H + I S+   P+     S  KDG +  W+  +   +  L+
Sbjct: 175 KMVKAWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLS 234

Query: 649 AHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           A Q EV+ALA S + R+ ++ +    I+V+
Sbjct: 235 A-QDEVFALAFSPN-RYWLTAATATGIKVY 262

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 10/141 (7%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++W++ +      F GHKS +  +  D   + +ISGS+D  I +W + G+  L  L
Sbjct: 85  DKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIKGDC-LATL 143

Query: 156 RSHKDSITGIWC----ENED---WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAI 208
             H D ++ +      + ED    LIS   D ++K W++   Q     + H +    +  
Sbjct: 144 LGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNYINSITA 203

Query: 209 HND--LVITTSTESQIKIWNL 227
             D  LV +   +  I +WNL
Sbjct: 204 SPDGSLVASAGKDGDIMLWNL 224

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 75/162 (46%), Gaps = 9/162 (5%)

Query: 34  AGQILTGALE-NVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAV 92
           A  I++G+ +  +  W IK   L+ +L      G  D  S         Q      L++ 
Sbjct: 118 ASMIISGSRDKTIKVWSIKGDCLATLL------GHNDWVSQVRVAPNEKQEDDNVTLISA 171

Query: 93  GYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGL 152
           G +D ++K W++    +  +F GH + I  +   P G+ + S  KD DI++W+L  +  L
Sbjct: 172 G-SDKMVKAWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPL 230

Query: 153 YKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
           Y L +  +     +  N  WL + +  G IK++ L+ +  ++
Sbjct: 231 YTLSAQDEVFALAFSPNRYWLTAATATG-IKVYSLEDEVLID 271

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 62/157 (39%), Gaps = 15/157 (9%)

Query: 86  ETNLLAVGYADGVIKIWDLISK-----TVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + NLL     D  +  W L          + +F GH   +        G   +S S D  
Sbjct: 28  QPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDCALTADGAYALSASWDKT 87

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENE-DWLISTSKDGLIKIWDLKTQQCVETHMAH 199
           + +W++       +   HK  +  +  + +   +IS S+D  IK+W +K   C+ T + H
Sbjct: 88  LRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIK-GDCLATLLGH 146

Query: 200 TSECWGLAIH--------NDLVITTSTESQIKIWNLD 228
                 + +         N  +I+  ++  +K WN++
Sbjct: 147 NDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNIN 183

 Score = 34.7 bits (78), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 12/122 (9%)

Query: 383 GHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFEC-GYALTCKFLPGGALVV 440
           GH   + SI  S D  L+A+A  +G + +WN+K    + T           F P    + 
Sbjct: 193 GHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVFALAFSPNRYWLT 252

Query: 441 VGNRGGDLQLFDLASSTLLEN--------KEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
                G ++++ L    L++          + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 253 AATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPHAV-SLTWSADGQTLFAGYTDSIIR 310

Query: 493 FW 494
            W
Sbjct: 311 VW 312

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 139/335 (41%), Gaps = 52/335 (15%)

Query: 370 RPAPNKLYTIELQGHR----TDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRT--- 421
           R    ++ ++EL G +      + ++ +S DN  +AT S  G ++I N +T   +     
Sbjct: 156 RAELGRMASLELAGSQLVSTRPISAVSLSPDNDYIATGSWAGDIRILNSQTLQSLAQKLD 215

Query: 422 FECGYALTCKFLPGGALVVVG-------------NRGGDLQLFDLASSTLLENKEDAHGA 468
              G     ++ P     ++              N  GDL+L      +L+      H  
Sbjct: 216 SHVGKIGAVQWHPESNNQIISCAEDGLIKNFQYLNEEGDLRLL----GSLV-----GHER 266

Query: 469 AIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
            +  L     GK + + S D T + WD    QEL+          L+  H         +
Sbjct: 267 RVSDLKYHPSGKFIGSASHDMTWRLWDASTYQELL----------LQEGHAKG------V 310

Query: 529 LAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSAD 588
             +    D   +    +D+   ++ + S    +SL GH  PV ++D S +   + T   D
Sbjct: 311 FCLSFQCDGSLVCSGGMDSLAMIWDIRSGNKVMSLTGHSKPVYTVDWSPNGYQVATGGGD 370

Query: 589 KNIKIWGL---DFGDCHKSLFAHQDSIMSVKFVPESHN--FFSCSKDGLVKYWDGDKFEC 643
             I +W +   D G  H+ + AH++ +  V+F  + +     SC  D L+  +  D +  
Sbjct: 371 GLINVWDIRQRDGGQVHQ-ILAHRNIVTKVQFSKDDNGKKLISCGYDNLINVYSSDNWLK 429

Query: 644 VQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           V  L  H  ++ +L ISND++++VS   D S+++W
Sbjct: 430 VASLEGHTDKIISLDISNDSKYLVSGGWDRSVKIW 464

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 3/122 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L+YHP    +     D   ++WD  +   L+   GH   +  L F   G+ + SG  DS 
Sbjct: 271 LKYHPSGKFIGSASHDMTWRLWDASTYQELLLQEGHAKGVFCLSFQCDGSLVCSGGMDSL 330

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETH--M 197
            +IWD+     +  L  H   +  + W  N   + +   DGLI +WD++ +   + H  +
Sbjct: 331 AMIWDIRSGNKVMSLTGHSKPVYTVDWSPNGYQVATGGGDGLINVWDIRQRDGGQVHQIL 390

Query: 198 AH 199
           AH
Sbjct: 391 AH 392

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 74/153 (48%), Gaps = 7/153 (4%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           L +  + +L+  G  D +  IWD+ S   +++  GH   +  + + P G ++ +G  D  
Sbjct: 313 LSFQCDGSLVCSGGMDSLAMIWDIRSGNKVMSLTGHSKPVYTVDWSPNGYQVATGGGDGL 372

Query: 141 IIIWDLVGEVG--LYKLRSHKDSITGIWCENED---WLISTSKDGLIKIWDLKTQQCVET 195
           I +WD+    G  ++++ +H++ +T +    +D    LIS   D LI ++       V +
Sbjct: 373 INVWDIRQRDGGQVHQILAHRNIVTKVQFSKDDNGKKLISCGYDNLINVYSSDNWLKVAS 432

Query: 196 HMAHTSECWGLAIHND--LVITTSTESQIKIWN 226
              HT +   L I ND   +++   +  +KIWN
Sbjct: 433 LEGHTDKIISLDISNDSKYLVSGGWDRSVKIWN 465

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 73/155 (47%), Gaps = 8/155 (5%)

Query: 81  LQYHPETNLLAVGYA-DGVIKIWDLISK----TVLINFNGHKSAITVLRFDPTGTRLISG 135
           +Q+HPE+N   +  A DG+IK +  +++     +L +  GH+  ++ L++ P+G  + S 
Sbjct: 224 VQWHPESNNQIISCAEDGLIKNFQYLNEEGDLRLLGSLVGHERRVSDLKYHPSGKFIGSA 283

Query: 136 SKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLI-STSKDGLIKIWDLKTQQCVE 194
           S D    +WD      L     H   +  +  + +  L+ S   D L  IWD+++   V 
Sbjct: 284 SHDMTWRLWDASTYQELLLQEGHAKGVFCLSFQCDGSLVCSGGMDSLAMIWDIRSGNKVM 343

Query: 195 THMAHTSECWGL--AIHNDLVITTSTESQIKIWNL 227
           +   H+   + +  + +   V T   +  I +W++
Sbjct: 344 SLTGHSKPVYTVDWSPNGYQVATGGGDGLINVWDI 378

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 14/127 (11%)

Query: 379 IELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFEC----GYALTCKFL 433
           + L GH   V ++D S +   +AT   +G + +W+I+     +  +           +F 
Sbjct: 343 MSLTGHSKPVYTVDWSPNGYQVATGGGDGLINVWDIRQRDGGQVHQILAHRNIVTKVQFS 402

Query: 434 P---GGALVVVGNRGGDLQLFDLASST--LLENKEDAHGAAIWSLDLTSDGKRLVTGSAD 488
               G  L+  G       L ++ SS   L     + H   I SLD+++D K LV+G  D
Sbjct: 403 KDDNGKKLISCGYD----NLINVYSSDNWLKVASLEGHTDKIISLDISNDSKYLVSGGWD 458

Query: 489 KTVKFWD 495
           ++VK W+
Sbjct: 459 RSVKIWN 465

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 101/443 (22%), Positives = 177/443 (39%), Gaps = 111/443 (25%)

Query: 83  YHPETN-LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDI 141
           + P T+  +  G  D   +IWD  ++T +    GH + +  + + P G  + +GS D+ I
Sbjct: 151 FAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTI 210

Query: 142 IIWD-----LVGEVGLYKLRSHKDSITGIWCE--------NEDWLISTSKDGLIKIWDLK 188
            +W+      VG+     LR H   IT +  E         +  L S SKDG IKIWD  
Sbjct: 211 RLWEGNKGQPVGDA----LRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTT 266

Query: 189 TQQCVETHMAHTSEC----WGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYE 244
            + C+ T   HTS      WG      ++ + S +  I+ W+++L    G K I   I +
Sbjct: 267 RRVCLITLSGHTSSVSCIKWG---GQGVLYSGSHDKTIRAWDMNL----GGKCIN--ILK 317

Query: 245 KQS---KQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISK-ALRKREKRLRDK 300
             +       +S ++           I   D T E  +  T EE  K AL+  EK  +  
Sbjct: 318 SHAHWVNHLSLSTDYA--------LRIGAFDHTSE--KPSTPEEAQKRALKNYEKIAKRN 367

Query: 301 GMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYS 360
           G  +                                         E+++T S++   Y  
Sbjct: 368 GEVE-----------------------------------------ELMVTASDDFTMYLW 386

Query: 361 IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACI 419
            P +  +P            + GH+  V  +  S D + + +AS + ++K+WN +    I
Sbjct: 387 NPLKSTKP---------ITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFI 437

Query: 420 RTF--------ECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIW 471
            TF        +  ++  C+ L      V  ++   L+++D+ +  L  +    H   ++
Sbjct: 438 STFRGHVASVYQVAWSSDCRLL------VSCSKDTTLKVWDVKTKKLAVDLP-GHKDEVY 490

Query: 472 SLDLTSDGKRLVTGSADKTVKFW 494
           ++D + DGKR+ +G  DK V+ W
Sbjct: 491 TVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 124/283 (43%), Gaps = 21/283 (7%)

Query: 398 KLLATASNGTLKIWNIKTHACIRTFECGY--ALTCKFLPGGALVVVGNRGGDLQLFDLAS 455
           +L + + +GT+KIW+     C+ T   G+  +++C    G  ++  G+    ++ +D+  
Sbjct: 250 RLASASKDGTIKIWDTTRRVCLITLS-GHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNL 308

Query: 456 STLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLK 515
                N   +H   +  L L++D   L  G+ D T +           P T ++   +  
Sbjct: 309 GGKCINILKSHAHWVNHLSLSTD-YALRIGAFDHTSE----------KPSTPEEAQKRAL 357

Query: 516 IFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDI 575
             ++   + N ++  + +++ + F     L N +K     S K    + GH+  V  +  
Sbjct: 358 KNYEKIAKRNGEVEELMVTASDDF--TMYLWNPLK-----STKPITRMTGHQKLVNHVAF 410

Query: 576 SFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKY 635
           S D + ++++S D +IK+W    G    +   H  S+  V +  +     SCSKD  +K 
Sbjct: 411 SPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 470

Query: 636 WDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           WD    +    L  H+ EV+ +  S D + V S   D  +R+W
Sbjct: 471 WDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 66/144 (45%), Gaps = 15/144 (10%)

Query: 546 DNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW----GLDFGDC 601
           DNT +++  N+     +L GH   VL +  S D +L+ T S D  I++W    G   GD 
Sbjct: 165 DNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGD- 223

Query: 602 HKSLFAHQDSIMSVKFVP-------ESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654
             +L  H   I S+ + P       +     S SKDG +K WD  +  C+  L+ H S V
Sbjct: 224 --ALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSV 281

Query: 655 WALAISNDARFVVSTSHDHSIRVW 678
             +        + S SHD +IR W
Sbjct: 282 SCIKWGGQG-VLYSGSHDKTIRAW 304

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 83/352 (23%), Positives = 144/352 (40%), Gaps = 44/352 (12%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDL-ISKTVLINFNGHKSAITVLRFDP-------TGTRL 132
           + + P+  L+A G  D  I++W+    + V     GH   IT L ++P          RL
Sbjct: 192 VSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRL 251

Query: 133 ISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLK-TQQ 191
            S SKD  I IWD    V L  L  H  S++ I    +  L S S D  I+ WD+    +
Sbjct: 252 ASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGGK 311

Query: 192 CVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGI---YEKQSK 248
           C+    +H          N L ++T    +I  ++   +K    +  +K     YEK +K
Sbjct: 312 CINILKSHAHWV------NHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAK 365

Query: 249 QRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRT--QEEISKALRKREKRLRDKGMADEK 306
           + G   E + T+      Y+ N  K+ +     T  Q+ ++      + R       D  
Sbjct: 366 RNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNS 425

Query: 307 IQ-QNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTS-NNTVEYYSIPYQ 364
           I+  N +D           T R      A+ + V  +S   ++++ S + T++ + +  +
Sbjct: 426 IKLWNGRDGKF------ISTFRGHV---ASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTK 476

Query: 365 KREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTH 416
           K             ++L GH+ +V ++D S D K +   S G  K+  + TH
Sbjct: 477 K-----------LAVDLPGHKDEVYTVDWSVDGKRV--CSGGKDKMVRLWTH 515

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 87/204 (42%), Gaps = 29/204 (14%)

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDD-ILAVKISSDNKF 539
           R++TG+ D T + WD      +                 +TL+ + + +L V  S D + 
Sbjct: 158 RMITGAGDNTARIWDCNTQTPM-----------------STLKGHFNWVLCVSWSPDGEL 200

Query: 540 LAVSLLDNTVKVFFLN-SMKFFLSLYGHKLPVLSIDI-------SFDSKLLITSSADKNI 591
           +A   +DNT++++  N       +L GH   + S+               L ++S D  I
Sbjct: 201 IATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTI 260

Query: 592 KIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGD-KFECVQKLAAH 650
           KIW      C  +L  H  S+  +K+  +    +S S D  ++ WD +   +C+  L +H
Sbjct: 261 KIWDTTRRVCLITLSGHTSSVSCIKWGGQG-VLYSGSHDKTIRAWDMNLGGKCINILKSH 319

Query: 651 QSEVWALAISNDARFVVSTSHDHS 674
              V  L++S D    +  + DH+
Sbjct: 320 AHWVNHLSLSTDYALRIG-AFDHT 342

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 80  YLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDS 139
           ++ + P+   +     D  IK+W+      +  F GH +++  + +      L+S SKD+
Sbjct: 407 HVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDT 466

Query: 140 DIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIW 185
            + +WD+  +     L  HKD +  + W  +   + S  KD ++++W
Sbjct: 467 TLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 109/297 (36%), Gaps = 53/297 (17%)

Query: 425 GYALTCK-FLP-GGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRL 482
           G  + C  F P   + ++ G      +++D  + T +   +  H   +  +  + DG+ +
Sbjct: 143 GSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLK-GHFNWVLCVSWSPDGELI 201

Query: 483 VTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAV 542
            TGS D T++ W+    Q +     D      K     + E    I  VK     + LA 
Sbjct: 202 ATGSMDNTIRLWEGNKGQPV----GDALRGHGKWITSLSWE---PIHLVKPGQKPR-LAS 253

Query: 543 SLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD-C 601
           +  D T+K++        ++L GH   V  I       +L + S DK I+ W ++ G  C
Sbjct: 254 ASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQG-VLYSGSHDKTIRAWDMNLGGKC 312

Query: 602 HKSLFAHQ-------------------DSIMSVKFVPESHN------------------- 623
              L +H                    D        PE                      
Sbjct: 313 INILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEE 372

Query: 624 -FFSCSKDGLVKYWDGDK-FECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
              + S D  +  W+  K  + + ++  HQ  V  +A S D R +VS S D+SI++W
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLW 429

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 562 SLYGHKLPVL-SIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPE 620
           ++ GH   +L S      S  +IT + D   +IW  +      +L  H + ++ V + P+
Sbjct: 138 AIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPD 197

Query: 621 SHNFFSCSKDGLVKYWDGDKFECV-QKLAAHQSEVWALAISNDARFVV---------STS 670
                + S D  ++ W+G+K + V   L  H    W  ++S +   +V         S S
Sbjct: 198 GELIATGSMDNTIRLWEGNKGQPVGDALRGHGK--WITSLSWEPIHLVKPGQKPRLASAS 255

Query: 671 HDHSIRVW 678
            D +I++W
Sbjct: 256 KDGTIKIW 263

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/305 (20%), Positives = 127/305 (41%), Gaps = 41/305 (13%)

Query: 376 LYTIELQGHRTDVRSIDISDDNKLLATA-SNGTLKIWNIKTHACIRTFECGYALTCKFLP 434
           +YT   Q    D+  ++ SDD ++ A    +  +KIW++           G +L      
Sbjct: 460 MYT--FQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLD----------GSSLN----- 502

Query: 435 GGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFW 494
               +++ +   + +  D    TL+      H   ++S   + D K L++GS DKTV+ W
Sbjct: 503 -NPNIMLNSANNNYRDDDPTCKTLV-----GHSGTVYSTSFSPDNKYLLSGSEDKTVRLW 556

Query: 495 DFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL 554
                  L+                +    N  +  V  S    + A +  D T +++  
Sbjct: 557 SMDTHTALV----------------SYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSC 600

Query: 555 NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMS 614
           + +       GH   V  +    +   + T S+DK  ++W +  GD  +    H   ++ 
Sbjct: 601 DHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIC 660

Query: 615 VKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDARFVVSTSHDH 673
           +   P+     + S+DG++  WD    + ++++  H ++ +++L+ S +   ++S   DH
Sbjct: 661 IAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADH 720

Query: 674 SIRVW 678
           S+RVW
Sbjct: 721 SVRVW 725

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 68/157 (43%), Gaps = 9/157 (5%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L  G  D  +++W + + T L+++ GH   +  + F P G    + S D    
Sbjct: 537 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 596

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           +W       +Y LR     +  + C     N  ++ + S D   ++WD+ T   V   + 
Sbjct: 597 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 653

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDM 233
           HT+    +A+  D   + T S +  I IW++   K +
Sbjct: 654 HTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 690

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    +  G +D   ++WD+ +   +  F GH + +  +   P G  L +GS+D  
Sbjct: 619 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 678

Query: 141 IIIWDLVGEVGLYKLRSH-KDSITGI-WCENEDWLISTSKDGLIKIWDLK 188
           I IWD+     L ++R H K++I  + + +  + LIS   D  +++WDLK
Sbjct: 679 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 67/151 (44%), Gaps = 5/151 (3%)

Query: 381 LQGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
             GH  DV  +    +   + T +S+ T ++W++ T   +R F       +     P G 
Sbjct: 609 FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGR 668

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +  G+  G + ++D+ +   L+        AI+SL  + +G  L++G AD +V+ WD K
Sbjct: 669 WLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

Query: 498 VDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
             +     + +   P +    D T  +N DI
Sbjct: 729 --KATTEPSAEPDEPFIGYLGDVTASINQDI 757

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 88/215 (40%), Gaps = 18/215 (8%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + + P  +  A    D   ++W       L  F GH + +  + F P G  + +GS D  
Sbjct: 577 VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKT 636

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +WD+     +     H   +  I    +  WL + S+DG+I IWD+ T + ++    H
Sbjct: 637 CRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGH 696

Query: 200 TSEC-WGLAI--HNDLVITTSTESQIKIWNL---------DLDKDMGSKLIEKGIYEKQS 247
                + L+     +++I+   +  +++W+L         + D+     L +      Q 
Sbjct: 697 GKNAIYSLSYSKEGNVLISGGADHSVRVWDLKKATTEPSAEPDEPFIGYLGDVTASINQD 756

Query: 248 -KQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVR 281
            K+ G     I TSD V  FY     K   +F+V+
Sbjct: 757 IKEYGRRRTVIPTSDLVASFYT----KKTPVFKVK 787

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 94/215 (43%), Gaps = 17/215 (7%)

Query: 465 AHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLEL 524
            H   ++S   + D K L++GS DKTV+ W       L+                +    
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 566

Query: 525 NDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLIT 584
           N  +  V  S    + A +  D T +++  + +       GH   V  +    +   + T
Sbjct: 567 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECV 644
            S+DK  ++W +  GD  +    H   ++S+   P+     + S+DG++  WD    + +
Sbjct: 627 GSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRL 686

Query: 645 QKLAAH-QSEVWALAISNDARFVVSTSHDHSIRVW 678
           +++  H ++ +++L+ S +   ++S   DH++RVW
Sbjct: 687 KQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVW 721

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 71/171 (41%), Gaps = 17/171 (9%)

Query: 525 NDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFL-----------------SLYGHK 567
           N D+  +  S D +  A    D+ +K++ L+                       +L GH 
Sbjct: 466 NKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHS 525

Query: 568 LPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSC 627
             V S   S D+K L++ S DK +++W +D      S   H   +  V F P  H F + 
Sbjct: 526 GTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATA 585

Query: 628 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           S D   + W  D    ++  A H ++V  ++   +  +V + S D + R+W
Sbjct: 586 SHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMW 636

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 104/262 (39%), Gaps = 65/262 (24%)

Query: 381 LQGHRTDVRSIDISDDNK-LLATASNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALV 439
           L GH   V S   S DNK LL+ + + T+++W++ TH  + +++                
Sbjct: 521 LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK---------------- 564

Query: 440 VVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVD 499
                                     H   +W +  +  G    T S D+T + W     
Sbjct: 565 -------------------------GHNHPVWDVSFSPLGHYFATASHDQTARLW----- 594

Query: 500 QELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL---NS 556
                 + D   P L+IF      LN D+  V    +  ++     D T +++ +   +S
Sbjct: 595 ------SCDHIYP-LRIFAG---HLN-DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 643

Query: 557 MKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMSV 615
           ++ FL   GH  PV+SI +  D + L T S D  I +W +  G   K +  H +++I S+
Sbjct: 644 VRLFL---GHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 700

Query: 616 KFVPESHNFFSCSKDGLVKYWD 637
            +  E +   S   D  V+ WD
Sbjct: 701 SYSKEGNVLISGGADHTVRVWD 722

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 109/266 (40%), Gaps = 30/266 (11%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           + P+   L  G  D  +++W + + T L+++ GH   +  + F P G    + S D    
Sbjct: 533 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTAR 592

Query: 143 IWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
           +W       +Y LR     +  + C     N  ++ + S D   ++WD+ T   V   + 
Sbjct: 593 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 649

Query: 199 HTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSKQRGVSVEF 256
           HT+    +A+  D   + T S +  I +W++   K +           KQ +  G +  +
Sbjct: 650 HTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRL-----------KQMRGHGKNAIY 698

Query: 257 -ITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMADEKIQQNIKDS- 314
            ++ S   N      AD TV ++ ++ +     +    E  +   G     I Q+IK+  
Sbjct: 699 SLSYSKEGNVLISGGADHTVRVWDLK-KATTEPSAEPDEPFIGYLGDVTASINQDIKEYG 757

Query: 315 ------YVSVIMHPFQTIRSP-FKIK 333
                   S ++  F T ++P FK+K
Sbjct: 758 RRRTVIPTSDLVASFYTKKTPVFKVK 783

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 67/151 (44%), Gaps = 4/151 (2%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + + P  +  A    D   ++W       L  F GH + +  + F P G  + +GS D  
Sbjct: 573 VSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKT 632

Query: 141 IIIWDLVGEVGLYKLRSHKDSITGIW-CENEDWLISTSKDGLIKIWDLKTQQCVETHMAH 199
             +WD+     +     H   +  I  C +  WL + S+DG+I +WD+ T + ++    H
Sbjct: 633 CRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 692

Query: 200 TSEC-WGLAI--HNDLVITTSTESQIKIWNL 227
                + L+     +++I+   +  +++W+L
Sbjct: 693 GKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 68/151 (45%), Gaps = 5/151 (3%)

Query: 381 LQGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
             GH  DV  +    +   + T +S+ T ++W++ T   +R F       ++    P G 
Sbjct: 605 FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGR 664

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 497
            +  G+  G + ++D+ +   L+        AI+SL  + +G  L++G AD TV+ WD K
Sbjct: 665 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

Query: 498 VDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
             +     + +   P +    D T  +N DI
Sbjct: 725 --KATTEPSAEPDEPFIGYLGDVTASINQDI 753

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
           + +HP    +  G +D   ++WD+ +   +  F GH + +  +   P G  L +GS+D  
Sbjct: 615 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGI 674

Query: 141 IIIWDLVGEVGLYKLRSH-KDSITGI-WCENEDWLISTSKDGLIKIWDLK 188
           I +WD+     L ++R H K++I  + + +  + LIS   D  +++WDLK
Sbjct: 675 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

>SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {ON}
           highly similar to uniprot|P41318 Saccharomyces
           cerevisiae YNL006W LST8 Protein required for the
           transport of amino acid permease Gap1p from the Golgi to
           the cell surface component of the TOR signaling pathway
           associates with both Tor1p and Tor2p contains a
           WD-repeat
          Length = 303

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 111/257 (43%), Gaps = 33/257 (12%)

Query: 373 PNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK 431
           PN + + E  GHR +V SI    DNK + ++S +GT+K+W+++  +  R ++        
Sbjct: 65  PNPVTSFE--GHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYK-------H 115

Query: 432 FLPGGALVVVGNRG--------GDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLV 483
             P   +V+  N+G        G+++++DL  +             + SL + SDG  LV
Sbjct: 116 HAPVNEVVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLV 175

Query: 484 TGSADKTVKFWDFKVDQELIPGTVD--KFVPKLKIFHDTTLELNDDILAVKISSDNKFLA 541
            G+       W        +P   D     P  K    T       I  V +SSD K LA
Sbjct: 176 AGNNKGNCYVWQ-------MPNHTDAANLKPVTKFRSHTKY-----ITRVLLSSDVKHLA 223

Query: 542 VSLLDNTVKVFFL-NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600
               D+T +V+ + ++ K   +L GH+  V     S DS  L+T+ +D  +++W L   +
Sbjct: 224 TCSADHTARVWSIEDNFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTRE 283

Query: 601 CHKSLFAHQDSIMSVKF 617
             +    H    + V  
Sbjct: 284 IVRQYGGHHKGAVCVAL 300

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 91/204 (44%), Gaps = 29/204 (14%)

Query: 482 LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLA 541
           L +   D T++FW      E + G   +          T    +  +  ++I+SD +FLA
Sbjct: 5   LASAGYDHTIRFW------EALTGVCSR----------TIQHADSQVNRLEITSDKRFLA 48

Query: 542 ------VSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWG 595
                 V L D  ++    N +  F    GH+  V SI    D+K +++SS D  IK+W 
Sbjct: 49  AAGHLHVRLYD--IRTTNPNPVTSF---EGHRGNVTSISFQQDNKWMVSSSEDGTIKVWD 103

Query: 596 LDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH-QSEV 654
           +      ++ + H   +  V   P      SC +DG ++ WD  + +C  +L     + +
Sbjct: 104 VRAPSVQRN-YKHHAPVNEVVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPL 162

Query: 655 WALAISNDARFVVSTSHDHSIRVW 678
            +L+I++D   +V+ ++  +  VW
Sbjct: 163 QSLSIASDGSMLVAGNNKGNCYVW 186

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 115/297 (38%), Gaps = 40/297 (13%)

Query: 399 LLATAS-NGTLKIWNIKTHACIRTFECGYALTCK--------FLPGGALVVVGNRGGDLQ 449
           +LA+A  + T++ W   T  C RT +   +   +        FL     + V  R  D++
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHV--RLYDIR 61

Query: 450 LFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDK 509
             +    T  E     H   + S+    D K +V+ S D T+K WD +            
Sbjct: 62  TTNPNPVTSFE----GHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRA----------- 106

Query: 510 FVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK-L 568
             P ++  +     +N+    V I  +   L     D  ++++ L   +    L      
Sbjct: 107 --PSVQRNYKHHAPVNE----VVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDT 160

Query: 569 PVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFVPESH 622
           P+ S+ I+ D  +L+  +   N  +W +       +L       +H   I  V    +  
Sbjct: 161 PLQSLSIASDGSMLVAGNNKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVK 220

Query: 623 NFFSCSKDGLVKYWD-GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           +  +CS D   + W   D F+    L  HQ  VW  A S D+ ++V+   DH +R+W
Sbjct: 221 HLATCSADHTARVWSIEDNFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLW 277

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 4/108 (3%)

Query: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           L A G+    ++++D+   +   + +F GH+  +T + F      ++S S+D  I +WD+
Sbjct: 47  LAAAGHLH--VRLYDIRTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDV 104

Query: 147 VGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
                    + H      +   N+  LIS  +DG I+IWDL   QC  
Sbjct: 105 RAPSVQRNYKHHAPVNEVVIHPNQGELISCDQDGNIRIWDLGENQCTH 152

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 69/144 (47%), Gaps = 8/144 (5%)

Query: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-- 146
           L + GY D  I+ W+ ++           S +  L    +  R ++ +    + ++D+  
Sbjct: 5   LASAGY-DHTIRFWEALTGVCSRTIQHADSQVNRLEI-TSDKRFLAAAGHLHVRLYDIRT 62

Query: 147 VGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWG 205
                +     H+ ++T I + ++  W++S+S+DG IK+WD++    V+ +  H +    
Sbjct: 63  TNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPS-VQRNYKHHAPVNE 121

Query: 206 LAIHNDL--VITTSTESQIKIWNL 227
           + IH +   +I+   +  I+IW+L
Sbjct: 122 VVIHPNQGELISCDQDGNIRIWDL 145

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 1/97 (1%)

Query: 65  PGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLR 124
           P  V +        T + +  +   +     DG IK+WD+ + +V  N+  H + +  + 
Sbjct: 65  PNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYK-HHAPVNEVV 123

Query: 125 FDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDS 161
             P    LIS  +D +I IWDL      ++L    D+
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDT 160

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/326 (20%), Positives = 127/326 (38%), Gaps = 64/326 (19%)

Query: 339 VTTTSKLEMVLTTSNNTVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNK 398
           +T T+  +++    +  V+ Y I       T P P        +GHR +V S+   +DN+
Sbjct: 38  LTITNDKKLLAAAGHQNVKLYDI-----NTTNPNP----VASFEGHRGNVTSLSFQNDNR 88

Query: 399 LLATAS-NGTLKIWNIKTHACIRTFECGYALT-CKFLPGGALVVVGNRGGDLQLFDLASS 456
            + T+S +GT+K+W++++ +  RT++    +      P    ++  +R G+++++DL  +
Sbjct: 89  WMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGEN 148

Query: 457 TLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKI 516
                        + SL L +DG  LV  ++      W+       +P   D        
Sbjct: 149 QCTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWE-------MPNRTDA------- 194

Query: 517 FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDIS 576
                                                 +++K       H   +  I +S
Sbjct: 195 --------------------------------------SNLKPVTKFRAHDAYITRILLS 216

Query: 577 FDSKLLITSSADKNIKIWGLDFG-DCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKY 635
            D K L T SAD   +IW +D   + H +L  HQ  +    F  +S    + S D  V+ 
Sbjct: 217 SDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRL 276

Query: 636 WDGDKFECVQKLAAHQSEVWALAISN 661
           WD    E V++ + H      +A+++
Sbjct: 277 WDLSTREIVRQYSGHHKGAVCVALND 302

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 117/290 (40%), Gaps = 27/290 (9%)

Query: 399 LLATASNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGG-DLQLFDLASST 457
           L++   + T++ W   T  C RT +   +   +        ++   G  +++L+D+ ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDINTTN 64

Query: 458 LLENKE-DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKI 516
                  + H   + SL   +D + +VT S D T+K WD +             VP+   
Sbjct: 65  PNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVR----------SPSVPR--- 111

Query: 517 FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK-LPVLSIDI 575
               T + N  +  V I  +   L     D  ++++ L   +    L      PV S+ +
Sbjct: 112 ----TYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLSL 167

Query: 576 SFDSKLLITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFVPESHNFFSCSK 629
           + D  +L+ +++  N  +W +       +L       AH   I  +    +     +CS 
Sbjct: 168 ATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSA 227

Query: 630 DGLVKYWD-GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           D   + W   D F     L  HQ  VW  A S D+ ++++ S DH +R+W
Sbjct: 228 DHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLW 277

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 92/220 (41%), Gaps = 20/220 (9%)

Query: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           L A G+ +  +K++D+   +   + +F GH+  +T L F      +++ S+D  I +WD 
Sbjct: 47  LAAAGHQN--VKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWD- 103

Query: 147 VGEVGLYKLRSHKDSITGIWCE-NEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS---- 201
           V    + +   H   +  +    N+  LIS  +DG I+IWDL   QC  TH         
Sbjct: 104 VRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQC--THQLTPEDDTP 161

Query: 202 -ECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGS-KLIEKGIYEKQSKQRGVSVEFITT 259
            +   LA    +++  +++    +W +    D  + K + K       +     +  I  
Sbjct: 162 VQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTK------FRAHDAYITRILL 215

Query: 260 SDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRD 299
           S  V F    +AD T  I+ +     +   L   ++ + D
Sbjct: 216 SSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWD 255

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 73/144 (50%), Gaps = 8/144 (5%)

Query: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-- 146
           L++ GY D  I+ W+ ++           S +  L       +L++ +   ++ ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLTI-TNDKKLLAAAGHQNVKLYDINT 62

Query: 147 VGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWG 205
                +     H+ ++T +  +N++ W++++S+DG IK+WD+++     T+  H +    
Sbjct: 63  TNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRSPSVPRTY-KHNAPVNE 121

Query: 206 LAIHNDL--VITTSTESQIKIWNL 227
           +AIH +   +I+   +  I+IW+L
Sbjct: 122 VAIHPNQGELISCDRDGNIRIWDL 145

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 84/205 (40%), Gaps = 21/205 (10%)

Query: 43  ENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           +NV  +DI T            P  V +        T L +  +   +     DG IK+W
Sbjct: 53  QNVKLYDINTTN----------PNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVW 102

Query: 103 DLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSI 162
           D+ S +V   +  H + +  +   P    LIS  +D +I IWDL      ++L    D+ 
Sbjct: 103 DVRSPSVPRTYK-HNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTP 161

Query: 163 TGIWCENED--WLISTSKDGLIKIWDLKTQ------QCVETHMAHTSECWGLAIHNDL-- 212
                   D   L++ +  G   +W++  +      + V    AH +    + + +D+  
Sbjct: 162 VQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKF 221

Query: 213 VITTSTESQIKIWNLDLDKDMGSKL 237
           + T S +   +IW++D + ++ + L
Sbjct: 222 LATCSADHTARIWSIDDNFNLHTTL 246

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 86/203 (42%), Gaps = 18/203 (8%)

Query: 482 LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLA 541
           L++GS DK++  W    D +     V  F     I  D T           ++ D ++  
Sbjct: 33  LLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT-----------VTPDGEYAL 81

Query: 542 VSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDC 601
            +  D TV+++ L S K      GHK  VLS+ I   +  ++++S DK +K+W    G+C
Sbjct: 82  SASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNT-LGEC 140

Query: 602 HKSLFAHQDSIMSVKFVP------ESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVW 655
             +L  H D +  V+  P      E+    S   D +VK W+   F+       H + V 
Sbjct: 141 MVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVN 200

Query: 656 ALAISNDARFVVSTSHDHSIRVW 678
            +  S D   V S   D  I +W
Sbjct: 201 TVTASPDGTLVASAGKDGQIMLW 223

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D V+K+W+L S  +  +F GH + +  +   P GT + S  KD  I++W+L  +  LY L
Sbjct: 175 DKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTL 234

Query: 156 RSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVE 194
            +  +     +  N  WL + +  G IKI++L+ ++ V+
Sbjct: 235 NAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 58/123 (47%), Gaps = 6/123 (4%)

Query: 562 SLYGHKLPVLSIDIS-FDSKLLITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 615
           +L GH   V S+  S     LL++ S DK++  W L      +G   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 616 KFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSI 675
              P+     S S D  V+ W+    +C+Q+   H+S+V ++ I   A  +VS S D ++
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 676 RVW 678
           +VW
Sbjct: 132 KVW 134

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155
           D  +++W+L S   +  F GHKS +  +  D   ++++S S+D  + +W+ +GE  +  L
Sbjct: 86  DKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGEC-MVTL 144

Query: 156 RSHKDSITGIW-CENED------WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAI 208
             H D ++ +    NE        +IS   D ++K+W+L + Q     + H +    +  
Sbjct: 145 LGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 204

Query: 209 HND--LVITTSTESQIKIWNL 227
             D  LV +   + QI +WNL
Sbjct: 205 SPDGTLVASAGKDGQIMLWNL 225

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 99/221 (44%), Gaps = 29/221 (13%)

Query: 465 AHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPG-TVDKFVPKLKIFHDTTLE 523
            H   +    +T DG+  ++ S DKTV+ W      EL  G  + +FV            
Sbjct: 63  GHSHIVQDCTVTPDGEYALSASWDKTVRLW------ELASGKCIQRFVGH---------- 106

Query: 524 LNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSM-KFFLSLYGHKLPVLSIDISF----- 577
              D+L+V I      +  +  D TVKV+  N++ +  ++L GH   V  + ++      
Sbjct: 107 -KSDVLSVTIDRRASQIVSASRDKTVKVW--NTLGECMVTLLGHNDWVSQVRVAPNETPE 163

Query: 578 -DSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYW 636
            ++  +I++  DK +K+W L           H + + +V   P+     S  KDG +  W
Sbjct: 164 DETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLW 223

Query: 637 DGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRV 677
           +  + E +  L A Q EV+A+A S + R+ ++ +    I++
Sbjct: 224 NLTEKEALYTLNA-QDEVFAVAFSPN-RYWLTAATSSGIKI 262

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 66/164 (40%), Gaps = 16/164 (9%)

Query: 79  TYLQYHP-ETNLLAVGYADGVIKIWDLIS-----KTVLINFNGHKSAITVLRFDPTGTRL 132
           T L   P + NLL  G  D  +  W L          + +F GH   +      P G   
Sbjct: 21  TSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYA 80

Query: 133 ISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE-DWLISTSKDGLIKIWDLKTQQ 191
           +S S D  + +W+L     + +   HK  +  +  +     ++S S+D  +K+W+    +
Sbjct: 81  LSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWN-TLGE 139

Query: 192 CVETHMAHTSECWGLAIHND--------LVITTSTESQIKIWNL 227
           C+ T + H      + +  +         VI+   +  +K+WNL
Sbjct: 140 CMVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNL 183

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 51/122 (41%), Gaps = 12/122 (9%)

Query: 383 GHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFEC-GYALTCKFLPGGALVV 440
           GH   V ++  S D  L+A+A  +G + +WN+     + T           F P    + 
Sbjct: 194 GHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTLNAQDEVFAVAFSPNRYWLT 253

Query: 441 VGNRGGDLQLFDLASSTLLEN--------KEDAHGAAIWSLDLTSDGKRLVTGSADKTVK 492
                G +++F+L    +++          + A   AI SL  ++DG+ L  G  D  ++
Sbjct: 254 AATSSG-IKIFNLEERKVVDELKPEFAGYTKAAEPHAI-SLAWSADGQTLFAGYTDNVIR 311

Query: 493 FW 494
            W
Sbjct: 312 VW 313

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 44/113 (38%), Gaps = 9/113 (7%)

Query: 85  PETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSK------- 137
           P+  L+A    DG I +W+L  K  L   N       V  F P    L + +        
Sbjct: 206 PDGTLVASAGKDGQIMLWNLTEKEALYTLNAQDEVFAV-AFSPNRYWLTAATSSGIKIFN 264

Query: 138 -DSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKT 189
            +   ++ +L  E   Y   +   +I+  W  +   L +   D +I++W + T
Sbjct: 265 LEERKVVDELKPEFAGYTKAAEPHAISLAWSADGQTLFAGYTDNVIRVWQVMT 317

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 95/431 (22%), Positives = 176/431 (40%), Gaps = 85/431 (19%)

Query: 82  QYHPETN-LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD 140
            + P T+  +  G  D   +IWD  ++T ++  +GH + +  + + P G  + +GS D+ 
Sbjct: 150 SFAPHTSSRMVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPDGELIATGSMDNT 209

Query: 141 IIIWD-LVGEVGLYKLRSHKDSITGIWCE--------NEDWLISTSKDGLIKIWDLKTQQ 191
           I +W+   G+     +R H+  IT +  E            L ++SKDG IK+WD   + 
Sbjct: 210 IRLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRV 269

Query: 192 CVETHMAHTSEC----WGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQS 247
           C+ T   H +      WG     +L+ + S +  +++W+++L    G K I   I +  +
Sbjct: 270 CLYTLSGHVNSVSCVKWG---GKNLLYSGSHDKTVRVWDMNL----GGKCIN--ILKSHA 320

Query: 248 ---KQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMAD 304
                  +S ++           +   D T  I     +E  +KAL+  EK  +  G +D
Sbjct: 321 HWVNHLSLSTDYA--------LRVGPFDHT-GIMPATPEEARAKALKNYEKVAKRNG-SD 370

Query: 305 EKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYSIPYQ 364
           E++     D +   + +P ++ +   ++       T   KL   +  S +     S  + 
Sbjct: 371 EELMVTASDDFTMFLWNPSKSTKPISRM-------TGHQKLVNHVAFSPDGRYIVSASFD 423

Query: 365 KREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGT-LKIWNIKTHACIRTFE 423
                  + +  +    +GH   V  +  S D +LLA+ S  T LK+W+I+T        
Sbjct: 424 NSIKLWDSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDTSLKVWDIRTK------- 476

Query: 424 CGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLV 483
               L+   LPG                              H   ++++D + DGKR+ 
Sbjct: 477 ---KLSVD-LPG------------------------------HLDEVYTVDWSVDGKRVC 502

Query: 484 TGSADKTVKFW 494
           +G  DK V+ W
Sbjct: 503 SGGKDKMVRLW 513

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 125/287 (43%), Gaps = 29/287 (10%)

Query: 398 KLLATASNGTLKIWNIKTHACIRTFECGY--ALTCKFLPGGALVVVGNRGGDLQLFDLAS 455
           KL  ++ +GT+K+W+     C+ T   G+  +++C    G  L+  G+    ++++D+  
Sbjct: 250 KLATSSKDGTIKVWDTGRRVCLYTLS-GHVNSVSCVKWGGKNLLYSGSHDKTVRVWDMNL 308

Query: 456 STLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPK-L 514
                N   +H   +  L L++D   L  G  D T           ++P T ++   K L
Sbjct: 309 GGKCINILKSHAHWVNHLSLSTD-YALRVGPFDHT----------GIMPATPEEARAKAL 357

Query: 515 KIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLN---SMKFFLSLYGHKLPVL 571
           K         N + +A +  SD + +  +  D T+  F  N   S K    + GH+  V 
Sbjct: 358 K---------NYEKVAKRNGSDEELMVTASDDFTM--FLWNPSKSTKPISRMTGHQKLVN 406

Query: 572 SIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDG 631
            +  S D + ++++S D +IK+W    G    +   H  S+  V +  +     SCSKD 
Sbjct: 407 HVAFSPDGRYIVSASFDNSIKLWDSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDT 466

Query: 632 LVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            +K WD    +    L  H  EV+ +  S D + V S   D  +R+W
Sbjct: 467 SLKVWDIRTKKLSVDLPGHLDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 15/144 (10%)

Query: 546 DNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW----GLDFGDC 601
           DNT +++  ++    ++L GH   VL +  S D +L+ T S D  I++W    G  FG+ 
Sbjct: 165 DNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPDGELIATGSMDNTIRLWEGKNGKPFGE- 223

Query: 602 HKSLFAHQDSIMSVKFVP-------ESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654
             ++  HQ  I S+ + P       E     + SKDG +K WD  +  C+  L+ H + V
Sbjct: 224 --AMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRVCLYTLSGHVNSV 281

Query: 655 WALAISNDARFVVSTSHDHSIRVW 678
            +         + S SHD ++RVW
Sbjct: 282 -SCVKWGGKNLLYSGSHDKTVRVW 304

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 90/203 (44%), Gaps = 27/203 (13%)

Query: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540
           R+VTG+ D T + WD            D   P + +   T       +L V  S D + +
Sbjct: 158 RMVTGAGDNTARIWD-----------CDTQTPMVTLSGHTNW-----VLCVAWSPDGELI 201

Query: 541 AVSLLDNTVKVF-FLNSMKFFLSLYGHKLPVLSIDI-------SFDSKLLITSSADKNIK 592
           A   +DNT++++   N   F  ++ GH+  + S+         + +   L TSS D  IK
Sbjct: 202 ATGSMDNTIRLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIK 261

Query: 593 IWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGD-KFECVQKLAAHQ 651
           +W      C  +L  H +S+  VK+  ++   +S S D  V+ WD +   +C+  L +H 
Sbjct: 262 VWDTGRRVCLYTLSGHVNSVSCVKWGGKNL-LYSGSHDKTVRVWDMNLGGKCINILKSHA 320

Query: 652 SEVWALAISNDARFVVSTSHDHS 674
             V  L++S D    V    DH+
Sbjct: 321 HWVNHLSLSTDYALRVG-PFDHT 342

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 95/244 (38%), Gaps = 50/244 (20%)

Query: 476 TSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISS 535
           + DG+ + TGS D T++ W+ K  +         F   ++        L+ + L +  + 
Sbjct: 195 SPDGELIATGSMDNTIRLWEGKNGKP--------FGEAMRGHQKWITSLSWEPLHLVKAG 246

Query: 536 DNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWG 595
           +   LA S  D T+KV+         +L GH   V  +       LL + S DK +++W 
Sbjct: 247 ERPKLATSSKDGTIKVWDTGRRVCLYTLSGHVNSVSCVKWG-GKNLLYSGSHDKTVRVWD 305

Query: 596 LDFGD-CHKSLFAHQDSI--------MSVKFVPESHN----------------------- 623
           ++ G  C   L +H   +         +++  P  H                        
Sbjct: 306 MNLGGKCINILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPEEARAKALKNYEKVAK 365

Query: 624 --------FFSCSKDGLVKYWDGDK-FECVQKLAAHQSEVWALAISNDARFVVSTSHDHS 674
                     + S D  +  W+  K  + + ++  HQ  V  +A S D R++VS S D+S
Sbjct: 366 RNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSPDGRYIVSASFDNS 425

Query: 675 IRVW 678
           I++W
Sbjct: 426 IKLW 429

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 72/165 (43%), Gaps = 4/165 (2%)

Query: 65  PGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLIN-FNGHKSAITVL 123
           P    AK+ K  E    +   +  L+     D  + +W+    T  I+   GH+  +  +
Sbjct: 349 PEEARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHV 408

Query: 124 RFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLI 182
            F P G  ++S S D+ I +WD      +   R H  S+  + W  +   L S SKD  +
Sbjct: 409 AFSPDGRYIVSASFDNSIKLWDSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDTSL 468

Query: 183 KIWDLKTQQCVETHMAHTSECWGL--AIHNDLVITTSTESQIKIW 225
           K+WD++T++       H  E + +  ++    V +   +  +++W
Sbjct: 469 KVWDIRTKKLSVDLPGHLDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 77  ESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLI-SG 135
           E  +L    E   LA    DG IK+WD   +  L   +GH ++++ +++   G  L+ SG
Sbjct: 238 EPLHLVKAGERPKLATSSKDGTIKVWDTGRRVCLYTLSGHVNSVSCVKWG--GKNLLYSG 295

Query: 136 SKDSDIIIWDL-VGEVGLYKLRSH 158
           S D  + +WD+ +G   +  L+SH
Sbjct: 296 SHDKTVRVWDMNLGGKCINILKSH 319

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 112/249 (44%), Gaps = 17/249 (6%)

Query: 373 PNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK 431
           PN + + E  GHR +V SI    +NK + ++S +GT+K+W+++  +  R ++   A+   
Sbjct: 65  PNPVTSFE--GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122

Query: 432 FL-PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT 490
            + P    ++  ++ G+++++DL  +  +          + SL + SDG  LV G+    
Sbjct: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182

Query: 491 VKFWDFKVDQELI-PGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTV 549
              W      +   P  V KF    K            I  V +SSD K LA    D+T 
Sbjct: 183 CYVWQMPHQTDAANPKPVTKFRSHAKY-----------ITRVLLSSDVKHLATCSADHTA 231

Query: 550 KVFFLN-SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSLFAH 608
           +V+ ++ + +   +L  H+  V     S DS  L+T+ +D  +++W L   +  +    H
Sbjct: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

Query: 609 QDSIMSVKF 617
               + V  
Sbjct: 292 HKGAICVAL 300

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 96/200 (48%), Gaps = 21/200 (10%)

Query: 482 LVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLA 541
           L +   D T++FW      E + G   +          T    +  +  ++ISSD +FLA
Sbjct: 5   LASAGYDHTIRFW------EALTGVCSR----------TIQHSDSQVNRLEISSDKRFLA 48

Query: 542 VSLLDNTVKVFFLNSMKF--FLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG 599
            +   N V+++ + +       S  GH+  V SI    ++K +++SS D  IK+W +   
Sbjct: 49  AAGHLN-VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAP 107

Query: 600 DCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALA 658
              ++ + HQ ++  V   P      SC +DG V+ WD  + +CV +LA    + + +L+
Sbjct: 108 SVQRN-YKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLS 166

Query: 659 ISNDARFVVSTSHDHSIRVW 678
           +++D   +V+ ++  +  VW
Sbjct: 167 VASDGSMLVAGNNKGNCYVW 186

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/295 (20%), Positives = 117/295 (39%), Gaps = 36/295 (12%)

Query: 399 LLATAS-NGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGG-DLQLFDLASS 456
           +LA+A  + T++ W   T  C RT +   +   +         +   G  +++L+D+ ++
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63

Query: 457 TLLE-NKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLK 515
                   + H   + S+    + K +V+ S D T+K WD +              P ++
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRA-------------PSVQ 110

Query: 516 IFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHK-LPVLSID 574
             +     +N+    V I  +   L     D  V+++ L   +    L      P+ S+ 
Sbjct: 111 RNYKHQAAVNE----VVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLS 166

Query: 575 ISFDSKLLITSSADKNIKIWGLDFGDCHKS----------LFAHQDSIMSVKFVPESHNF 624
           ++ D  +L+  +   N  +W +     H++            +H   I  V    +  + 
Sbjct: 167 VASDGSMLVAGNNKGNCYVWQMP----HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHL 222

Query: 625 FSCSKDGLVKYWD-GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
            +CS D   + W   D F+    L  HQ  VW  A S D+ ++V+   DH +R+W
Sbjct: 223 ATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 57/109 (52%), Gaps = 6/109 (5%)

Query: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146
           L A G+ +  ++++D+   +   + +F GH+  +T + F      ++S S+D  I +WD 
Sbjct: 47  LAAAGHLN--VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD- 103

Query: 147 VGEVGLYKLRSHKDSITGIWCE-NEDWLISTSKDGLIKIWDLKTQQCVE 194
           V    + +   H+ ++  +    N+  LIS  +DG ++IWDL   QCV 
Sbjct: 104 VRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVH 152

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL-- 146
           L + GY D  I+ W+ ++           S +  L    +  R ++ +   ++ ++D+  
Sbjct: 5   LASAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEIS-SDKRFLAAAGHLNVRLYDIRT 62

Query: 147 VGEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWG 205
                +     H+ ++T I  + E+ W++S+S+DG IK+WD++    V+ +  H +    
Sbjct: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNE 121

Query: 206 LAIHNDL--VITTSTESQIKIWNL 227
           + IH +   +I+   +  ++IW+L
Sbjct: 122 VVIHPNQGELISCDQDGNVRIWDL 145

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 94/435 (21%), Positives = 177/435 (40%), Gaps = 95/435 (21%)

Query: 83  YHPETN-LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDI 141
           + P T+  +  G  D    IWD  ++T +    GH + +    + P G  + +GS D+ I
Sbjct: 151 FAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTI 210

Query: 142 IIWDLV-GEVGLYKLRSHKDSITGIWCE--------NEDWLISTSKDGLIKIWDLKTQQC 192
            +W+   G+     LR H   IT +  E        ++  L + SKDG IKIWD   + C
Sbjct: 211 RLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVC 270

Query: 193 VETHMAHTS--EC--WGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYEKQSK 248
           + T   HTS   C  WG     +++ + S +  I+ W+++L+         K I   +S 
Sbjct: 271 LLTLCGHTSSVSCVKWG---GKNVLYSGSHDKTIRCWDMNLNG--------KCINILKSH 319

Query: 249 QRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDKGMADEKIQ 308
              V+   ++T   +      +  +T        +E   KAL+  EK  + KG  +    
Sbjct: 320 AHWVNHLSLSTDYALRLGAFDHKGETP----ASPEEAQQKALKNYEKVAKRKGDFE---- 371

Query: 309 QNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYSIPYQKREP 368
                                                E+++T S++   Y   P +  +P
Sbjct: 372 -------------------------------------ELMVTASDDFTMYLWNPLKSTKP 394

Query: 369 TRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTF----- 422
                       + GH+  V  +  S D + + +AS + ++K+W+ +    + TF     
Sbjct: 395 ---------ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVA 445

Query: 423 ---ECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDG 479
              +  ++  C+      L+V  ++   L+++D+ +  L  +    H   ++++D + DG
Sbjct: 446 SVYQVAWSSDCR------LLVSCSKDTTLKVWDVKTRKLSVDLP-GHQDEVYTVDWSVDG 498

Query: 480 KRLVTGSADKTVKFW 494
           KR+ +G  DK V+ W
Sbjct: 499 KRVCSGGKDKMVRIW 513

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 132/315 (41%), Gaps = 29/315 (9%)

Query: 374 NKLYTIELQGHRTDVRSIDI-------SDDNKLLATAS-NGTLKIWNIKTHACIRTFECG 425
            K Y   L+GH   + S+           D   LATAS +GT+KIW+     C+ T  CG
Sbjct: 218 GKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTL-CG 276

Query: 426 Y--ALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLV 483
           +  +++C    G  ++  G+    ++ +D+  +    N   +H   +  L L        
Sbjct: 277 HTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSL-------- 328

Query: 484 TGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVS 543
             S D  ++   F    E  P + ++   K    ++   +   D   + +++ + F    
Sbjct: 329 --STDYALRLGAFDHKGE-TPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDF--TM 383

Query: 544 LLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHK 603
            L N +K     S K    + GH+  V  +  S D + ++++S D +IK+W    G    
Sbjct: 384 YLWNPLK-----STKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLS 438

Query: 604 SLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDA 663
           +   H  S+  V +  +     SCSKD  +K WD    +    L  HQ EV+ +  S D 
Sbjct: 439 TFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDG 498

Query: 664 RFVVSTSHDHSIRVW 678
           + V S   D  +R+W
Sbjct: 499 KRVCSGGKDKMVRIW 513

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/376 (21%), Positives = 141/376 (37%), Gaps = 69/376 (18%)

Query: 355 TVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDV--RSIDISDDNKLLATASNGTLKIWN 412
           T ++ ++ Y  R   +  P    +  + GH + +   +   +  ++++  A + T  IW+
Sbjct: 113 TEDFLTLVYTPRAIFKVKPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWD 172

Query: 413 I--KTHACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAI 470
              +T  C       + L C + P G L+  G+    ++L++ +      +    H   I
Sbjct: 173 CDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWI 232

Query: 471 WSLDL-------TSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLE 523
            SL           D  RL T S D T+K WD             + V  L +   T+  
Sbjct: 233 TSLSWEPIHLVKPGDKPRLATASKDGTIKIWD-----------TTRRVCLLTLCGHTS-- 279

Query: 524 LNDDILAVKISSDNKFLAVSLLDNTVKVFFLN---SMKFFLSLYGHKLPVLSIDI----- 575
               +  VK    N   + S  D T++ + +N        L  + H +  LS+       
Sbjct: 280 ---SVSCVKWGGKNVLYSGS-HDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALR 335

Query: 576 --SFDSK------------------------------LLITSSADKNIKIWG-LDFGDCH 602
             +FD K                              L++T+S D  + +W  L      
Sbjct: 336 LGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPI 395

Query: 603 KSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISND 662
             +  HQ  +  V F P+     S S D  +K WDG   + +     H + V+ +A S+D
Sbjct: 396 TRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSD 455

Query: 663 ARFVVSTSHDHSIRVW 678
            R +VS S D +++VW
Sbjct: 456 CRLLVSCSKDTTLKVW 471

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 50/107 (46%), Gaps = 1/107 (0%)

Query: 80  YLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDS 139
           ++ + P+   +     D  IK+WD      L  F GH +++  + +      L+S SKD+
Sbjct: 407 HVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDT 466

Query: 140 DIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIW 185
            + +WD+        L  H+D +  + W  +   + S  KD +++IW
Sbjct: 467 TLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 96/214 (44%), Gaps = 12/214 (5%)

Query: 470 IWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTV----DKFVPKLKIFHDTTLELN 525
           + SLD +SD     TG  D  +K W  +       GT     ++   ++     T +  +
Sbjct: 708 MSSLDFSSDYTLAATGFQDSYIKIWSLE-------GTSINENEQNYSQINSIFKTLVGHS 760

Query: 526 DDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDIS-FDSKLLIT 584
           D + +V  S  N+FL     D T +++  ++ K  +S  GH+ P+  ++ S   + L  T
Sbjct: 761 DAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFAT 820

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECV 644
           +S+D   ++W  D     + L  H   +  V F P     F+ S D   + WD    + V
Sbjct: 821 ASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSV 880

Query: 645 QKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
           +    H S V A A+S D R++ + + D +I VW
Sbjct: 881 RLFIGHSSAVTATAVSPDGRWLSTANEDGTITVW 914

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 111/255 (43%), Gaps = 28/255 (10%)

Query: 437 ALVVVGNRGGDLQLFDLASSTLLENKED------------AHGAAIWSLDLTSDGKRLVT 484
            L   G +   ++++ L  +++ EN+++             H  A++S++ +   + L++
Sbjct: 718 TLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVNFSPCNRFLLS 777

Query: 485 GSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSL 544
           GS DKT + W     + L+      +    K   D               + N   A + 
Sbjct: 778 GSGDKTARLWSTDTYKGLV-----SYKGHEKPIWDVNFS----------PTGNNLFATAS 822

Query: 545 LDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKS 604
            DNT +V+  + +     L GH   V  +    + + + T S+DK  ++W L  GD  + 
Sbjct: 823 SDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRL 882

Query: 605 LFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAISNDA 663
              H  ++ +    P+     + ++DG +  WD    + ++ +  H ++ +++L+ +   
Sbjct: 883 FIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTG 942

Query: 664 RFVVSTSHDHSIRVW 678
             +VS+  D+S+RVW
Sbjct: 943 NILVSSGADNSVRVW 957

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 61/116 (52%), Gaps = 2/116 (1%)

Query: 75  LAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLIS 134
           L++   + +HP    +  G +D   ++WDL S   +  F GH SA+T     P G  L +
Sbjct: 845 LSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLST 904

Query: 135 GSKDSDIIIWDLVGEVGLYKLRSH-KDSITGI-WCENEDWLISTSKDGLIKIWDLK 188
            ++D  I +WD+     L  +R H K+SI  + + +  + L+S+  D  +++WD+K
Sbjct: 905 ANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIK 960

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/144 (20%), Positives = 69/144 (47%), Gaps = 4/144 (2%)

Query: 88  NLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLV 147
           NL A   +D   ++W       +    GH S +  + F P G  + +GS D    +WDL 
Sbjct: 816 NLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLS 875

Query: 148 GEVGLYKLRSHKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAH-TSECWG 205
               +     H  ++T      +  WL + ++DG I +WD+ + + +++   H  +  + 
Sbjct: 876 SGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYS 935

Query: 206 LAIH--NDLVITTSTESQIKIWNL 227
           L+ +   ++++++  ++ +++W++
Sbjct: 936 LSYNKTGNILVSSGADNSVRVWDI 959

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 70/162 (43%), Gaps = 10/162 (6%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLI-SGSKDS 139
           + + P    L  G  D   ++W   +   L+++ GH+  I  + F PTG  L  + S D+
Sbjct: 766 VNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDN 825

Query: 140 DIIIWDLVGEVGLYKLRSHKDSITGIWC----ENEDWLISTSKDGLIKIWDLKTQQCVET 195
              +W       +Y +R     ++ + C     N  ++ + S D   ++WDL +   V  
Sbjct: 826 TARVWSC---DRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRL 882

Query: 196 HMAHTSECWGLAIHND--LVITTSTESQIKIWNLDLDKDMGS 235
            + H+S     A+  D   + T + +  I +W++   K + S
Sbjct: 883 FIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKS 924

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 76/159 (47%), Gaps = 8/159 (5%)

Query: 375 KLYTIE-LQGHRTDVRSIDISDDNKLLAT-ASNGTLKIWNIKTHACIRTFECGY--ALTC 430
           ++Y +  L GH +DV  +    + + + T +S+ T ++W++ +   +R F  G+  A+T 
Sbjct: 834 RVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLF-IGHSSAVTA 892

Query: 431 KFL-PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADK 489
             + P G  +   N  G + ++D+ S   L++       +I+SL     G  LV+  AD 
Sbjct: 893 TAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADN 952

Query: 490 TVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDI 528
           +V+ WD K +        ++  P L   +D    +N DI
Sbjct: 953 SVRVWDIKKNTHEPSLEPEEIYPGLG--NDNVTSMNQDI 989

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 60/164 (36%), Gaps = 17/164 (10%)

Query: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLIN-------------FNGHKSAITVLRFDP 127
           L +  +  L A G+ D  IKIW L   ++  N               GH  A+  + F P
Sbjct: 711 LDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVNFSP 770

Query: 128 TGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSI--TGIWCENEDWLISTSKDGLIKIW 185
               L+SGS D    +W      GL   + H+  I          +   + S D   ++W
Sbjct: 771 CNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNTARVW 830

Query: 186 DLKTQQCVETHMAHTS--ECWGLAIHNDLVITTSTESQIKIWNL 227
                  V     H S  +C     +   V T S++   ++W+L
Sbjct: 831 SCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDL 874

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 55/126 (43%), Gaps = 17/126 (13%)

Query: 120 ITVLRFDPTGTRLISGSKDSDIIIWDLVGEV------------GLYK-LRSHKDSITGI- 165
           ++ L F    T   +G +DS I IW L G               ++K L  H D++  + 
Sbjct: 708 MSSLDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVN 767

Query: 166 WCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGL---AIHNDLVITTSTESQI 222
           +     +L+S S D   ++W   T + + ++  H    W +      N+L  T S+++  
Sbjct: 768 FSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNTA 827

Query: 223 KIWNLD 228
           ++W+ D
Sbjct: 828 RVWSCD 833

>NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON}
           Anc_7.322
          Length = 1205

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 79/163 (48%), Gaps = 8/163 (4%)

Query: 69  DAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPT 128
           ++KST+   +  + +HP    + V      I++WD    T+L  F  H+  +  + F PT
Sbjct: 8   ESKSTR---AKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPT 64

Query: 129 GTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE-DWLISTSKDGLIKIWDL 187
               +SG  D  I +W L     LY L  H D I  ++   E  W+IS S D  I+IW+ 
Sbjct: 65  QPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNW 124

Query: 188 KTQQ---CVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNL 227
           + ++   C+  H  H   C      +DLV++ S +  I++W++
Sbjct: 125 QNRKEIACLTGH-NHFVMCAQFHPTDDLVVSASLDETIRVWDI 166

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 58/137 (42%)

Query: 542 VSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDC 601
           V+L  +T++++             H+ PV S+D      + ++   D  IK+W L+   C
Sbjct: 28  VALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKC 87

Query: 602 HKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN 661
             +L  H D I +V F  E     S S D  ++ W+    + +  L  H   V       
Sbjct: 88  LYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHP 147

Query: 662 DARFVVSTSHDHSIRVW 678
               VVS S D +IRVW
Sbjct: 148 TDDLVVSASLDETIRVW 164

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 103/281 (36%), Gaps = 53/281 (18%)

Query: 432 FLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTV 491
           F P    V+V      +QL+D    TLL   ED H   + S+D        V+G  D T+
Sbjct: 19  FHPSRPWVLVALFSSTIQLWDYRMGTLLHRFED-HEGPVRSVDFHPTQPIFVSGGDDYTI 77

Query: 492 KFWDFKVDQEL--IPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTV 549
           K W  + ++ L  + G +D    +   FH          L   IS+ +        D T+
Sbjct: 78  KVWSLETNKCLYTLNGHLDYI--RTVFFHKE--------LPWIISASD--------DQTI 119

Query: 550 KVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLD------------ 597
           +++   + K    L GH   V+         L++++S D+ I++W +             
Sbjct: 120 RIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTS 179

Query: 598 ----------------FGDCHKS--LFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGD 639
                           FGDC     L  H   +    F P      S S D  VK W  +
Sbjct: 180 TFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYN 239

Query: 640 KFEC--VQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVW 678
             +   V     H + V  +      +F++S   D ++R+W
Sbjct: 240 STKAWEVDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIW 280

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 67/154 (43%), Gaps = 14/154 (9%)

Query: 82  QYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDI 141
           Q   + NLL  G+ D V+K              GH   +    F PT   ++SGS D  +
Sbjct: 184 QMAAQQNLLDGGFGDCVVKFI----------LEGHTRGVNWASFHPTLPMIVSGSDDRQV 233

Query: 142 IIWDLVGEVG--LYKLRSHKDSITG-IWCENEDWLISTSKDGLIKIWDLKTQQCVETHMA 198
            +W         +   R H +++   I+   + +++S  +D  ++IWDL  +  V+    
Sbjct: 234 KLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIWDLDKRIPVKQFKR 293

Query: 199 HTSECWGLAIHNDL-VITTSTESQIKIWNLDLDK 231
                W +A H ++ +   + ++ I ++ LD ++
Sbjct: 294 ENDRFWLIASHPNINLFGAAHDAGIMVFKLDRER 327

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/309 (18%), Positives = 115/309 (37%), Gaps = 47/309 (15%)

Query: 381 LQGHRTDVRSIDISDDNKLLATASNG-TLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
            + H   VRS+D      +  +  +  T+K+W+++T+ C+ T      Y  T  F     
Sbjct: 49  FEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELP 108

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKED-----AHGAAIWSLDLTSDGKRLVTGSADKTVK 492
            ++  +    +++++       +N+++      H   +           +V+ S D+T++
Sbjct: 109 WIISASDDQTIRIWNW------QNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIR 162

Query: 493 FWDFKVDQELIPGTVDKF-VPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKV 551
            WD       I G   K   P    F D            ++++    L     D  VK 
Sbjct: 163 VWD-------ISGLRKKHSAPGTSTFDD------------QMAAQQNLLDGGFGDCVVKF 203

Query: 552 FFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHK--SLFAHQ 609
                      L GH   V          ++++ S D+ +K+W  +     +  +   H 
Sbjct: 204 I----------LEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHT 253

Query: 610 DSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISNDARFVVST 669
           +++  V F P      S  +D  ++ WD DK   V++        W +A S+    +   
Sbjct: 254 NNVDCVIFHPTQKFILSVGEDKTLRIWDLDKRIPVKQFKRENDRFWLIA-SHPNINLFGA 312

Query: 670 SHDHSIRVW 678
           +HD  I V+
Sbjct: 313 AHDAGIMVF 321

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/235 (20%), Positives = 85/235 (36%), Gaps = 51/235 (21%)

Query: 83  YHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDII 142
           +H E   +     D  I+IW+  ++  +    GH   +   +F PT   ++S S D  I 
Sbjct: 103 FHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIR 162

Query: 143 IWDLVGE------------------------------VGLYKLRSHKDSITGIWCENEDW 172
           +WD+ G                               V  + L  H   +   W      
Sbjct: 163 VWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVN--WASFHPT 220

Query: 173 L---ISTSKDGLIKIWDLKTQQC--VETHMAHTSECWGLAIH--NDLVITTSTESQIKIW 225
           L   +S S D  +K+W   + +   V+T   HT+    +  H     +++   +  ++IW
Sbjct: 221 LPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIW 280

Query: 226 NLDLDKDMGSKLIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRV 280
           +LD           K I  KQ K+       I +   +N F   + D  + +F++
Sbjct: 281 DLD-----------KRIPVKQFKRENDRFWLIASHPNINLFGAAH-DAGIMVFKL 323

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 87/191 (45%), Gaps = 20/191 (10%)

Query: 69  DAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPT 128
           ++KST++     + +HP   L+ V      I++WD    T+L  F GH   +  + F PT
Sbjct: 8   ESKSTRVKG---IAFHPSRPLVLVALFSSTIQLWDYRMGTLLHRFEGHDGPVRGIDFHPT 64

Query: 129 GTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENE-DWLISTSKDGLIKIWDL 187
                S   D+ I IW L     LY    H D +  ++  +E  WLIS S D  I+IW+ 
Sbjct: 65  QPIFASTGDDATIRIWSLDTNKCLYTFTGHLDYVRTVFFHHELPWLISASDDQTIRIWNW 124

Query: 188 KTQQ---CVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEKGIYE 244
           + ++   C+  H  H   C       DLV++ S +  +++W++             G+ +
Sbjct: 125 QNRKEIACLTGH-NHFVMCAQFHPTEDLVVSASLDETVRVWDI------------SGLRK 171

Query: 245 KQSKQRGVSVE 255
           K S    +S+E
Sbjct: 172 KHSAPGAMSME 182

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 56/137 (40%)

Query: 542 VSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDC 601
           V+L  +T++++            GH  PV  ID      +  ++  D  I+IW LD   C
Sbjct: 28  VALFSSTIQLWDYRMGTLLHRFEGHDGPVRGIDFHPTQPIFASTGDDATIRIWSLDTNKC 87

Query: 602 HKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN 661
             +   H D + +V F  E     S S D  ++ W+    + +  L  H   V       
Sbjct: 88  LYTFTGHLDYVRTVFFHHELPWLISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHP 147

Query: 662 DARFVVSTSHDHSIRVW 678
               VVS S D ++RVW
Sbjct: 148 TEDLVVSASLDETVRVW 164

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 109 VLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WC 167
           +L  F    + +  + F P+   ++     S I +WD      L++   H   + GI + 
Sbjct: 3   MLTKFESKSTRVKGIAFHPSRPLVLVALFSSTIQLWDYRMGTLLHRFEGHDGPVRGIDFH 62

Query: 168 ENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDL--VITTSTESQIKIW 225
             +    ST  D  I+IW L T +C+ T   H      +  H++L  +I+ S +  I+IW
Sbjct: 63  PTQPIFASTGDDATIRIWSLDTNKCLYTFTGHLDYVRTVFFHHELPWLISASDDQTIRIW 122

Query: 226 N 226
           N
Sbjct: 123 N 123

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 79/193 (40%), Gaps = 28/193 (14%)

Query: 43  ENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIW 102
           E V  WDI     S +      PGA+  +   +A+          NLL  G+ D V+K  
Sbjct: 159 ETVRVWDI-----SGLRKKHSAPGAMSMEDQMIAQQ---------NLLDGGFGDCVVKFI 204

Query: 103 DLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVG--LYKLRSHKD 160
                       GH   +    F PT   ++SG  D  + +W +       +   R H +
Sbjct: 205 ----------LEGHTRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEIDSCRGHTN 254

Query: 161 SITG-IWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDL-VITTST 218
           ++   I+   ++ +IS  +D  +++WDL  +  V+         W +A H  + +   + 
Sbjct: 255 NVDCVIFHPQQNLIISAGEDKTLRVWDLDKRVPVKQFKRENDRFWLVAAHPTINLFGAAH 314

Query: 219 ESQIKIWNLDLDK 231
           +S I I+ LD ++
Sbjct: 315 DSGIMIFKLDRER 327

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/310 (20%), Positives = 121/310 (39%), Gaps = 49/310 (15%)

Query: 381 LQGHRTDVRSIDISDDNKLLA-TASNGTLKIWNIKTHACIRTF--ECGYALTCKFLPGGA 437
            +GH   VR ID      + A T  + T++IW++ T+ C+ TF     Y  T  F     
Sbjct: 49  FEGHDGPVRGIDFHPTQPIFASTGDDATIRIWSLDTNKCLYTFTGHLDYVRTVFFHHELP 108

Query: 438 LVVVGNRGGDLQLFDLASSTLLENKED-----AHGAAIWSLDLTSDGKRLVTGSADKTVK 492
            ++  +    +++++       +N+++      H   +           +V+ S D+TV+
Sbjct: 109 WLISASDDQTIRIWNW------QNRKEIACLTGHNHFVMCAQFHPTEDLVVSASLDETVR 162

Que