Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G14916gna 1ON58158127250.0
Kpol_358.3na 1ON57557119860.0
Kwal_33.15545na 1ON57657719520.0
TPHA0M00130singletonON61158619280.0
CAGL0A01199gna 1ON61356119260.0
KLTH0B01166gna 1ON57757819150.0
NCAS0D02260na 1ON59758519150.0
Ecym_2480na 1ON58653718990.0
NDAI0I02660na 1ON59457518870.0
YPL265W (DIP5)na 1ON60857518800.0
Smik_6.473na 1ON60657518740.0
Suva_16.40na 1ON60656918640.0
Skud_16.12na 1ON60757718590.0
KNAG0L02460singletonON58857718390.0
KLLA0E16281gna 1ON60556218260.0
KAFR0B06430singletonON59357618170.0
ACL135Wna 1ON58858317800.0
TBLA0A07060na 1ON62553417780.0
KNAG0L02470singletonON63855416610.0
Ecym_80357.44ON5635338661e-108
ZYRO0D17908gna 1ON5185208571e-107
YOR348C (PUT4)7.44ON6275888621e-107
SAKL0C02662g1.83ON5485748541e-107
SAKL0C02640gsingletonON5485468531e-107
TDEL0A08030singletonON5145118411e-105
KLLA0C02343g1.83ON5815518411e-104
Suva_5.41.83ON5905598411e-104
Smik_5.241.83ON5905588401e-104
Smik_15.5327.44ON6315878401e-104
NDAI0A006101.83ON5655218341e-103
Skud_5.261.83ON5905328301e-103
Kpol_2000.641.84ON6105578311e-102
TDEL0C061701.84ON5735548241e-102
SAKL0C02684gsingletonON5885168251e-102
Kwal_26.69407.44ON5705698231e-102
TPHA0H028507.44ON6016108251e-102
YEL063C (CAN1)1.83ON5905318221e-101
CAGL0J08184g1.83ON5725698191e-101
TDEL0H040707.44ON5775788181e-101
Ecym_10871.83ON5705188171e-101
TBLA0A054601.84ON6085618171e-100
SAKL0F09790gsingletonON5585788121e-100
YNL268W (LYP1)1.84ON6115658161e-100
Kpol_367.77.44ON5845908131e-100
CAGL0E05632g7.44ON5985398141e-100
TPHA0B044701.84ON5995758111e-100
Ecym_10881.84ON5675538081e-100
Suva_8.4027.44ON6835788161e-99
KNAG0F004801.84ON5975318072e-99
ZYRO0F16632g1.84ON6075398056e-99
NDAI0F041901.84ON5995128021e-98
SAKL0B10956g7.44ON5725847983e-98
CAGL0J08162g1.84ON5975137985e-98
YNL270C (ALP1)1.83ON5735607965e-98
Skud_14.701.83ON5735547957e-98
TBLA0A054501.83ON6064927987e-98
NDAI0E038007.44ON6215537989e-98
Skud_14.711.84ON6125267971e-97
NCAS0E022607.44ON5935797942e-97
Kwal_23.4026singletonON5345267892e-97
Skud_15.5157.44ON6265857962e-97
KAFR0D039401.83ON5975577933e-97
Smik_14.671.83ON5735457913e-97
KNAG0E003907.44ON5995597933e-97
TDEL0C061801.83ON5835157914e-97
AFR156W7.44ON5585327885e-97
NCAS0B085701.83ON5325347841e-96
SAKL0C02728g1.84ON5625297861e-96
Smik_14.681.84ON6115267891e-96
NCAS0A006001.83ON5445507823e-96
Suva_14.751.84ON6115257873e-96
KNAG0C05920singletonON5995567864e-96
KNAG0C007901.83ON5795157811e-95
Kwal_33.134011.83ON5595587801e-95
KLTH0D01474g7.44ON6245297805e-95
KLTH0F02420g1.84ON6215537795e-95
KLTH0F02398g1.83ON5555667721e-94
KAFR0D007001.83ON5745567722e-94
ZYRO0F16654g1.83ON5805617713e-94
Kwal_33.134111.84ON5605657693e-94
TPHA0B044801.83ON6035697708e-94
KLLA0F23419g7.44ON5735957688e-94
NCAS0A006101.84ON6075627709e-94
Suva_13.517singletonON5475597642e-93
TBLA0C01240singletonON6295737683e-93
Smik_6.482na 2ON5585527609e-93
NDAI0F042001.83ON5665787564e-92
AFR668W1.83ON5565217511e-91
KLLA0C02365g1.84ON5795587522e-91
Suva_14.731.83ON4974777443e-91
SAKL0F16544gsingletonON5675377485e-91
AFR667C1.84ON5635597372e-89
Kpol_2000.651.83ON5954967383e-89
TDEL0E05750singletonON5485397258e-88
Kwal_8.590na 3ON6295667292e-87
ZYRO0C18502g7.44ON5755257094e-85
KLLA0B14685gna 4ON5715667085e-85
KLTH0A00308gsingletonON5415436864e-82
KAFR0C051607.44ON5845816886e-82
CAGL0K05753g1.50ON6605776928e-82
Skud_16.2na 2ON4964946755e-81
KLTH0B00154gna 3ON5565146762e-80
Kwal_23.2817na 4ON5805696676e-79
KAFR0D041401.50ON6375756663e-78
Kpol_2000.921.50ON6375706638e-78
KLTH0F04048gsingletonON5835326521e-76
YCL025C (AGP1)1.50ON6335716551e-76
TDEL0D00200singletonON5675576511e-76
ZYRO0D03762g1.244ON6005126522e-76
Smik_3.531.50ON6335716523e-76
SAKL0C01232gsingletonON6135436487e-76
KAFR0D04120na 5ON6485756509e-76
KNAG0C02140singletonON5985806461e-75
Ecym_47895.158ON5885456451e-75
Ecym_60211.244ON6004996451e-75
SAKL0G14014g5.158ON6055626452e-75
Ecym_26643.285ON5755766422e-75
YGR191W (HIP1)5.158ON6035356425e-75
Suva_3.1891.50ON6335656445e-75
Skud_3.381.50ON6335656428e-75
KAFR0E018505.158ON5605576379e-75
Kpol_1010.325.158ON5995666372e-74
YDR508C (GNP1)1.50ON6635696386e-74
NDAI0A006401.50ON6415756376e-74
Skud_11.2751.244ON6025226321e-73
Kwal_27.126811.244ON5935316321e-73
Smik_16.1155.158ON6035436302e-73
CAGL0B01012g1.50ON6235796295e-73
SAKL0D02970g3.284ON6015486277e-73
NDAI0B052201.244ON6115326278e-73
NDAI0F043901.50ON6675506291e-72
YBR068C (BAP2)3.284ON6095636261e-72
Suva_2.6881.50ON6615896282e-72
Skud_7.5255.158ON6035686242e-72
TDEL0C00930singletonON5955006232e-72
KLTH0B02046g5.158ON5895646223e-72
Suva_7.4855.158ON6035676223e-72
NDAI0D021605.158ON5875816204e-72
TDEL0F02830na 6ON5615706186e-72
TPHA0E036601.50ON6475706229e-72
TPHA0A047005.158ON5695236171e-71
KLTH0E15642g1.244ON5965896181e-71
KNAG0F002701.50ON6345846211e-71
TBLA0A05190na 5ON6675886221e-71
Smik_4.7901.50ON6635566203e-71
CAGL0L03267g1.244ON5975746153e-71
NCAS0B079001.244ON6195316156e-71
KAFR0D005001.50ON6175796147e-71
Kpol_1052.163.284ON6136066138e-71
Skud_4.7841.50ON6635896161e-70
Suva_11.2731.244ON6015226121e-70
KAFR0A011203.284ON5925586111e-70
KAFR0D04130na 7ON6445166141e-70
SAKL0D00836gna 8ON6015216102e-70
TBLA0A051801.50ON6765726152e-70
KLTH0F01606gna 5ON6045536102e-70
KAFR0C004003.284ON5825856092e-70
SAKL0D04664g1.244ON5935006092e-70
Kpol_543.791.244ON6055316102e-70
TPHA0B010901.244ON6065826092e-70
Kwal_33.14276na 8ON5965216083e-70
KAFR0D00510na 7ON6175256103e-70
SAKL0C01650g1.50ON6135716084e-70
YKR039W (GAP1)1.244ON6025226074e-70
TPHA0B047501.50ON6395886105e-70
KLLA0A11770g5.158ON5815756056e-70
TDEL0C065101.50ON6425776071e-69
KLLA0C15873g3.397ON5685246002e-69
KAFR0D00520na 5ON5985836013e-69
AGR040C3.285ON5735766003e-69
AGR039Cna 9ON5865586004e-69
NCAS0A071105.158ON5925296005e-69
Kpol_1065.133.284ON5965845996e-69
NDAI0A074903.284ON5965475997e-69
NDAI0C029505.158ON6095685998e-69
NCAS0A004201.50ON6795856031e-68
Suva_4.3073.284ON6095725981e-68
KNAG0H011503.284ON6175125991e-68
CAGL0L07546g3.284ON6345325982e-68
TPHA0A002405.158ON6035865953e-68
NDAI0A056203.284ON5715765933e-68
KLLA0A06886gsingletonON5875195943e-68
KNAG0J022003.284ON6075825953e-68
SAKL0D02948gna 9ON5945235935e-68
NCAS0A106803.284ON5935485925e-68
AFR698C1.50ON6095185936e-68
Kwal_33.132041.50ON6075855936e-68
KNAG0C005901.50ON6345275931e-67
NCAS0B085801.50ON6275695921e-67
KNAG0G009005.158ON6135705911e-67
Skud_2.1913.284ON6095555902e-67
Suva_2.716singletonON6035195902e-67
NCAS0I015303.284ON5955595882e-67
AGR319W5.158ON6265455902e-67
CAGL0B03773g5.158ON6055025883e-67
AAR038W3.397ON5665275853e-67
Skud_2.2603.397ON5985425874e-67
KLTH0F01584g1.50ON5965225856e-67
KLLA0C01606g1.50ON6205275867e-67
NCAS0D018705.158ON5955355848e-67
Smik_11.3021.244ON5534725818e-67
AFR230C1.244ON6045555841e-66
TBLA0B077605.158ON6585325871e-66
Kpol_526.103.397ON5805495821e-66
NDAI0G060301.368ON5995865822e-66
Suva_4.3813.397ON5905435812e-66
Smik_2.2013.284ON6095295813e-66
ZYRO0F13838g8.342ON8365895914e-66
YBR132C (AGP2)3.397ON5965245794e-66
SAKL0H15092g8.342ON8506275915e-66
Kwal_26.9612singletonON5435575755e-66
Smik_2.2723.397ON5975025761e-65
Kwal_33.154075.158ON5875715751e-65
Kpol_2002.441.50ON6275425771e-65
KLLA0F27093gsingletonON5635655732e-65
CAGL0H08393g3.284ON6125215752e-65
Kwal_33.13215na 5ON5985205734e-65
Smik_4.2843.284ON6045435734e-65
NCAS0A089201.368ON5995425701e-64
SAKL0D02926g3.285ON5835715691e-64
Kwal_27.105383.284ON6025705692e-64
AGR038C3.284ON5805495662e-64
ZYRO0F17446g1.50ON6335665675e-64
KLTH0C05170g3.284ON5985765656e-64
YDR046C (BAP3)3.284ON6045515657e-64
TDEL0C053403.397ON5755535602e-63
NCAS0J00140na 10ON5585045582e-63
AEL030W1.368ON5826055584e-63
KLLA0A06930g1.244ON5875755576e-63
YLL061W (MMP1)na 11ON5835235568e-63
TDEL0E05700singletonON5844945513e-62
KLTH0C08052gna 12ON5994895523e-62
KNAG0L00110na 10ON5714905504e-62
Suva_16.18na 12ON5835235505e-62
Skud_4.3003.284ON6045395509e-62
Kpol_543.78singletonON6055305472e-61
TPHA0M012003.284ON6075835463e-61
KAFR0K013603.397ON5825605453e-61
TBLA0I020103.285ON6284785473e-61
Suva_2.2033.284ON6045585463e-61
CAGL0M00154gsingletonON5505535423e-61
NDAI0A01340singletonON5545375425e-61
Skud_2.1923.285ON6195155447e-61
SAKL0A09724gna 13ON5515305391e-60
TBLA0C012101.368ON6005165402e-60
Ecym_8297na 14ON5695595382e-60
ZYRO0C17182g3.397ON5785585356e-60
KAFR0F02250singletonON5545585346e-60
Kpol_1052.143.285ON6025495368e-60
SAKL0H08184gna 14ON5985665358e-60
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G14916g
         (581 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...  1054   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   769   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   756   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     747   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   746   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   742   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              742   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   736   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   731   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   728   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   726   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   722   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   720   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             712   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   707   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   704   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   690   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   689   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             644   0.0  
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   338   e-108
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   334   e-107
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   336   e-107
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   333   e-107
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   333   e-107
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            328   e-105
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   328   e-104
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   328   e-104
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   328   e-104
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   328   e-104
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   325   e-103
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   324   e-103
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   324   e-102
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   322   e-102
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   322   e-102
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   321   e-102
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   322   e-102
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   321   e-101
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   320   e-101
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   319   e-101
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   319   e-101
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   319   e-100
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   317   e-100
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   318   e-100
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   317   e-100
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   318   e-100
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   317   e-100
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   315   e-100
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   318   e-99 
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                315   2e-99
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   314   6e-99
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   313   1e-98
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   311   3e-98
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   311   5e-98
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   311   5e-98
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   310   7e-98
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   311   7e-98
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     311   9e-98
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   311   1e-97
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     310   2e-97
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   308   2e-97
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   311   2e-97
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   310   3e-97
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   309   3e-97
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   310   3e-97
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   309   4e-97
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   308   5e-97
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            306   1e-96
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   307   1e-96
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   308   1e-96
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   305   3e-96
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   307   3e-96
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            307   4e-96
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              305   1e-95
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   305   1e-95
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   305   5e-95
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   304   5e-95
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   301   1e-94
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   301   2e-94
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   301   3e-94
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   300   3e-94
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   301   8e-94
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   300   8e-94
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              301   9e-94
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   298   2e-93
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   300   3e-93
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   297   9e-93
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            295   4e-92
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   293   1e-91
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   294   2e-91
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   291   3e-91
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   292   5e-91
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   288   2e-89
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   288   3e-89
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            283   8e-88
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   285   2e-87
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   277   4e-85
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   277   5e-85
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   268   4e-82
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   269   6e-82
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   271   8e-82
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   264   5e-81
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   265   2e-80
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   261   6e-79
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              261   3e-78
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   259   8e-78
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   255   1e-76
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   256   1e-76
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                255   1e-76
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   255   2e-76
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   255   3e-76
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   254   7e-76
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   254   9e-76
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   253   1e-75
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   253   1e-75
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   253   1e-75
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   253   2e-75
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   251   2e-75
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   251   5e-75
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   252   5e-75
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   251   8e-75
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   249   9e-75
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   249   2e-74
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   250   6e-74
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   249   6e-74
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   248   1e-73
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   248   1e-73
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   247   2e-73
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   246   5e-73
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   246   7e-73
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   246   8e-73
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   246   1e-72
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   245   1e-72
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   246   2e-72
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   244   2e-72
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   244   2e-72
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   244   3e-72
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   244   3e-72
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    243   4e-72
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   242   6e-72
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   244   9e-72
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   242   1e-71
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   242   1e-71
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   243   1e-71
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   244   1e-71
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   243   3e-71
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   241   3e-71
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   241   6e-71
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      241   7e-71
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   240   8e-71
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   241   1e-70
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   240   1e-70
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   239   1e-70
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              241   1e-70
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   239   2e-70
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   241   2e-70
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   239   2e-70
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                239   2e-70
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   239   2e-70
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   239   2e-70
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   239   2e-70
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   238   3e-70
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      239   3e-70
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   238   4e-70
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   238   4e-70
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   239   5e-70
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   237   6e-70
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   238   1e-69
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   235   2e-69
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   236   3e-69
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   235   3e-69
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   235   4e-69
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   235   5e-69
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   235   6e-69
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   235   7e-69
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    235   8e-69
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   236   1e-68
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   234   1e-68
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              235   1e-68
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   234   2e-68
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   233   3e-68
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            233   3e-68
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   233   3e-68
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   233   3e-68
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   233   5e-68
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   232   5e-68
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   233   6e-68
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   233   6e-68
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   233   1e-67
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   232   1e-67
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   232   1e-67
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   231   2e-67
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   231   2e-67
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              231   2e-67
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   231   2e-67
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   231   3e-67
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   229   3e-67
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   230   4e-67
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   229   6e-67
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   230   7e-67
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   229   8e-67
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   228   8e-67
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   229   1e-66
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   230   1e-66
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   228   1e-66
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   228   2e-66
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   228   2e-66
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   228   3e-66
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   232   4e-66
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   227   4e-66
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   232   5e-66
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   226   5e-66
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   226   1e-65
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   226   1e-65
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   226   1e-65
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   225   2e-65
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   226   2e-65
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   225   4e-65
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   225   4e-65
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   224   1e-64
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   223   1e-64
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   223   2e-64
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   222   2e-64
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   223   5e-64
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   222   6e-64
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   222   7e-64
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   220   2e-63
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      219   2e-63
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   219   4e-63
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   219   6e-63
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   218   8e-63
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   216   3e-62
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   217   3e-62
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   216   4e-62
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   216   5e-62
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   216   9e-62
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   215   2e-61
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   214   3e-61
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   214   3e-61
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   215   3e-61
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   214   3e-61
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   213   3e-61
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              213   5e-61
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   214   7e-61
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   212   1e-60
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   212   2e-60
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   211   2e-60
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   210   6e-60
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              210   6e-60
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   211   8e-60
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   210   8e-60
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   214   1e-59
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   209   1e-59
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   210   1e-59
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   209   2e-59
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   209   2e-59
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    209   2e-59
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   209   3e-59
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   209   3e-59
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   208   4e-59
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   209   5e-59
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   208   5e-59
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   207   5e-59
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   207   7e-59
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   208   7e-59
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                207   8e-59
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   208   1e-58
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   207   1e-58
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   204   1e-58
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   206   2e-58
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   207   2e-58
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   206   2e-58
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   206   2e-58
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   206   3e-58
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   203   3e-58
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   206   3e-58
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   206   3e-58
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   203   4e-58
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   205   5e-58
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   206   7e-58
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              206   7e-58
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   204   2e-57
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   203   2e-57
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   203   3e-57
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              203   3e-57
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   202   3e-57
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   202   7e-57
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   202   8e-57
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   202   1e-56
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   200   2e-56
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   201   2e-56
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   199   6e-56
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              200   6e-56
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                200   6e-56
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   199   6e-56
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      199   8e-56
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   199   8e-56
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   199   1e-55
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    197   1e-55
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   201   2e-55
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   197   6e-55
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   195   1e-54
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   198   4e-54
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   198   4e-54
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   195   4e-54
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   195   7e-54
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   194   9e-54
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   192   3e-53
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   195   6e-53
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   194   1e-52
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   190   1e-52
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   194   2e-52
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   190   2e-52
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   193   2e-52
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   192   4e-52
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   192   6e-52
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   192   9e-52
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   191   2e-51
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   187   2e-51
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   187   3e-51
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   190   4e-51
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   190   5e-51
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   185   2e-50
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   186   2e-49
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      181   5e-49
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   181   6e-49
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   182   2e-48
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   179   2e-48
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              176   2e-47
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   172   5e-46
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   170   4e-45
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   171   8e-45
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   161   3e-42
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   157   4e-40
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     150   4e-40
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     150   6e-40
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   152   6e-39
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   145   9e-37
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         117   2e-28
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   108   3e-26
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      87   2e-18
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     85   3e-17
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          81   9e-17
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      61   5e-11
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          64   5e-11
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    63   2e-10
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    60   5e-10
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      53   1e-07
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              49   5e-06
ZYRO0A08844g Chr1 (704383..705783) [1401 bp, 466 aa] {ON} highly...    41   0.009
NCAS0A04090 Chr1 (825742..827172) [1431 bp, 476 aa] {ON} Anc_2.407     39   0.026
NDAI0E01810 Chr5 (359926..361353) [1428 bp, 475 aa] {ON} Anc_2.407     39   0.027
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    39   0.030
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    39   0.039
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    39   0.046
TDEL0A01810 Chr1 (329082..330482) [1401 bp, 466 aa] {ON} Anc_2.4...    37   0.10 
KAFR0F02620 Chr6 complement(511809..513215) [1407 bp, 468 aa] {O...    37   0.14 
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    37   0.17 
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    37   0.18 
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    37   0.19 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    36   0.28 
SAKL0E04576g Chr5 complement(369959..371380) [1422 bp, 473 aa] {...    35   0.60 
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    35   0.60 
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              33   0.63 
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    35   0.71 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    34   0.87 
ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]...    34   1.00 
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    34   1.3  
KLTH0E09262g Chr5 complement(841503..842918) [1416 bp, 471 aa] {...    33   1.5  
CAGL0A03476g Chr1 complement(355620..357035) [1416 bp, 471 aa] {...    33   1.5  
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    33   1.5  
Smik_12.96 Chr12 complement(197308..198729) [1422 bp, 473 aa] {O...    33   1.6  
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    33   1.9  
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    33   2.4  
Suva_10.114 Chr10 complement(217404..218825) [1422 bp, 473 aa] {...    32   4.4  
Kwal_47.17792 s47 complement(558662..560077) [1416 bp, 471 aa] {...    32   4.6  
Skud_12.101 Chr12 complement(202336..203757) [1422 bp, 473 aa] {...    32   4.6  
NDAI0H00180 Chr8 (18650..20356) [1707 bp, 568 aa] {ON} Anc_4.5         32   5.0  
YLR034C Chr12 complement(210512..211933) [1422 bp, 473 aa] {ON} ...    32   6.3  
Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)    32   7.3  

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score = 1054 bits (2725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/581 (92%), Positives = 535/581 (92%)

Query: 1   MSFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELE 60
           MSFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELE
Sbjct: 1   MSFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELE 60

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
           ARHVSM                       PVSILIAYSFVGFLVYIVMTCLGEMATYIPL
Sbjct: 61  ARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120

Query: 121 DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIF 180
           DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIF
Sbjct: 121 DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIF 180

Query: 181 LVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPG 240
           LVIIVTIN            WLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPG
Sbjct: 181 LVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPG 240

Query: 241 AFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYR 300
           AFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYR
Sbjct: 241 AFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYR 300

Query: 301 IVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLM 360
           IVVFYLVTIFLLGMTVAYNDPLLLQ           PFVVAIKNAGIPVLPHIFNACVLM
Sbjct: 301 IVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLM 360

Query: 361 FVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSG 420
           FVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSG
Sbjct: 361 FVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSG 420

Query: 421 SAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALF 480
           SAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALF
Sbjct: 421 SAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALF 480

Query: 481 FCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTF 540
           FCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTF
Sbjct: 481 FCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTF 540

Query: 541 KELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           KELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF
Sbjct: 541 KELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/571 (67%), Positives = 449/571 (78%), Gaps = 14/571 (2%)

Query: 11  DLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXX 70
           DLEK     NTTS    +L+   Q+D S++ S    DGK DG+RLKKEL+ARH+SM    
Sbjct: 19  DLEK-----NTTS----SLNSFEQEDDSNKIS----DGKEDGVRLKKELKARHISMIAIG 65

Query: 71  XXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYASRY 130
                              P SILIAYSFVG LV+ VM CLGEMATYIPLDGFTSYA+RY
Sbjct: 66  GSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRY 125

Query: 131 CDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXX 190
           CDPALGFAVGY YLFKY IITPNQLTA ALV+QYW+ RE VNPGVWITIFLV+IV IN  
Sbjct: 126 CDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTV 185

Query: 191 XXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAIS 250
                     WLSSFK++VM  +I+ LF+IMLGGGP+HDRLGFR++K+PGAF+PYSE+I+
Sbjct: 186 GVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESIT 245

Query: 251 GSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIF 310
           GSKGKFVSFVAVFVYALFAYLG EL GIVAAE +NPRRN+PRAIKLT+YRI++FY+VTIF
Sbjct: 246 GSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIF 305

Query: 311 LLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDL 370
           LLGM VAYNDP LL            PFVVAI+N+G+  LPHIFN CVL+FVFSACNSDL
Sbjct: 306 LLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDL 365

Query: 371 YVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVN 430
           YV +RSLY LAID KAPK+FAKTN+WGVPYN+L  C LFCLLAYMNVSSGSAQ+FNYFVN
Sbjct: 366 YVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVN 425

Query: 431 VVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKN 490
           VVSIFG++SWI+ILITYI+F RA  AQ VD+++ AY AP    GAY  LFFC LIA IKN
Sbjct: 426 VVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKN 485

Query: 491 FTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEE 550
           FTVF+G +FDYK+FITGYIG+P+++I +FGYK I  TK VK EEADLY+FKE ID EE E
Sbjct: 486 FTVFIG-EFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDREEAE 544

Query: 551 GKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           GK+ +A  KE++++S K+ KWFYEK+LG+IF
Sbjct: 545 GKIKEAEAKERLKNSKKSLKWFYEKYLGYIF 575

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/577 (68%), Positives = 448/577 (77%), Gaps = 4/577 (0%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHV 64
             S  K    ++ ++ T  + +  L+   Q    S+     +DGKH+GIRLKKELEARHV
Sbjct: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSE----GVDGKHEGIRLKKELEARHV 59

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFT 124
           SM                       PVSILI+YSFVG LVY VM+CLGEMA +IPLDGFT
Sbjct: 60  SMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFT 119

Query: 125 SYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVII 184
           SYASRY DPA+GFAVGYSYLFKY I+TPNQLTA A+V+Q+WVSR++VNPGVWITIFL +I
Sbjct: 120 SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179

Query: 185 VTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRP 244
           V IN            WLSS KVLVML LI+LLF+IMLGGGP+HDR GFRF++DPGAF+P
Sbjct: 180 VLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKP 239

Query: 245 YSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVF 304
           YSEAISGSKGKFVSF +VF  ALFAY GTELCGIVAAE KNPRR+VPRAIKLTLYRIVVF
Sbjct: 240 YSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVF 299

Query: 305 YLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFS 364
           Y++TI LLGMTVAYNDP LL+           PFVVAI+NA IPVLPHIFN CVL+FVFS
Sbjct: 300 YVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFS 359

Query: 365 ACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQV 424
           ACNSDLYVASRSLYGLAID KAP+IFA TNKWGVPY SL L +LFCLLAYMNVSSGSAQV
Sbjct: 360 ACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQV 419

Query: 425 FNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCL 484
           FNYFVNVVSIFGL+SWI ILITYI FD+A+R Q  DKS+L+Y A       Y ALFFCCL
Sbjct: 420 FNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL 479

Query: 485 IALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELI 544
           I LIKN+TVFLGHKFDYK FI+GYIGIPV++IC+ GYK +  TK +KPE+ DLYTFK+ I
Sbjct: 480 IGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAI 539

Query: 545 DLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           D EEEE KL +  + E ME+SPKNFKWFYE FLGWIF
Sbjct: 540 DAEEEEYKLLEKERLENMENSPKNFKWFYETFLGWIF 576

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/586 (62%), Positives = 444/586 (75%), Gaps = 14/586 (2%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLN-----IDGKHDGIRLKKE 58
           I DSY K       ++ T + D+E  D + Q+ +    S  +     +DGK DG RLKK+
Sbjct: 32  IDDSYFK------KDNGTVAYDLEVNDQTRQNTLDDDASADSDGYNVMDGKDDGTRLKKD 85

Query: 59  LEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYI 118
           L+ARH+SM                       P SILIAY+FVG LV+  M  LGEMA YI
Sbjct: 86  LKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEMAAYI 145

Query: 119 PLDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
           PLDGFTSYASRYCDPALGFAVGYSYLFKY IITPNQLTAAALV+QYWV R+ VNPGVWIT
Sbjct: 146 PLDGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWIT 205

Query: 179 IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           IFLV+I+ IN            WLSSFK++VM+ +++ LFVIMLGGGP+HDRLGFR++K 
Sbjct: 206 IFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKT 265

Query: 239 PGAFRPYSEA---ISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIK 295
           PGAF+PYS +   I GS GKFV+FV VFVYALFAYLG EL GIVAAE +NPRRN+PRAIK
Sbjct: 266 PGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIK 325

Query: 296 LTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFN 355
           LT++RI+ FY+ TIFLLGM VAY+DPLLL            PFVVAI+N+G+ VLPHIFN
Sbjct: 326 LTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFN 385

Query: 356 ACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYM 415
            CVLMFVFSACNSDLYV +RSLY LA+D KAPKIFAKTN+WGVPYN++  C+LFCLLAYM
Sbjct: 386 VCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYM 445

Query: 416 NVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGA 475
           NVSSGSA++FNYFVNVVSIFG++SW +ILIT+IYFDRA+RAQG+D+ST AY AP    G+
Sbjct: 446 NVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGS 505

Query: 476 YFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEA 535
           YFALFFC L+ALIKNF+VFLG++FDYK FITGYIG+PV+   F GYK    TK VKP EA
Sbjct: 506 YFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTVKPHEA 565

Query: 536 DLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           DL ++K  +D EEEEGK+ +A +KE+++   K+ +WFYEK++  IF
Sbjct: 566 DLNSYKAAVDREEEEGKIKEAERKERLKHGKKDLEWFYEKYISSIF 611

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/561 (65%), Positives = 439/561 (78%), Gaps = 4/561 (0%)

Query: 24  KDVENLDL--SNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXX 81
            D++NL    S  +D   Q+ +++ DGK +  RL+K+L+ARH+SM               
Sbjct: 54  NDMDNLSTVSSRLEDSEKQDDYMD-DGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGT 112

Query: 82  XXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYASRYCDPALGFAVGY 141
                   P+S+ IAY+FVG LV+  M  LGEMA+YIPLDGFTSYASRYCDPALGFAVGY
Sbjct: 113 GNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGY 172

Query: 142 SYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXW 201
           +YL KYLI+ PNQLTAAALV+QYW+ RE+VNPGVWITIFLVIIV +N            W
Sbjct: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232

Query: 202 LSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVA 261
           LS+FKV+VM+ LI+LLFVIMLGGGP+HDRLGFRFY  PGAF+PYS++I GSKGKFV+FVA
Sbjct: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVA 292

Query: 262 VFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDP 321
           V VYALFAYLG EL GIVAAE  NPR+++P+AIKLT+YRI+VFYLVTIFLLGM VAY+DP
Sbjct: 293 VLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352

Query: 322 LLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLA 381
           LL +           P+VVAI N+GI  LPHIFNACVLMFVFSACNSDLYVASR+LYGLA
Sbjct: 353 LLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412

Query: 382 IDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWI 441
           IDNKAPKIFA TN+WGVPY SL++   FCLLAYM+VSSGSA++FNYFVNVVSIFGL+SWI
Sbjct: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472

Query: 442 AILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDY 501
           +ILITY+ F RA++AQ VD+S  AY AP    G+YF L FC LIA IKNFTVFL H FDY
Sbjct: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDY 532

Query: 502 KNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEK 561
           KNFITGYIGIPVF+I +FGYK+++ TK  KPEE DLYTFK  ID EEE+GK+ DA ++E+
Sbjct: 533 KNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRER 592

Query: 562 MESSP-KNFKWFYEKFLGWIF 581
           +++S  K + WFYEK LG IF
Sbjct: 593 LKNSKTKGWDWFYEKVLGNIF 613

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/578 (67%), Positives = 448/578 (77%), Gaps = 1/578 (0%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           + +S  K    I+ ++ T  +DV   D   +    +  +  ++DGKH+GIRLKK LEARH
Sbjct: 1   MSESLEKKNAGILYSNETLEEDVA-FDKLERGASGASAAGASVDGKHEGIRLKKALEARH 59

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGF 123
           VSM                       P SILI+YSFVG LVY VM CLGEMA +IPLDGF
Sbjct: 60  VSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEMAAFIPLDGF 119

Query: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183
           TSYASRY DPALGFAVGY YLFKY I+TPNQLTA A+V+QYWVSREKVNPGVWITIFLV+
Sbjct: 120 TSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVL 179

Query: 184 IVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243
           IV IN            WLSS KVLVML LI+LLF+IMLGGGP+HDR GFR+++DPGAF+
Sbjct: 180 IVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRYWRDPGAFK 239

Query: 244 PYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVV 303
           PYSEAISGSKGKFVSF +VF  ALFAY GTELCGIVAAE KNPRR+VPRAIKLTLYRIV+
Sbjct: 240 PYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVL 299

Query: 304 FYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVF 363
           FY+++I LLGMTVAYNDPLL++           PFVVAIKNAGIPVLPHIFNACVL+FVF
Sbjct: 300 FYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPHIFNACVLLFVF 359

Query: 364 SACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQ 423
           SACNSDLYVASR+LYGLAID KAPKIFAKTN WGVPY SL + +LFCLLAYMNVSSGSAQ
Sbjct: 360 SACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQ 419

Query: 424 VFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCC 483
           +FNYFVNVVSIFGL+SWI+ILITY+ F +A+ AQ  DKS  +Y AP      + +LFFCC
Sbjct: 420 IFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCC 479

Query: 484 LIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKEL 543
           LI LIKN+TVFLGH FDYK FI+GYIGIPV+ IC+ GYK +  +K +KPE+ DLYTFK  
Sbjct: 480 LIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAA 539

Query: 544 IDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           ID EEEEGKL +  +KE+++SSPKN  WFY+ FLGWIF
Sbjct: 540 IDAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWIF 577

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/585 (64%), Positives = 445/585 (76%), Gaps = 8/585 (1%)

Query: 5   QDSYRK--DLEKIVSNSNTTSKDVENL--DLSNQDDISS----QESHLNIDGKHDGIRLK 56
            D Y +  D +K V +    +++ E L  DL N   +S+    Q    N+DGK +G RLK
Sbjct: 13  SDRYEEYFDPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGTRLK 72

Query: 57  KELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMAT 116
           K LE R VSM                       PVS+LIAY+FVG LV+  M  LGEMA+
Sbjct: 73  KVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMAS 132

Query: 117 YIPLDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVW 176
           YIPLDGFTSYA+RY DPALGFAVGY YLFKY I+ PNQLTAAALV+QYW+ REKVNPGVW
Sbjct: 133 YIPLDGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVW 192

Query: 177 ITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFY 236
           ITIFLV+IV IN            WLSSFKVLVM  LI+LLF++MLGGGP+HDRLGFR +
Sbjct: 193 ITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHW 252

Query: 237 KDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKL 296
           K PGAF  YS AI+G  GKFV+FV+VFVYA FAYLGTEL GIV  E +NPR++VP+AIKL
Sbjct: 253 KHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKL 312

Query: 297 TLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNA 356
           T+YRI++FYL++I LLGM V Y+DPLLL+           PFVVAI N+GI VLPHIFNA
Sbjct: 313 TMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNA 372

Query: 357 CVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMN 416
           CVL+FVFSACNSDLYVASRSLY LAIDNKAPKIFA+TN+WG+PY SL L +LFCLLAYM+
Sbjct: 373 CVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMS 432

Query: 417 VSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAY 476
           VSSGSA++FNYFVNVVSIFGL+SWI IL+TY+ FDRA+RAQG+DKST +Y AP    GAY
Sbjct: 433 VSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAY 492

Query: 477 FALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEAD 536
           FALFFC LIALIKNFTVFLGH+FDYK FITGYIGIPVF I +FGYK I  TK + P E D
Sbjct: 493 FALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKIIDPLEVD 552

Query: 537 LYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           LYTFK  ID EEE+GKL D A+KE+++++ +NF+WFY+KFL  IF
Sbjct: 553 LYTFKAAIDQEEEDGKLEDIARKERIKANGRNFEWFYDKFLSNIF 597

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/537 (68%), Positives = 422/537 (78%), Gaps = 2/537 (0%)

Query: 47  DGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYI 106
           DGKH GIRLKK+L+ARHVSM                       P++ILIAYS +G++V+ 
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 107 VMTCLGEMATYIPLDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWV 166
           VM+CLGEMA YIPLDGFTSYA+RY DPALGFAVGY+YLFKYL++TPNQLTAAALV+QYWV
Sbjct: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169

Query: 167 SREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGP 226
            R KVNPGVWIT+FL +I+TIN            WLSSFKVLVMLC++ LL V++LGGGP
Sbjct: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGP 229

Query: 227 SHDRLGFRFYKDPGAFRPYSEAIS--GSKGKFVSFVAVFVYALFAYLGTELCGIVAAECK 284
           SH+RLGFR++KDPG F+PYS A+S  G KGKFVSF +VFVYALFAYLGTELCGIVAAECK
Sbjct: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289

Query: 285 NPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKN 344
           NPRRNVPRAIKLTLYRIVVFYL T+FLLG++VAYNDPLLLQ           P+VVAIKN
Sbjct: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKN 349

Query: 345 AGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLI 404
           AGIPVLPHIFNACVL FVFSACNSDLYV SRSLYGLAID KAPKIFAKTN WGVPYNSL 
Sbjct: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409

Query: 405 LCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTL 464
           LC LFC LAYMNVSS +  +F+YFVNV SIFGL+SWI+ILITYI FDRA R QG+DK+TL
Sbjct: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469

Query: 465 AYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI 524
           +Y AP     A+ AL FC ++AL+KNFTVFLG  FDYK FITGYIGIPV+I+CF  YK +
Sbjct: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529

Query: 525 RGTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
             TK++K    DL+T+K  IDLEEEEGKL     KE+ +     +K FY+   GWIF
Sbjct: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/575 (64%), Positives = 447/575 (77%), Gaps = 6/575 (1%)

Query: 9   RKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESH--LNIDGKHDGIRLKKELEARHVSM 66
           +K+ +  +      + D+E     N    SSQ+ +   NIDGK +G RLKK L+ARHVSM
Sbjct: 24  KKEFKLPIQEEELINDDLER----NISSASSQDENDSYNIDGKTEGTRLKKALKARHVSM 79

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSY 126
                                  PVS LIAY+FVG LV+  M CLGEMATYIPLDGFTSY
Sbjct: 80  IAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSY 139

Query: 127 ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVT 186
           ASRYCDPALGFAVGY+YLFKY I+ PNQLTAAALV+QYWV +EKVNPGVW+TIFLV+IV+
Sbjct: 140 ASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVS 199

Query: 187 INXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS 246
           IN            WLSSFKVLVML L++LLF++MLGGGP HDRLGFR+++ PG+F+ YS
Sbjct: 200 INVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYS 259

Query: 247 EAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYL 306
           E I+G  G+FV+FV+VFVYA +AYLG EL GIVAAE +NPR+++P+AIKLT+YRIV+FYL
Sbjct: 260 ETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYL 319

Query: 307 VTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366
           ++IFLLGM VAY+DPLL++           PFVVAI N+GI  LPHI NACVL+FVFSAC
Sbjct: 320 ISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSAC 379

Query: 367 NSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFN 426
           NSDLYV+SRSLY LAIDNKAPKIFAKTN+WG+PY +L + +LFCLLAYM VSS SA++FN
Sbjct: 380 NSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFN 439

Query: 427 YFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIA 486
           YFVNVVSIFG++SWI+ILITYI FDRA+RAQGVDKST AY AP    GA+F+LFFCCLIA
Sbjct: 440 YFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIA 499

Query: 487 LIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDL 546
           LIKNFTVFL H+FDYKNFITGYIG+PVF  C+FGYK+   TK + P + DLYTFK  ID 
Sbjct: 500 LIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQ 559

Query: 547 EEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           EEE+GK+ DA + E+++ + KNF+WFY+KFLG IF
Sbjct: 560 EEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/575 (64%), Positives = 443/575 (77%), Gaps = 10/575 (1%)

Query: 17  SNSNTTSKDVENLDLSNQD----------DISSQESHLNIDGKHDGIRLKKELEARHVSM 66
            N     +++ N+DL   +            +  +S    DGK +  RL+K+L+ARH+SM
Sbjct: 34  DNFPVKEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAVPDGKDENTRLRKDLKARHISM 93

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSY 126
                                  PV++LIAY+FVG LV+  M CLGEMA+YIPLDGFTSY
Sbjct: 94  IAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMACLGEMASYIPLDGFTSY 153

Query: 127 ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVT 186
           ASRY DPALGFA+GY+YLFKY I+ PNQLTAAALV+QYW+SR++VNPGVWITIFLV+IV 
Sbjct: 154 ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVA 213

Query: 187 INXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS 246
           IN            WLSSFKV+VML LI+LLF+IMLGGGP+HDRLGFR+++DPGAF+ YS
Sbjct: 214 INVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNHDRLGFRYWRDPGAFKEYS 273

Query: 247 EAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYL 306
            AI+G KGKFVSFVAVFVY+LF+Y G EL GIV +E +NPR++VP+AIKLT+YRI+VFYL
Sbjct: 274 TAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYL 333

Query: 307 VTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366
            T+FLLGM VAYNDP LL            PFVVAI+N+GI VLPHIFNACVL+FVFSAC
Sbjct: 334 CTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSAC 393

Query: 367 NSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFN 426
           NSDLYV+SR+LY LAID KAPKIFAKT++WGVPYN+LIL +LFC LAYMNVSSGSA++FN
Sbjct: 394 NSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFN 453

Query: 427 YFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIA 486
           YFVNVVS+FG++SWI ILI YIYFD+A RAQG+DKS  AY AP    GAYFALFFC LIA
Sbjct: 454 YFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIA 513

Query: 487 LIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDL 546
           LIKNFTVFLGHKFDYK FITGYIG+PV+II + GYK I  TK +K  + DLYTFKE+ D 
Sbjct: 514 LIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKVIKSTDVDLYTFKEIYDR 573

Query: 547 EEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           EEEEG++ D  ++E+++S+ KN +WFYEKFLG IF
Sbjct: 574 EEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/575 (63%), Positives = 439/575 (76%), Gaps = 10/575 (1%)

Query: 17  SNSNTTSKDVENLDLSNQD----------DISSQESHLNIDGKHDGIRLKKELEARHVSM 66
            N     +++ N+DL   +            +  +S    DGK +  RLKKEL+ARH+SM
Sbjct: 32  DNFPVKEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAIADGKDENTRLKKELKARHISM 91

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSY 126
                                  PV++LIAY+FVG LV+  M CLGEMA+YIPLDGFTSY
Sbjct: 92  IAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDGFTSY 151

Query: 127 ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVT 186
           ASRY DPALGFA+GY+YLFKY I+ PNQLTAAALV+QYW+SR++VNPGVWITIFLV+IV 
Sbjct: 152 ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVA 211

Query: 187 INXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS 246
           IN            WLSSFKV+VML LI+LLF+IMLGGGP HDRLGFR+++DPGAF+ YS
Sbjct: 212 INIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYS 271

Query: 247 EAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYL 306
            AI+GS GKF SFVAVFVY+LF+Y G EL GIV +E +NPR++VP+AIKLT+YRI+VFYL
Sbjct: 272 TAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYL 331

Query: 307 VTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366
            T+FLLGM VAYNDP LL            PFVVAI+N+GI VLPHIFNACVL+FVFSAC
Sbjct: 332 CTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSAC 391

Query: 367 NSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFN 426
           NSDLYV+SR+LY LAID KAPKIFAKT+KWGVPYN+LIL +LFC LAYMNVSSGSA++FN
Sbjct: 392 NSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAYMNVSSGSAKIFN 451

Query: 427 YFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIA 486
           YFVNVVS+FG++SWI ILI YIYFD+A RAQG+DKS  AY AP    GAYFAL FC LIA
Sbjct: 452 YFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALSFCILIA 511

Query: 487 LIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDL 546
           LIKNFTVFLGHKFDYK FITGYIG+PV+I+ + GYK I  TK +K  + DLYTFKE+ D 
Sbjct: 512 LIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVIKSTDVDLYTFKEIYDR 571

Query: 547 EEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           EEEEG++ D  ++E+++ + KN +WFYEKFLG IF
Sbjct: 572 EEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/569 (63%), Positives = 438/569 (76%)

Query: 13  EKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXX 72
           E+ + N +    +V +   ++    +  +S    DGK +  RL+K+L+ARH+SM      
Sbjct: 38  EQEIYNIDLEENNVSSRSSTSTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGS 97

Query: 73  XXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYASRYCD 132
                            PVS+LIAY FVG LV+  M CLGEMA+YIPLDGFTSYASRY D
Sbjct: 98  LGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVD 157

Query: 133 PALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXX 192
           PALGFA+GY+YLFKY I+ PNQLTAAALV+QYWVSR++VNPGVWITIFLV+IV IN    
Sbjct: 158 PALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFLVVIVAINIVGV 217

Query: 193 XXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGS 252
                   WLSSFKV+VML LI+LLF+IMLGGGP HDRLGFR+++DPGAF+ YS AI+GS
Sbjct: 218 RFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGS 277

Query: 253 KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLL 312
           KGKFV+F +VFVY+LF+Y G EL GIV +E KNPR++VP+AIKLT+YRI+VFYL T+FLL
Sbjct: 278 KGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLL 337

Query: 313 GMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYV 372
           GM VAYNDP LL            PFVVAI+N+GI VLPHIFN CVL+FVFSACNSDLYV
Sbjct: 338 GMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYV 397

Query: 373 ASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVV 432
           +SR+LY LAID KAPKIFAKT+KWGVPY +L++ +LFC LAYMNVS+GSA++FNYFVNVV
Sbjct: 398 SSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVV 457

Query: 433 SIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFT 492
           S+FG++SWI ILI YIYFDRA RAQGVDKS  AY AP    GAYFALFFC LIALIKNFT
Sbjct: 458 SMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAPGQRYGAYFALFFCILIALIKNFT 517

Query: 493 VFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEEGK 552
           VFLGH FDYK FITGYIG+P+++  + GYK I  TK VKP +ADLYT KE+ D EEE+GK
Sbjct: 518 VFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTKVVKPADADLYTLKEIYDREEEQGK 577

Query: 553 LWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           L D  ++E+++ + KN +WFYEKFLG IF
Sbjct: 578 LQDQEKEERLQRNGKNLEWFYEKFLGNIF 606

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/577 (63%), Positives = 441/577 (76%), Gaps = 9/577 (1%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHV 64
           Q+ Y  DLE+    +N +S+       S +DD     S    DGK +  RL+K+L+ARH+
Sbjct: 40  QEIYNIDLEE----NNVSSRSSTFTSPSARDD-----SFAVPDGKDETTRLRKDLKARHI 90

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFT 124
           SM                       PV++LIAY+FVG LV+  M CLGEMA+YIPLDGFT
Sbjct: 91  SMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDGFT 150

Query: 125 SYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVII 184
           SYASRY DPALGFA+GY+YLFKY I+ PNQLTAAALV+QYWVSR++VNPGVWITIF+V+I
Sbjct: 151 SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVI 210

Query: 185 VTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRP 244
           V IN            WLSSFKVLVML LI+LLF+IMLGGGP HDRLGFR+++DPGAF+ 
Sbjct: 211 VAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKE 270

Query: 245 YSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVF 304
           YS AI G KGKFVSF+AVFVY+LF+Y G EL GIV +E +NPR++VP+AIKLT+YRI+VF
Sbjct: 271 YSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVF 330

Query: 305 YLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFS 364
           YL T+FLLGM VAYNDP L+            PFVVAI+N+GI VLPHIFNACVL+FVFS
Sbjct: 331 YLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFS 390

Query: 365 ACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQV 424
           ACNSDLYV+SR+LY LAID KAPKIF+KTNKWGVPYN+LI  +LFC LAYMNVS+GSA++
Sbjct: 391 ACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKI 450

Query: 425 FNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCL 484
           FNYFVNVVS+FG++SWI ILI YIYFD+A RAQG+DKS  AY AP    GAYFAL FC  
Sbjct: 451 FNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIF 510

Query: 485 IALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELI 544
           IALIKNFTVFLGHKFDYK FITGYIG+PV++  + GYK I  TK +K  + DLYTFKE+ 
Sbjct: 511 IALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTKVIKSTDVDLYTFKEIY 570

Query: 545 DLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           D EEE+GK+ D  ++E+++ + KN +WFYEKFLG IF
Sbjct: 571 DREEEQGKIEDQEKEERLKKNGKNMEWFYEKFLGHIF 607

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/577 (63%), Positives = 448/577 (77%), Gaps = 8/577 (1%)

Query: 13  EKIVSNSNTTSKDVENLDLSNQDDISSQ--------ESHLNIDGKHDGIRLKKELEARHV 64
             IV + +  S +++N     Q DI  +        +++   DGK    RLKK+L+ARHV
Sbjct: 12  SSIVPSFSNHSDNIDNKKEPFQIDIEKESTESVALDDTNEQFDGKCSDQRLKKDLKARHV 71

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFT 124
           SM                       PVS+LI+YSFVG LV+ VM+C+GEMA YIPLDGFT
Sbjct: 72  SMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPLDGFT 131

Query: 125 SYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVII 184
           SYASRYCDPALGFAVGY+YL KY I+ PNQLTAAALV+QYW+ REKVNPGVWITI LV+I
Sbjct: 132 SYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVI 191

Query: 185 VTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRP 244
           V IN            WLSSFKV+VML LI+L+F+IMLGG P+HDRLGFR++K PGAF+ 
Sbjct: 192 VVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKE 251

Query: 245 YSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVF 304
           YS++I G  G+FVSFV+ FVY LF YLG EL GIVAAE +NPR+N+P+AIKLT++RI++F
Sbjct: 252 YSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIF 311

Query: 305 YLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFS 364
           Y++TIFLLGM V+ NDPLLL+           PFVVAI N+GI  LPHIFNACVLMFVFS
Sbjct: 312 YIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFS 371

Query: 365 ACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQV 424
           ACNSDLYVASR+LY LAIDNKAPKIFAKTN++G+PYNSL + +LFCLLAYM+VSSGSA++
Sbjct: 372 ACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKI 431

Query: 425 FNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCL 484
           FNYFVNVVSI G+++WI+ILITYI FDRA+RAQG+DKST AY APL   GAYF+LFFCCL
Sbjct: 432 FNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCL 491

Query: 485 IALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELI 544
           +ALIKNFTVFL HKFDY+NFITGYIG+P+F IC+FGYK+++ TK  KPEE DL++FK  I
Sbjct: 492 LALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTKIRKPEEVDLFSFKAAI 551

Query: 545 DLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           D EEE+G++ DAA  E+++ + KN++WFYE +LG IF
Sbjct: 552 DQEEEDGRIKDAATAERIKKNGKNWEWFYETYLGKIF 588

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/562 (62%), Positives = 422/562 (75%), Gaps = 1/562 (0%)

Query: 20  NTTSKDVENLDLSNQDDISSQESHLN-IDGKHDGIRLKKELEARHVSMXXXXXXXXXXXX 78
             +   V  +   +  D+ +  +H +  DGKHDGIRLKK LEARHVSM            
Sbjct: 43  GQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLL 102

Query: 79  XXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYASRYCDPALGFA 138
                      P +ILIAY+FVG LV+ VM+CLGEMA YIPLDGFTSY++RY DPALGFA
Sbjct: 103 IGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMAAYIPLDGFTSYSTRYADPALGFA 162

Query: 139 VGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXX 198
           VGY+YLFKY II PNQLTA ALV+QYWV R+KVNPGVWITI LV I+TIN          
Sbjct: 163 VGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEI 222

Query: 199 XXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVS 258
             ++S+ K+ VML LI+LL V+  GGGP+H+ LGF+++K+PGAF+ YS AI+G+KG+FVS
Sbjct: 223 EYYISAVKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVS 282

Query: 259 FVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAY 318
           F +VFV ALFAYLGTELCGIV +ECKNPR+ VP+AIKLT+YRI+VFYL++IFLLGM V +
Sbjct: 283 FASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPF 342

Query: 319 NDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLY 378
           NDPLL+            PFVVAI NAGIPVLPHI NAC+L+FVFSA NSDLYVASRSLY
Sbjct: 343 NDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLY 402

Query: 379 GLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLM 438
           GLAIDNKAP+IFAKTNK GVPY SL++ +LF LLAYMNVSSGS++VF YFVN VSIFGL+
Sbjct: 403 GLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLL 462

Query: 439 SWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHK 498
           SWI+ILITYI FD+A R QG+DKSTLAY +PL   GA+F+LFFC LI LIKNF  FLG  
Sbjct: 463 SWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDT 522

Query: 499 FDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQ 558
           FDYK+FITGYIGIP +II + GYK    TK +  EE DL +FKE +DLEEEEGK+ D  +
Sbjct: 523 FDYKSFITGYIGIPTYIISYIGYKLWYKTKIIPSEEVDLVSFKEAVDLEEEEGKMLDEER 582

Query: 559 KEKMESSPKNFKWFYEKFLGWI 580
              + +  K+ KW YEK  GW+
Sbjct: 583 AAHLAAHGKDLKWCYEKIFGWV 604

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/576 (61%), Positives = 426/576 (73%), Gaps = 6/576 (1%)

Query: 11  DLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNI--DGKHDGIRLKKELEARHVSMXX 68
           DL+K  S+  T S D+E   +S     +S     +I  DGK +G RLKK L+ARHVSM  
Sbjct: 19  DLQK-QSDQVTISSDLEQNSISIASSRNSSIGDRDIFDDGKTEGFRLKKNLKARHVSMIA 77

Query: 69  XXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYAS 128
                                P S+ I YSFVG LV+  M+CLGEMA +IPLDGFTSYAS
Sbjct: 78  IGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEMAAFIPLDGFTSYAS 137

Query: 129 RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTIN 188
           RY DPALGFAVGYSYL KYLI+  NQLTA A+V+QYWV R+ +NPGV+ITIFL++IVTIN
Sbjct: 138 RYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNPGVFITIFLILIVTIN 197

Query: 189 XXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEA 248
                       WLSSFKVLVML LI+L+F+IMLGGGP+HDRLGFR+++DPG+F+PYS +
Sbjct: 198 IFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGFRYWRDPGSFKPYSSS 257

Query: 249 ISGS---KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFY 305
           I       GKFVSF + FVYALF YLG EL GIVAAE +NPR+N+P+AIKLT+YRI++FY
Sbjct: 258 IISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNIPKAIKLTMYRIIIFY 317

Query: 306 LVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSA 365
           ++TI LL M VAYNDPLLL+           PFVVAI+N+GI +LPHIFN CVL FV SA
Sbjct: 318 VITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINILPHIFNVCVLAFVLSA 377

Query: 366 CNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVF 425
            NSDLYVASRSLY LAIDNKAPK F KTNKWG+PY SL     F  LAYMNVSS ++ VF
Sbjct: 378 ANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFSCLAYMNVSSSASNVF 437

Query: 426 NYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLI 485
           NYFVN VSIFG++SWI IL+TYI+FD+A +AQG+DKS   Y AP    GAYFALFFCC++
Sbjct: 438 NYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPWQPYGAYFALFFCCVL 497

Query: 486 ALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELID 545
           AL+KNFTVFLG +FDYKNFITGYIGIPVF ICF GYK +  TK  +PEE DL T K LID
Sbjct: 498 ALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTKTHRPEEVDLVTLKALID 557

Query: 546 LEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
            EEE+GK+ DA ++E++++  K++ WFY++FLG IF
Sbjct: 558 QEEEDGKIEDAEREERLKNGNKDWAWFYDRFLGKIF 593

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/583 (60%), Positives = 423/583 (72%), Gaps = 4/583 (0%)

Query: 3   FIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQD-DISSQESHLNIDGKHDGIRLKKELEA 61
           F Q S    L+++       + +   L  ++   D  +Q    N DGKH+GIRLKK+L+A
Sbjct: 6   FAQASEASTLDELKGPKLAAAGEGRGLRHTHSSTDQEAQSVDWNYDGKHEGIRLKKDLQA 65

Query: 62  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLD 121
           RHVSM                       P SILIAYS +G++V+ VM+CLGEMA YIPLD
Sbjct: 66  RHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLGEMAAYIPLD 125

Query: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
           GFTSYA+RY DPALGFAVG++YLFKYL++TPNQLTA ALV+Q+W+   +V+PGVWIT+ L
Sbjct: 126 GFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAARVSPGVWITVVL 185

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
            +IV IN            WLSSFKVLVMLC+++LL V+ LGGGP+HDRLGFR++ DPGA
Sbjct: 186 AVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDRLGFRYWSDPGA 245

Query: 242 FRPYSEA---ISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTL 298
           F+ YS+    I G  GKFV+F++VFVYALFAYLGTELCGIVAAECK+PRRNVPRAIKLTL
Sbjct: 246 FKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPRRNVPRAIKLTL 305

Query: 299 YRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 358
           YRIVVFYLVTIFLLGM VAYNDPLL+Q           P+VVAI+NA IPVLP++FNACV
Sbjct: 306 YRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVIPVLPNLFNACV 365

Query: 359 LMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVS 418
           L FVFSACNSDLYV SRSLYGLAID KAPK+FA+TNKWGVPYN+L  C LFC LAYM+VS
Sbjct: 366 LTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCTLFCCLAYMSVS 425

Query: 419 SGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFA 478
             +   F YFVNV SIFGLMSW++ILITYI FDRA RAQG+ KSTL+Y AP      + A
Sbjct: 426 KSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVA 485

Query: 479 LFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLY 538
           L FC  +ALIKNF  F+G + D   FITGYIG+P++I CF GYK +  TK++  +E DL+
Sbjct: 486 LIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYKIVHKTKWIPSKEVDLF 545

Query: 539 TFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           TFKE IDLEEEE     A  KE++     ++K  Y+  LGWIF
Sbjct: 546 TFKEAIDLEEEECIRERALMKEQLAKGGLSWKKIYDNVLGWIF 588

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/534 (65%), Positives = 410/534 (76%), Gaps = 3/534 (0%)

Query: 49  KH-DGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIV 107
           KH DG  LKK L+ARHVSM                       P S+ IAYSFVG LV+  
Sbjct: 94  KHTDG--LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFT 151

Query: 108 MTCLGEMATYIPLDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVS 167
           M  +GEMA+YIP+DGFTSYASRY DPALGFAVGY YLFKYLI+ PNQLTAA+LV+QYW+ 
Sbjct: 152 MAAIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211

Query: 168 REKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPS 227
           R+ VNPGVWITIFLV+IV IN            WLSSFKVLVML LI+L+F++MLGGGP 
Sbjct: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPD 271

Query: 228 HDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPR 287
           HDRLGFR+++ PGAF+PYS+AI GS GKFV+FV+VFVYALFAYLG EL GIVAAE  NPR
Sbjct: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331

Query: 288 RNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGI 347
           ++VPRA+KLT++RIV+FYLVTIFLLGM VAYNDP LL            PFVVAI+N+GI
Sbjct: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGI 391

Query: 348 PVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCI 407
            VLPHIFNACVL+FVFSACNSDLYV SRSLY LA+D KAP IF +T  WG+P+ SL +C+
Sbjct: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451

Query: 408 LFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYA 467
           LF LLAYMNVSSGSAQVFNYFVNVVSIFGL+SWI I ITYI F RA++ QGVD+S  AY+
Sbjct: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511

Query: 468 APLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGT 527
           AP    G YF+L +C  IA IKNFTVFLGH FDYKNFITGYIG+PVF+I +FGYK+I+ T
Sbjct: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571

Query: 528 KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           K VK  E DL+T KE+ D +E EGK+ D  ++ ++  +  + +W YEKFLG IF
Sbjct: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/554 (60%), Positives = 405/554 (73%), Gaps = 10/554 (1%)

Query: 21  TTSKDVENLDL-SNQDDISSQESHLNI------DGKHDGIRLKKELEARHVSMXXXXXXX 73
           T SK   N+++ S+Q   S  +S  ++      DGK++GIRLKK+L++RH+SM       
Sbjct: 24  TASKLALNIEVQSDQSSKSLCDSASDVLASEIGDGKYEGIRLKKQLKSRHISMIAIGGSL 83

Query: 74  XXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYASRYCDP 133
                           PVS LIAY+FVG +V+  M CLGEMAT+IPLDGFTSYASRYCDP
Sbjct: 84  GTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMATFIPLDGFTSYASRYCDP 143

Query: 134 ALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXX 193
           ALGFAVGY+YL KY I+ PNQLTAAA+V+QYWV R+ VNPG+W+T+   +I  IN     
Sbjct: 144 ALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGIWVTLVFAVITVINIFGVR 203

Query: 194 XXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSK 253
                  WLSS KVL+M+ LI+LLFVIMLGG  SHDRLGFR++K PGAF  YS+ ISGS 
Sbjct: 204 FFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRYWKHPGAFNDYSDDISGSL 263

Query: 254 GKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLG 313
           GKFVSFVAV V  +FAYLG EL GIVAAE  NPRR+VP+AIKLT YRI+VFY+V+IFLLG
Sbjct: 264 GKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIKLTFYRILVFYVVSIFLLG 323

Query: 314 MTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVA 373
           M V YND  L+            PF +AI NAGI VLP IFN C+L+FVFSA NSDLYVA
Sbjct: 324 MCVPYNDEKLVT--TNENSLTASPFSIAILNAGITVLPDIFNGCLLIFVFSAANSDLYVA 381

Query: 374 SRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVS 433
           SR+LY LA+DNKAPKIFA TN+WG+PYNSL +  LFCLLAYM VSS SAQVF YFVNVVS
Sbjct: 382 SRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYMTVSSSSAQVFKYFVNVVS 441

Query: 434 IFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTV 493
           I GL++WI+ILITYI FDRA+RAQ VDKST AY AP    GAY +LFFCCLIA+IKNFTV
Sbjct: 442 IAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYGAYVSLFFCCLIAIIKNFTV 501

Query: 494 FLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEEGKL 553
           FLGH FDYK FITGYIG+P+F++C+FGYK    ++       DL + K L+D E+ E +L
Sbjct: 502 FLGH-FDYKTFITGYIGLPIFVLCYFGYKITCKSEIRSARYVDLVSQKSLVDREQVEYEL 560

Query: 554 WDAAQKEKMESSPK 567
            +  ++E+M ++ K
Sbjct: 561 IEQLKREEMIANTK 574

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  338 bits (866), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/533 (35%), Positives = 297/533 (55%), Gaps = 22/533 (4%)

Query: 12  LEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXX 71
           ++++ SN  T      NL+  N D +S        D +H+   LKK L  RH+ +     
Sbjct: 19  MKEVKSNEETYRTSHSNLESQNSDVVS--------DYEHN---LKKGLSNRHIQLIALGG 67

Query: 72  XXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRY 130
                             P  + +++  +  +VY +M  L EM  Y+P  G      +RY
Sbjct: 68  CIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVTRY 127

Query: 131 CDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXX 190
            DP+LGFA G++Y + Y ++   +LTAAA +++YW   ++V  GVWITIFL+++V +N  
Sbjct: 128 VDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWT--DQVPQGVWITIFLIVVVVLNFS 185

Query: 191 XXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAIS 250
                     W +S K++ +L L+V+  VI  GG P+HDR+GFR++++PGAF  +     
Sbjct: 186 AVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYH--ITG 243

Query: 251 GSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTI 309
           G+ G+F+      + + FA+ L  EL G+   E K+ RRN+ +A +  +YRI+ FYL + 
Sbjct: 244 GNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSS 303

Query: 310 FLLGMTVAYNDP-LLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNS 368
            ++G+ VA ND  LLL            PFV  I N+GIPVL H+ N  +L   +SA NS
Sbjct: 304 LMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNS 363

Query: 369 DLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYF 428
             Y +SRS+  L+    APKIF+K N++GVPYN++ LC L   LAY+NVSS S++VF + 
Sbjct: 364 FFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWL 423

Query: 429 VNVVSIFGLMSWIAILITYIYFDRA-LRAQGVDKSTLAYAAPLASKGAYFALFFCCLIAL 487
            N+ +I G + W  I + YI F +A L  + +D+  + Y +PL    AYF      +I L
Sbjct: 424 SNICTISGFIGWFLIGVAYIRFRKAILFNRLLDR--IPYRSPLQPFSAYFFTIVVAIITL 481

Query: 488 IKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKP-EEADLYT 539
              + VF+  ++DYK+F+T YI +P+F+  + G+K I  T+F  P ++ D+ T
Sbjct: 482 TNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVIT 534

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  334 bits (857), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/520 (36%), Positives = 287/520 (55%), Gaps = 18/520 (3%)

Query: 32  SNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPV 91
           S +D+  S+E    ID K+    L +EL+ R VS+                       P+
Sbjct: 15  SGEDECESEE----IDEKNG--NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPI 68

Query: 92  SILIAYSFVGFLVYIVMTCLGEMATYIPLD-GFTSYASRYCDPALGFAVGYSYLFKYLII 150
           S+ IAY F G L+ +V+  L EMA++ P+D GF+ Y +RY DPA GFA G++Y  KY I+
Sbjct: 69  SLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIV 128

Query: 151 TPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVM 210
               LTA  LV+ YW  R  VN GVW+T+  V +  +N             L+ FK+LV+
Sbjct: 129 LSANLTAFGLVIGYW--RPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVL 186

Query: 211 LCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY 270
           + + +   +I  GG P+H   GFR++++ GA  PY   + G  GKF+ + A  V ++F +
Sbjct: 187 VIVYITCLIITCGGAPNHTTTGFRYWRESGAL-PY--LVGGGTGKFLGWWACVVQSIFGF 243

Query: 271 LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXX 330
           +G+E+ GIV  E  NP++ +P++     +RI   Y+  +F+LG+ ++  +  L+      
Sbjct: 244 MGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD 303

Query: 331 XXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIF 390
                 PFV+AI ++GI VLP+  NA +L+F+ S+ N+D+Y+ SR LYGLA D  APKIF
Sbjct: 304 ANAS--PFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIF 361

Query: 391 AKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYF 450
              N++ VP    +   L   LAYMN    +A VF+Y  + VS+FG+++W  ILI YI +
Sbjct: 362 LLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINY 421

Query: 451 DRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIG 510
           DRA++A+G+    + +        AY  LFF  +I     +  F+  KF YK FIT YIG
Sbjct: 422 DRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFI-IKFHYKTFITSYIG 480

Query: 511 IPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEE 550
           +   I+   GYK    TKFVKP E    +F+   + E EE
Sbjct: 481 VFANILMVIGYKLYFKTKFVKPSEI---SFRTRNEHEGEE 517

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/588 (33%), Positives = 316/588 (53%), Gaps = 35/588 (5%)

Query: 5   QDSYRKD---LEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEA 61
            D+ + D   +EKI  N + +S      DL    D+    S   +DG  +  +LK+ L++
Sbjct: 56  SDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPS---VDGDSEPHKLKQGLQS 112

Query: 62  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLD 121
           RHV +                       P  + I+Y  +  ++Y +M  LGEM  ++P D
Sbjct: 113 RHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGD 172

Query: 122 GFTSYAS------RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGV 175
           G  S  S      RY DP+LGFA G++Y + Y+I+   + TAA+ V++YW +   V  GV
Sbjct: 173 GSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTT--AVPKGV 230

Query: 176 WITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRF 235
           WITIFL ++V +N            W +S K+L ++ LI+L F++  GGGP+HDRLGFR+
Sbjct: 231 WITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRY 290

Query: 236 YKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAI 294
           ++ PGAF  +     GS G F       +   FA+ LG EL  + +AEC + RRN+ +A 
Sbjct: 291 WQHPGAFAHH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKAS 348

Query: 295 KLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHI 353
           +  ++R++ FY++    + + V YNDP L+             PFV+ I+NAGI VLPHI
Sbjct: 349 RRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHI 408

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N C+L   +SA N+ ++ ++RSL  +A   +APK   + NKWGVPY ++ +  L   LA
Sbjct: 409 INGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLA 468

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGV-DKSTLAYAAPLAS 472
           Y+NVSS +A VFN+F N+ +I G + W+   I Y+ F +A+   G+ D+  L +      
Sbjct: 469 YLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGLYDR--LPFKTWGQP 526

Query: 473 KGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK--F 529
              +F+L    +I +   + +F+   +   +FI  YI +P+F++ +FG+K Y R  +  +
Sbjct: 527 YTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRTWRQWW 586

Query: 530 VKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFL 577
           +   E D+ T   L+++EE+  ++      E+M   P  FK   +KFL
Sbjct: 587 LPVSEIDVTT--GLVEIEEKSREI------EEMRLPPTGFK---DKFL 623

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  333 bits (854), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/574 (35%), Positives = 305/574 (53%), Gaps = 36/574 (6%)

Query: 7   SYRKDLEKIVSNSNTTSKDVENLDL--SNQDDISSQESHLNIDGKHDGIRLKKELEARHV 64
           S  KD E       T  KD  +L +  S  +D  S ES     G     ++K+ L+ RH+
Sbjct: 2   SLSKDYEA------TREKDGSHLIIKPSIAEDAVSMESL----GSVKETQVKRALKPRHI 51

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGF 123
           SM                       PV  LIAY F+G L Y V   LGEMAT+IP+   F
Sbjct: 52  SMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSF 111

Query: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183
           T +  R+  PALG A GY Y   + I    +L+    ++Q+W   + V    WI IF VI
Sbjct: 112 TVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT--DAVPLTAWIAIFWVI 169

Query: 184 IVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243
           +   N            W++  KVL ++  I+  F+++ G G +   +GFR++++PG + 
Sbjct: 170 LTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWG 228

Query: 244 PYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVV 303
           P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ VPRAI    +RI+ 
Sbjct: 229 PGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILF 288

Query: 304 FYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVF 363
           FY++++  +G+ V +NDP L             PFV+AI+N+G  VLPHIFNA +L  + 
Sbjct: 289 FYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTII 345

Query: 364 SACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQ 423
           SA NS++YV SR  Y +A++  APK    T K G+PY +++   +   LAY+  SSG++ 
Sbjct: 346 SAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASA 405

Query: 424 VFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCC 483
           VFN+ +N+ ++ G  +WI I I++I F +AL+ QG+ +  L + A     GAY+A FF  
Sbjct: 406 VFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIG 465

Query: 484 LIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKE 542
           +I +I+ FT F   KF   +F T YI + +F + + G++ + RG  F+K E+ DL T   
Sbjct: 466 VIIIIQGFTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDT--- 521

Query: 543 LIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKF 576
             D  E +  +W+       E  P+N    +EKF
Sbjct: 522 --DRREIDDVVWE-------EQKPRN---LWEKF 543

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  333 bits (853), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/546 (34%), Positives = 299/546 (54%), Gaps = 19/546 (3%)

Query: 18  NSNTTSKDVENL--DLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXX 75
           +S+   K+ E L  + S   D+ S ES     G     ++K+ L+ RH+SM         
Sbjct: 7   HSSEKEKNSEELVSEFSRSKDVVSLESL----GSVKETQVKRALKPRHISMIALGGTIGT 62

Query: 76  XXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPA 134
                         PV  LIAY F+G L Y+V   LGEMAT+IP+   F  +  R+  PA
Sbjct: 63  GLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPA 122

Query: 135 LGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXX 194
           LG A GY Y   + I    +L+    V+Q+W   + V    WI I  V++V+ N      
Sbjct: 123 LGAANGYMYFLSWSITFALELSVVGQVIQFWT--DAVPLTAWIIILWVVLVSANLAPVKF 180

Query: 195 XXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKG 254
                 W++  KVL ++  I+  F+++ G G +   +GFR++++PG + P   +   ++G
Sbjct: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEG 239

Query: 255 KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGM 314
           +F+ +V+  + A F Y GTEL GI A E  NPR+ VPRAI    +RI+ FY++++  +G+
Sbjct: 240 RFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGL 299

Query: 315 TVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVAS 374
            V +NDP L             PFV+AI+N+G  VLPHIFNA +L  + SA NSD+Y++S
Sbjct: 300 LVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISS 356

Query: 375 RSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSI 434
           R LY + ++  APK    T K G+PY +++   L   LAY+  S G++ VF++ +N+ ++
Sbjct: 357 RVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAV 416

Query: 435 FGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVF 494
            G  +W+ I + +I F +AL+ QG+ +  L + A     GAY+A FF  +I +I+ FT F
Sbjct: 417 AGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAF 476

Query: 495 LGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKELID---LEEEE 550
              KF+  +F T Y+ + +F   + G++ + RG  F K E+ DL T +  ID    EE+E
Sbjct: 477 -APKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDE 535

Query: 551 GK-LWD 555
            K LW+
Sbjct: 536 PKNLWE 541

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  328 bits (841), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/511 (35%), Positives = 281/511 (54%), Gaps = 9/511 (1%)

Query: 25  DVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXX 84
           +++N     +  +S   S  +  G  +   L +EL    VS+                  
Sbjct: 3   EIKNTVTVVEPTLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTA 62

Query: 85  XXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLD-GFTSYASRYCDPALGFAVGYSY 143
                P+SI +AY F G ++ +V+  L EMA + P+D GF+ Y ++Y DPA GFA G++Y
Sbjct: 63  LARGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNY 122

Query: 144 LFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLS 203
             KY I+    LTA  LV+ YW  R  +N  VW+T+       +N            +++
Sbjct: 123 FLKYAIVLSANLTAFGLVIGYW--RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMT 180

Query: 204 SFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVF 263
             K+ ++L + ++  VI  GGGP H  +GFR++++ G F PY   + G+ GKF+ + A  
Sbjct: 181 VAKLTILLLIFIVCLVITCGGGPDHTTIGFRYWRESG-FLPY--LVKGNTGKFLGWWACV 237

Query: 264 VYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLL 323
           + ++F ++G+E+ GI+  E  NPR+ +P+A +  + RI VFY+  +F+LG+ V+ ++  L
Sbjct: 238 IQSIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKL 297

Query: 324 LQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAID 383
           +            PFV+AI  +GI VLP   NA +L+F+ S+  +D+Y+ SR LYGLA D
Sbjct: 298 VHAHSTDANAS--PFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKD 355

Query: 384 NKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAI 443
             APKIF + NK  +P    ++  L   LAYMN    +A VF Y  + VS+FG+++W  I
Sbjct: 356 GAAPKIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYI 415

Query: 444 LITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKN 503
           L+ YI++DR +++ GV    + +  P     AY ALFF  +I     ++ F+  KF+YK 
Sbjct: 416 LVAYIHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKL 474

Query: 504 FITGYIGIPVFIICFFGYKYIRGTKFVKPEE 534
           FIT YIGI   ++   GYK    TK+VKPEE
Sbjct: 475 FITSYIGIFANVLLVLGYKLYYKTKWVKPEE 505

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 198/551 (35%), Positives = 303/551 (54%), Gaps = 19/551 (3%)

Query: 16  VSNSNTT-----SKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXX 70
           VSNS        SKD  NL L   DD SS+    + +G      +K+ L+ RHVSM    
Sbjct: 32  VSNSKIDDPLRFSKD-NNLTLEAIDDDSSR--MFDPEGSIGQAEVKRALKPRHVSMIALG 88

Query: 71  XXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASR 129
                              PV  LIA+  +G L Y V   LGEMAT+IP+   FT ++ R
Sbjct: 89  GTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQR 148

Query: 130 YCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINX 189
           +  PA+G A GY Y F + I    +L+    ++QYW   + V    WI IF V++V+ N 
Sbjct: 149 FISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT--DAVPLEAWIAIFWVLLVSFNM 206

Query: 190 XXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAI 249
                      W++S KV+ ++  ++    ++ G GP    +GFR+++ PG +     A 
Sbjct: 207 FPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAK 265

Query: 250 SGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTI 309
           + +K +F+ +V+  + A F Y GTEL GI A E KNPR+ VPRAI    +RI++FY+ ++
Sbjct: 266 NVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSL 325

Query: 310 FLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSD 369
           F +G+ V YNDP L +           PF++AI N   PVLPHIFNA +L  + SA NS+
Sbjct: 326 FFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSN 384

Query: 370 LYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFV 429
           +YV SR L+GL+ +N APK F+KT K GVP+ ++++  +F  LAY+NVS+ + +VF++ +
Sbjct: 385 VYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLL 444

Query: 430 NVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIK 489
           N+ +I G ++W+ I I++I F + L+ +G+ +  L Y A      AY+A FF  +I +I+
Sbjct: 445 NITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQ 504

Query: 490 NFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEE----ADLYTFKELID 545
            FT F  H F+  +F   YI + +F I +  ++ I  TK  +  +           ++I 
Sbjct: 505 GFTAFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVII 563

Query: 546 LEEEEGK-LWD 555
            EEEE K LW+
Sbjct: 564 WEEEEPKNLWE 574

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 195/559 (34%), Positives = 305/559 (54%), Gaps = 23/559 (4%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNID-GKHDGIRLKKELEAR 62
           ++D   K+L  + S  N          ++ QD  S +E   + D G+     +K+EL+ R
Sbjct: 41  LKDEKSKELYPLRSFPN---------GVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQR 91

Query: 63  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-D 121
           H+ M                       PV  LI+Y F+G L Y V   LGEMAT+IP+  
Sbjct: 92  HIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTS 151

Query: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
            FT ++ R+  PA G A GY Y F + +    +L+    V+Q+W     V    WI+IF 
Sbjct: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTY--AVPLAAWISIFW 209

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
           VII  +N            W++S KV+ ++  ++  F ++ G G +   +GFR++++PGA
Sbjct: 210 VIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGA 268

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
           + P   + + ++ +F+ +V+  + A F + GTEL GI A E  NPR+ VPRAIK  ++RI
Sbjct: 269 WGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRI 328

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
           + FY+ ++  +G+ V YNDP L             PF++AI+N+G  VLPHIFNA +L  
Sbjct: 329 LTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS---PFIIAIENSGTKVLPHIFNAVILTT 385

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
           + SA NS++YV SR L+GL+    APK F+KT K GVPY ++    +F  LAYM  S+G 
Sbjct: 386 IISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGG 445

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
            +VF + +N+  + G  +W+ I +++I F +AL+ +G+ +  L + A L    AY+A FF
Sbjct: 446 GKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFF 505

Query: 482 CCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTF 540
             +I LI+ FT F    F+  NF+  YI + +F+  +  ++ I   +FV K E+ D+ + 
Sbjct: 506 MVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSD 564

Query: 541 K---ELIDLEEEEGK-LWD 555
           +   E I  EE E K LWD
Sbjct: 565 RRDIEAIVWEEPEPKTLWD 583

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  328 bits (840), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/558 (34%), Positives = 306/558 (54%), Gaps = 21/558 (3%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           ++D   K+L  +    ++ S  V+  D  +  D+   E      G+     +K+EL+ RH
Sbjct: 41  LKDEKNKELYPL----HSFSTRVDGEDTFSMGDVIRDEDQ----GEVRNAEVKRELKQRH 92

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DG 122
           + M                       PV  LI+Y F+G L Y V   LGEMAT+IP+   
Sbjct: 93  IGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSS 152

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182
           FT ++ R+  PA G A GY Y F + I    +L+    V+++W +  KV    WI+IF V
Sbjct: 153 FTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTN--KVPLAAWISIFWV 210

Query: 183 IIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAF 242
           II  +N            W++S KVL ++  ++  F ++ G G +   +GFR++++PGA+
Sbjct: 211 IITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAW 269

Query: 243 RPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302
            P   +   ++G+F+ +V+  + A F + GTEL GI A E  NPR+ VPRAIK  ++RI+
Sbjct: 270 GPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRIL 329

Query: 303 VFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFV 362
            FY+ ++  +G+ V YNDP L             PF++AI+N+G  VLPHIFNA +L  +
Sbjct: 330 TFYIGSLLFIGLLVPYNDPKL---TTATSYVSVSPFIIAIENSGTKVLPHIFNAVILTTI 386

Query: 363 FSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSA 422
            SA NS++YV SR L+GL+ +  APK  ++T K GVPY ++ +  +F  LAYM  S+G  
Sbjct: 387 ISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTGGD 446

Query: 423 QVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFC 482
           +VF + +N+  + G  +W+ I I++I F +AL+ +G+ +  L + A L    AYFA  F 
Sbjct: 447 KVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATFM 506

Query: 483 CLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFK 541
            +I LI+ FT F   KFD  +F+  YI I +F+  +  ++ I   +F+ K E+ D+ + +
Sbjct: 507 IIIILIQGFTAF-APKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIEDVDIDSDR 565

Query: 542 ---ELIDLEEEEGK-LWD 555
              E I  E+ E K  WD
Sbjct: 566 RDIEAIVWEDHEPKTFWD 583

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  328 bits (840), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/587 (33%), Positives = 315/587 (53%), Gaps = 35/587 (5%)

Query: 6   DSYRKD---LEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEAR 62
           D+ + D   +EKI  N + +S      DL    D+    S   ++G ++  +LK+ L++R
Sbjct: 61  DNEKDDAIRMEKISKNHSASSNGTIREDLIMDVDVEKSPS---VEGDNEPHKLKQGLQSR 117

Query: 63  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG 122
           HV +                       P  + I+Y  +  ++Y +M  LGEM  ++P DG
Sbjct: 118 HVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDG 177

Query: 123 FTSYAS------RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVW 176
             S  S      RY D +LGFA G++Y + Y+I+   + TAA+ V++YW +   V  GVW
Sbjct: 178 SDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT--AVPKGVW 235

Query: 177 ITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFY 236
           ITIFL ++V +N            W +S K+L ++ LI+L F++  GGGP+HDRLGFR++
Sbjct: 236 ITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYW 295

Query: 237 KDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIK 295
           + PGAF  +     GS G F       +   FA+ LG EL  + +AEC + RRN+ +A +
Sbjct: 296 QHPGAFAHH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASR 353

Query: 296 LTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHIF 354
             ++R++ FY++    + + V YNDP L+             PFV+ I+NAGI VLPHI 
Sbjct: 354 RFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHII 413

Query: 355 NACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAY 414
           N C+L   +SA N+ ++ ++RSL  +A   +APK   + N+WGVPY ++ +  L   LAY
Sbjct: 414 NGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAY 473

Query: 415 MNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGV-DKSTLAYAAPLASK 473
           +NVSS +A VFN+F N+ +I G + W+   I Y+ F +A+   G+ D+  L +       
Sbjct: 474 LNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGLFDR--LPFKTWGQPY 531

Query: 474 GAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIR--GTKFV 530
             + +L    +I L   + +F+   +   +FI  YI +P+F++ +FG+K Y R     ++
Sbjct: 532 TVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRTWSQWWL 591

Query: 531 KPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFL 577
              E D+ T   LI++EE+  ++      E+M   P +FK   +KF+
Sbjct: 592 PVSEIDVTT--GLIEIEEKSREI------EEMRLPPSSFK---DKFM 627

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/521 (35%), Positives = 291/521 (55%), Gaps = 12/521 (2%)

Query: 30  DLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXX 89
            + +Q  I SQE  +  +G+     +K+EL+ RH+ M                       
Sbjct: 35  SIPSQITIESQEEEIA-NGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAG 93

Query: 90  PVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYL 148
           PV  LIAY F+G LVY V   LGEMAT+IP+   FT ++ R+  P+ G A GY Y F + 
Sbjct: 94  PVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWA 153

Query: 149 IITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVL 208
           I    +L+    ++Q+W S   +    WI+IF V++V +N            W++S KVL
Sbjct: 154 ITFALELSVVGQIIQFWTSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVL 211

Query: 209 VMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALF 268
            ++  ++    ++ G G +   +GFR++++PG   P   A + ++ KF+ +V+  + A F
Sbjct: 212 AIMGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAF 270

Query: 269 AYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXX 328
            Y GTEL GI A E  NPR++VPRAIK  ++RI+ FY+ ++F +G+ V YNDP L     
Sbjct: 271 TYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDS 330

Query: 329 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPK 388
                   PF+++I+N+G P+LPHIFNA +L  + SA NS++YV SR ++GL+    AP+
Sbjct: 331 YVAAS---PFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPR 387

Query: 389 IFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYI 448
           I ++TNK GVP+ S+I   LF  LAYM  S+G    FN+ +N+  + G  SW+ I I+++
Sbjct: 388 ILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHV 447

Query: 449 YFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGY 508
            F +AL  +G+ +  L + A      AY+A+FF  LI +I+ FT F    FD  +F+  Y
Sbjct: 448 RFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAY 506

Query: 509 IGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKELIDLEE 548
           I   +FI  +  ++ + R     K E+ D+ T +   D+EE
Sbjct: 507 ISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRR--DIEE 545

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  324 bits (830), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/532 (35%), Positives = 301/532 (56%), Gaps = 14/532 (2%)

Query: 31  LSNQDDISSQESHLNID-GKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXX 89
           ++ QD  S +E+  + D G+     +K+EL+ RH+ M                       
Sbjct: 59  VNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAG 118

Query: 90  PVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYL 148
           PV  LIAY F+G L + V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + 
Sbjct: 119 PVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178

Query: 149 IITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVL 208
           I    +L+    V+Q+W    KV    WI+IF V+I  +N            W++S KV+
Sbjct: 179 ITFALELSVVGQVIQFWT--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVI 236

Query: 209 VMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALF 268
            ++  ++  F ++ G G +   +GFR++++PGA+ P   + + ++G+F+ +V+  + A F
Sbjct: 237 AIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAF 295

Query: 269 AYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXX 328
            + GTEL GI A E  NPR+ VPRAIK  ++RI+ FY+ ++  +G+ V YNDP L +   
Sbjct: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATS 355

Query: 329 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPK 388
                   PF+VAI+N+G  VLPHIFNA +L  + SA NS++YV SR L+GL+ +  APK
Sbjct: 356 YVSTS---PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412

Query: 389 IFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYI 448
             ++T+K GVPY ++    +F  LAYM  S+G  +VF + +N+  + G  +W+ I I++I
Sbjct: 413 FLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHI 472

Query: 449 YFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGY 508
            F +AL+ +G+ +  L + A L    AY++ FF  +I +I+ FT F   KF+  +F+  Y
Sbjct: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAF-APKFNGSSFLAAY 531

Query: 509 IGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFK---ELIDLEEEEGK-LWD 555
           I I +FI  +  ++ I   +F+ K E+ D+ + +   E I  E+ E K  WD
Sbjct: 532 ISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWD 583

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  324 bits (831), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/557 (34%), Positives = 294/557 (52%), Gaps = 26/557 (4%)

Query: 27  ENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXX 86
            NL       +   E     + ++   R+K+ L+ RH+ M                    
Sbjct: 76  SNLHQHGTTSLHDDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLS 135

Query: 87  XXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLF 145
              PV  LIAY F+G +VY V   LGEMAT+IP+    T ++ R+  PA G A GY Y F
Sbjct: 136 NAGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWF 195

Query: 146 KYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSF 205
            + I    +++    V+QYW   + V    WI IF VI+  +N            W++S 
Sbjct: 196 NWAITYAVEISVIGQVIQYWT--KAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASI 253

Query: 206 KVLVMLCLIVLLFVIMLGGGPSHDR-LGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFV 264
           KVL ++  ++   +I+ GG  SH   +GFR++++PG + P   +    + +F+ +V+  +
Sbjct: 254 KVLAIMGYLIYALIIVCGG--SHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLI 311

Query: 265 YALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLL 324
            A F Y GTEL GI A E  NPR++VPRAI   ++RI +FY++++F +G+ V +ND  L 
Sbjct: 312 NAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLA 371

Query: 325 QXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDN 384
                       PFV++I+NAG   LP IFNA VL+ + SA NS++YV SR LY LA+  
Sbjct: 372 NDSAVIASS---PFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTG 428

Query: 385 KAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAIL 444
            APKIF+   K+GVPY  +I      LLA++ V++ +   FN+ +N+ ++ GL +W+ I 
Sbjct: 429 NAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFIS 488

Query: 445 ITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNF 504
           +++I F +AL+ +G+ +  L + A L   GAY+A FF  +I  I+ F  F   KFD   F
Sbjct: 489 LSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFT-PKFDVSTF 547

Query: 505 ITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFKELIDLEEEEGKLWDAAQKEKME 563
            T YI + +  + F G +     +F+ K E+ D+ +     D  E E  +W+       E
Sbjct: 548 FTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDIDS-----DRREIEAIIWE-------E 595

Query: 564 SSPKNFKWFYEKFLGWI 580
             PKN    +EKF  W+
Sbjct: 596 DEPKN---LWEKFWAWV 609

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  322 bits (824), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/554 (33%), Positives = 291/554 (52%), Gaps = 24/554 (4%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQ--------------ESHLNIDGKH 50
             ++ KD    +S    T +D    +L   D ++ Q              E      G H
Sbjct: 4   SKAHEKDDSPTISPVGKTEQDKYGYELHPLDPVTQQVTLRTVTNVCDGLEEEDAEEAGYH 63

Query: 51  DGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTC 110
           D  R+K+ L+ RH+ M                       PV  LIAY F+G +VY +   
Sbjct: 64  D-TRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQS 122

Query: 111 LGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSRE 169
           LGEMAT+IP+    T ++ R+  PA G A GY Y F + I    +++    V+Q+W S  
Sbjct: 123 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTS-- 180

Query: 170 KVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHD 229
            V    WI IF V +  +N            W++S KV+ ++  ++   VI+ GG  S  
Sbjct: 181 AVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS-SQG 239

Query: 230 RLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRN 289
            +GFR++++PG + P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR++
Sbjct: 240 PIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 299

Query: 290 VPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPV 349
           VPRAI   ++RIV+FY++++F +GM V +NDP L             PFV++I+NAG  V
Sbjct: 300 VPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL---ASNVAVIASSPFVISIQNAGTRV 356

Query: 350 LPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILF 409
           LPHIFNA V++ + SA NS++YV SR LY L+    APK F    + GVPY  +I   L 
Sbjct: 357 LPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLL 416

Query: 410 CLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAP 469
            LLA++ V++ +   FN+ +N+ ++ GL +W+ I +++I F +AL+ +G+ +  L + A 
Sbjct: 417 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAK 476

Query: 470 LASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK 528
           L   GAY+A FF  +I  I+ F  F   KFD   F T YI + + ++   G + Y R   
Sbjct: 477 LMPWGAYYAAFFVTVIIFIQGFEAF-SPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRF 535

Query: 529 FVKPEEADLYTFKE 542
             K E+ D+ T + 
Sbjct: 536 LWKLEDIDIDTDRR 549

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/516 (35%), Positives = 286/516 (55%), Gaps = 12/516 (2%)

Query: 20  NTTSKDVENLDLSNQDDISSQESHLNIDGKHDG----IRLKKELEARHVSMXXXXXXXXX 75
           +T S D +   +S    + +   +++ID   +G      +K+ L+ RH+SM         
Sbjct: 43  DTKSTDEKTRVVSQVSPMRTGSPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGTIGT 102

Query: 76  XXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPA 134
                         PV  LIAY F+G + Y V   LGEMAT+IP+   FT +  R+  PA
Sbjct: 103 GLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPA 162

Query: 135 LGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXX 194
            G A GY Y F + I    +L+    ++Q+W     V  G WI IF VI+ T N      
Sbjct: 163 FGVANGYLYWFSWCITFALELSVVGQIIQFWTF--AVPLGAWIAIFWVILTTSNLFPVKY 220

Query: 195 XXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKG 254
                 W++  KVL ++  I+  F+++ G G +   +GFR++++PG + P   +   ++G
Sbjct: 221 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEG 279

Query: 255 KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGM 314
           +F+ +V+  + A F Y GTEL GI A E KNPRR VPRAI    +RI+ FY++++  +G+
Sbjct: 280 RFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGL 339

Query: 315 TVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVAS 374
            V +NDP L             PFV+AI+N+G  VLPHIFNA +L  + SA NS++YV S
Sbjct: 340 LVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGS 396

Query: 375 RSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSI 434
           R LYGLA +  APK+FA+  K GVPY S++    F  LAY+N+S+ + +VF++ +N+ +I
Sbjct: 397 RVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAI 456

Query: 435 FGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVF 494
            G  +W+ I + +I F + L+ + + ++ L + A     GAY++ FF  LI +I+ FT F
Sbjct: 457 AGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAF 516

Query: 495 LGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV 530
              KF+  NF   YI + +F+  +  ++    T+F+
Sbjct: 517 -APKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFI 551

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  321 bits (823), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/569 (34%), Positives = 302/569 (53%), Gaps = 37/569 (6%)

Query: 25  DVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXX 84
           D E+L   N     SQ        K +   LK+ L++RH+ +                  
Sbjct: 27  DTESLSALNTGGSESQ--------KREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSST 78

Query: 85  XXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYAS------RYCDPALGFA 138
                P  +L +Y  +  ++Y VM  LGEM  Y+P  G  S  S      RY DP+LGFA
Sbjct: 79  LSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFA 138

Query: 139 VGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXX 198
            G++Y + Y+I+   + TAA+ V+ YW +   V    WITIFL ++  +N          
Sbjct: 139 TGWNYYYCYVILIAAECTAASGVVTYWTT--VVPKAAWITIFLGVVTMLNFGPVKFYGES 196

Query: 199 XXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVS 258
             W +  K+L ++ L+ + F++  GGGPSHDRLGFR+++ PGAF  +    +G+ G+F+ 
Sbjct: 197 EFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYH--ITTGNTGRFLD 254

Query: 259 FVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVA 317
                +   FA+ LG EL  + ++E  + RRN+ +A +   YR++ FY+ +   +G+ VA
Sbjct: 255 VWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVA 314

Query: 318 YNDPLLLQXXXXXXX-XXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRS 376
            NDP+L              PFV+AI+NA I +LPHI NAC+L   +S+ NS ++ ASRS
Sbjct: 315 QNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRS 374

Query: 377 LYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFG 436
           L  +A D  APK+F K N+ GVPYN++ +   F  LAY+NVSSGSA+ F +F N+ +I G
Sbjct: 375 LLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISG 434

Query: 437 LMSWIAILITYIYFDRALRAQGV-DKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL 495
            + WI I + Y+ F +A+  +G+ D+  + + +P    G YF +    +I L   +  F+
Sbjct: 435 FIGWICIGVAYLRFRKAIFFRGLYDR--VPFKSPFQPYGTYFFIIVVSIICLTNGYATFI 492

Query: 496 GHKFDYKNFITGYIGIPVFIICFFGYK-YIR--GTKFVKPEEADLYTFKELIDLEEEEGK 552
              +   +F+  YI +PVF++ + G+K Y R   T  +   E D+ T   L ++EE   +
Sbjct: 493 PRFWKGADFVAAYITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDVTT--GLAEIEELTKE 550

Query: 553 LWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           L DA +       P N  W  EKF+ W+ 
Sbjct: 551 L-DALR------VPPNSAW--EKFMDWLL 570

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 202/610 (33%), Positives = 317/610 (51%), Gaps = 48/610 (7%)

Query: 5   QDSYRKDLEKIVSNSNTTSK--DVE----NLDLSNQDDISSQESHLN------IDGKHDG 52
           Q +Y  +LE I S+ N   +  D+E    NLD S  D  + ++S LN       D   + 
Sbjct: 7   QVTYNYELEDIPSSKNELKELGDMEAQQMNLDDSLDDRFNKKDSGLNKVLTVSSDTSTNS 66

Query: 53  IR------LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYI 106
           +       LK+ L++RHV +                       P  + IAY  +  ++Y 
Sbjct: 67  LEEDYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYP 126

Query: 107 VMTCLGEMATYIPLDGFTSYAS------RYCDPALGFAVGYSYLFKYLIITPNQLTAAAL 160
           +M  +GEM  Y+P DG  S  S      RY D +L FA G++Y + Y+I+   + TAAA 
Sbjct: 127 IMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAG 186

Query: 161 VLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVI 220
           V++YW     V    WITIFL II  +N            W +S K+L ++ LI+L F++
Sbjct: 187 VVEYWT--LAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFIL 244

Query: 221 MLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIV 279
             GGGPSHDRLGFR++K+PGAF  +     GS G F+   +  +   FA+ LG EL  + 
Sbjct: 245 FWGGGPSHDRLGFRYWKNPGAFAHH--VTDGSLGNFLDIYSGIIKGAFAFILGPELVALT 302

Query: 280 AAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPF 338
           ++EC + RRN+ +A K  +YR++ FY++    +G+ VA+NDP+L              PF
Sbjct: 303 SSECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPF 362

Query: 339 VVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGV 398
           V+ I+NAGI VLPHI NAC+L   +S+ N+ ++ +SRSL+ +A +  APKIF + NK+GV
Sbjct: 363 VIGIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGV 422

Query: 399 PYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQG 458
           PY ++IL  L   LAY+N SS +A+VF +  N+ +I G + WI   I Y+ F +A     
Sbjct: 423 PYMAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKA----- 477

Query: 459 VDKSTLAYAAPLASKGA----YFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVF 514
           +  + L    P  + G      ++L    +I +   +  F+   ++  +FI  YI +P+F
Sbjct: 478 IFYNNLYDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIF 537

Query: 515 IICFFGYKYIRGTKFVKPEEADLYTFKE---LIDLEEEEGKLWDAAQKEKMESSPKNFKW 571
           +  + G+K     K   P     Y+ ++   +  L+E E K  +  +   +   P N +W
Sbjct: 538 LALYVGHKVYNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRIL---PTN-RW 593

Query: 572 FYEKFLGWIF 581
             E+F+ W+ 
Sbjct: 594 --ERFIDWLL 601

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  321 bits (822), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/531 (35%), Positives = 294/531 (55%), Gaps = 15/531 (2%)

Query: 33  NQDDISSQESHL--NIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXP 90
           N +D  S E  +    +G+     +K+EL+ RH+ M                       P
Sbjct: 60  NGEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGP 119

Query: 91  VSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLI 149
           V  LI+Y F+G L Y V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I
Sbjct: 120 VGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAI 179

Query: 150 ITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLV 209
               +L+    V+Q+W    KV    WI+IF VII  +N            W++S KVL 
Sbjct: 180 TFALELSVVGQVIQFWTY--KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLA 237

Query: 210 MLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFA 269
           ++  ++  F ++ G G +   +GFR++++PGA+ P   +   ++G+F+ +V+  + A F 
Sbjct: 238 IIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFT 296

Query: 270 YLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXX 329
           + GTEL GI A E  NPR++VPRAIK  ++RI+ FY+ ++  +G+ V YNDP L Q    
Sbjct: 297 FQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY 356

Query: 330 XXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKI 389
                  PF++AI+N+G  VLPHIFNA +L  + SA NS++YV SR L+GL+ +  APK 
Sbjct: 357 VSTS---PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKF 413

Query: 390 FAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIY 449
            ++T K GVPY ++ +   F  LAYM  S+G  +VF + +N+  + G  +W+ I I++I 
Sbjct: 414 LSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIR 473

Query: 450 FDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYI 509
           F +AL+ +G+ +  L + A L    AY+A  F  +I +I+ FT F   KF+  +F   YI
Sbjct: 474 FMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYI 532

Query: 510 GIPVFIICFFGYKYIRGTKFV-KPEEADLYTFK---ELIDLEEEEGK-LWD 555
            I +F+  +  ++ I   +F+ K  + D+ + +   E I  E+ E K  WD
Sbjct: 533 SIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWD 583

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  320 bits (819), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/569 (33%), Positives = 308/569 (54%), Gaps = 31/569 (5%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQ-----------DDISSQESHLNIDGKHDGI 53
           + S  +D++ I+  +++ S +    +L  +           +D+++++  L     HD  
Sbjct: 10  EKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELL--EHHD-- 65

Query: 54  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGE 113
            +K+ L+ RH+ M                       PV  L+AY F+G +V+ V   LGE
Sbjct: 66  -VKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGE 124

Query: 114 MATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172
           MAT+IP+   F+ +A R+  PALG A GY Y   +      +L+    ++Q+W    KV 
Sbjct: 125 MATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF--KVP 182

Query: 173 PGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232
              WI+IF V++   N            W++S KVL ++  ++    I+ G G +   +G
Sbjct: 183 LAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IG 241

Query: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
           FR++++PGA  P   + +  + +F+ +V+  + A F Y GTEL GI A E  NPR+ VPR
Sbjct: 242 FRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 301

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           AI+  L RI++FY+ ++F +G+TV YNDP L             PF++ I+NAG  VLPH
Sbjct: 302 AIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSS---PFIITIQNAGTRVLPH 358

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           IFNA +L  + SA NS++YV SR L+ +A +  APK  AKT   GVPY S++    F  L
Sbjct: 359 IFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSL 418

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           +YM +S+G A+ FN+ +N+  + G  +W+ I  +++ F +AL+ +G+ +  L Y A    
Sbjct: 419 SYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMP 478

Query: 473 KGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGY--KYIRGTKFV 530
             AY+A+FF  +I LI+ FT F  H F  ++F+  YI + +F++ F+G+   Y R     
Sbjct: 479 WLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLV-FWGFFQIYFRCRIIW 536

Query: 531 KPEEADLYTFKELID---LEEEEGK-LWD 555
           K E+ D+ T +  I+    E++  K LWD
Sbjct: 537 KLEDVDIDTDRREIESVVWEDDAPKTLWD 565

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/578 (32%), Positives = 313/578 (54%), Gaps = 26/578 (4%)

Query: 7   SYRKDLEKIVSNSN---TTSKDVENLDLSN---QDDISSQESHLNIDGKHDGIRLKKELE 60
           S R+  ++  +N N     +  V  +DL +   +   +++  + N D K +G +L++ L 
Sbjct: 3   SRREKEKETTTNGNLFDQKTGQVLEIDLESLTPEGSSTNRGINGNKDAKLEG-KLQQGLS 61

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
           ARH+ +                       P  + I+Y  +  ++Y +M   GEM  Y+P 
Sbjct: 62  ARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEMVCYLPG 121

Query: 121 DGFTSYAS------RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174
           +G  S  S      RY DP+L FA G++Y + Y+I+   + TAA+ V++YW   + V   
Sbjct: 122 NGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYWT--DAVPTA 179

Query: 175 VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFR 234
            WITIFL I+V +N            W +S KVL ++ LI+L F++  GGGP+HDRLGFR
Sbjct: 180 AWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNHDRLGFR 239

Query: 235 FYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRA 293
           ++K+PG F  +     G+ G F+   +  +   FA+ LG EL  + ++ECK+ RRN+ +A
Sbjct: 240 YWKNPGGFAHH--ITGGNLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQRRNIMKA 297

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPH 352
            K  ++R++ FY++    + + VA NDP L              PFV+ I+NAGI +LPH
Sbjct: 298 SKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGIKILPH 357

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           I NAC+L   +SA N+ ++ +SRSL  +A + +APKIF K N++GVP+ ++    L   L
Sbjct: 358 IINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSALISCL 417

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           AY+NVSS +A VF +F N+ +I G + W   L+ Y+ F +A++  G++ + L YA     
Sbjct: 418 AYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGLE-NRLPYAPRFQQ 476

Query: 473 KGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK--F 529
              ++++    L+     + VF+   ++  +FI  YI +P+F++ + G+K Y R  K  +
Sbjct: 477 YMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTRDFKKWW 536

Query: 530 VKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPK 567
              EE D+ T   L ++EE   ++ D  + E   + PK
Sbjct: 537 YPVEEIDVVT--GLTEIEERT-RILDEERVEPKGAFPK 571

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  319 bits (817), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/518 (34%), Positives = 289/518 (55%), Gaps = 18/518 (3%)

Query: 33  NQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVS 92
           NQ+++S  ES       +D   +K++L+ RH+SM                       PV 
Sbjct: 44  NQENMSEVESLYG----NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVG 99

Query: 93  ILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIIT 151
            L+AY F+G + + V   LGEMAT+IP+   FT Y  R+  PALG A GY Y F + +  
Sbjct: 100 SLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTF 159

Query: 152 PNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVML 211
             +L+    ++QYW     V   VWI +F +++   N            W+++ KVL + 
Sbjct: 160 ALELSIIGQLIQYWTF--AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIF 217

Query: 212 CLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGS---KGKFVSFVAVFVYALF 268
             ++   V M+ GG S   LGFR++K+PG   P+   +  S   + +F+ +V+  + A F
Sbjct: 218 GFLIYALV-MVCGGSSEGALGFRYWKNPG---PWGMGMISSNKYEARFLGWVSSLIKAAF 273

Query: 269 AYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXX 328
            Y GTEL GI A E KNPR+ VP+AI    +RI+ FY++++F +G+ V Y DP L     
Sbjct: 274 TYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL--STT 331

Query: 329 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPK 388
                   PFV+AI+N+G  VLP +FN  +L+ + SA NS++Y+ SR LYGL+    AP 
Sbjct: 332 SDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPS 391

Query: 389 IFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYI 448
           +F KTNK GVP+ +++   +F  LAY+N+S  + +VF++ + + ++ G  +W+ I +++I
Sbjct: 392 LFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHI 451

Query: 449 YFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGY 508
            F + L+ +G+ ++ L + A     GAY+A FF  +I LI+ F  F   +F +  FI  Y
Sbjct: 452 RFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADY 510

Query: 509 IGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFKELID 545
           I + +FI+C+ G++ +  T+ + + E+ D+ T +  ID
Sbjct: 511 ISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREID 548

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  319 bits (817), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/561 (33%), Positives = 303/561 (54%), Gaps = 21/561 (3%)

Query: 9   RKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNI--------DGKHDGIRLKKELE 60
           +KD+     N     KD ++   ++ +  +S  S   I        + +    ++K+ L+
Sbjct: 48  KKDMTVTYDNEILEKKDSKSDIFTSVNRYASHPSEARISSDEYDHQEAEFKDTKVKRALK 107

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
            RH+ M                       PV  LIAY F+G +VY V   LGEMAT+IP+
Sbjct: 108 PRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMATFIPV 167

Query: 121 -DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITI 179
               T ++SR+  PA G + GY Y F + I    +++    V+++W +  KV    WI+I
Sbjct: 168 TSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTT--KVPLAAWISI 225

Query: 180 FLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDP 239
           F V++  +N            W++S KVL ++  ++   VI+ GG      +GFR+++  
Sbjct: 226 FWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQGPIGFRYWRHG 284

Query: 240 GAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLY 299
            A      +   ++ +F+ +VA  + A F Y GTEL GI A E  NPR++VPRAI   ++
Sbjct: 285 YAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVF 344

Query: 300 RIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVL 359
           RIV+FY++++F +G+ V YNDP L             PFV++I+NAG   LPHIFNA ++
Sbjct: 345 RIVIFYILSLFFIGLLVPYNDPKL---NSATSYIASSPFVISIENAGTRALPHIFNAIIM 401

Query: 360 MFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSS 419
           + + SA NS++YV+SR LY LA+   APKIFA+    GVP+  +I+  L  LLA++ V++
Sbjct: 402 ITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVNN 461

Query: 420 GSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFAL 479
            + + FN+ +N+ ++ GL +W+ I ++++ F  AL+ +G+ +  L + A     G+Y+A 
Sbjct: 462 NANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYAC 521

Query: 480 FFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLY 538
           FF  +I  I+ FT F   KFD  +F T YI + +  + F G + Y R   F K E+ D+ 
Sbjct: 522 FFITVIIFIQGFTAF-SPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDID 580

Query: 539 TFKELID---LEEEEGKL-WD 555
           T +  ID    E++E K  WD
Sbjct: 581 TDRREIDEIVWEDDEPKTAWD 601

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/578 (33%), Positives = 307/578 (53%), Gaps = 30/578 (5%)

Query: 9   RKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXX 68
           + +LEK     +T+  DV++   +    ++  ES L    K D   L+K L +RH+ +  
Sbjct: 6   KANLEK-----DTSFYDVKSQGETYSGTLNQLESQLE-GTKCDENNLEKGLSSRHIQLIA 59

Query: 69  XXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYA 127
                                P+ + +++  + F+VY VM  L EM  Y+P  G      
Sbjct: 60  LGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELT 119

Query: 128 SRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTI 187
           SRY DP+LGFA G++Y + Y I+   +L+AAA V+QYW   +KV+  VWITIFLVI+V +
Sbjct: 120 SRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWT--DKVHVAVWITIFLVIVVGL 177

Query: 188 NXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSE 247
           N            W +S K++ +L L+++  VI  GG PSHDRLGFR++ +PG   P++ 
Sbjct: 178 NFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPG---PFAY 234

Query: 248 AISG-SKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFY 305
            I+G + G+F+      + + FA+ L  EL G+   E K+ RRN+ +A +  ++RI+ FY
Sbjct: 235 HITGGNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFY 294

Query: 306 LVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFS 364
           + +   +G  ++ +DP L+Q            PFV  I NAGIPVL HI NA +L   +S
Sbjct: 295 ITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWS 354

Query: 365 ACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQV 424
           + NS +Y +SRS+  LA    APK+F + N+ GVPYN++ L      L Y+N SS SAQV
Sbjct: 355 SANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQV 414

Query: 425 FNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCL 484
           F +  N+ +I G + W  I ITY+ F +A+    + +  + + + L     YF + F  L
Sbjct: 415 FTWLSNICTISGFIGWALIGITYLRFRKAIFYNNLYER-VPFKSALQPYFTYFFVVFVVL 473

Query: 485 IALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKP-EEADLYTFKEL 543
           + L   +  F+   ++  +F+  YI +P+F + + G+K    T++  P  E D+ T   L
Sbjct: 474 LCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVIT--GL 531

Query: 544 IDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
            D EEE         K     +PKN    +EKF+ W+ 
Sbjct: 532 ADAEEE--------AKMTQPRTPKN---MWEKFMYWLL 558

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  318 bits (816), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/565 (34%), Positives = 301/565 (53%), Gaps = 32/565 (5%)

Query: 16  VSNSNTTSKDVENLDL-SNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXX 74
           +++ N+ +  +  L + S++ DI+  E   + + KH    +K+ L+ RH+ M        
Sbjct: 70  IADVNSITNSLTRLQVVSHETDINEDEEEAHYEDKH----VKRALKQRHIGMIALGGTIG 125

Query: 75  XXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDP 133
                          PV  LIAY F+G +VY V   LGEMAT+IP+    T ++ R+  P
Sbjct: 126 TGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSP 185

Query: 134 ALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXX 193
           A G + GY Y F + I    +++    V++YW   +KV    WI IF VII  +N     
Sbjct: 186 AFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWT--DKVPLAAWIAIFWVIITLMNFFPVK 243

Query: 194 XXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-LGFRFYKDPGAFRPYSEAISGS 252
                  W++S KVL ++  ++   +I+ GG  SH   +GFR++++PGA+ P   +   S
Sbjct: 244 VYGEFEFWVASVKVLAIMGYLIYALIIVCGG--SHQGPIGFRYWRNPGAWGPGIISSDKS 301

Query: 253 KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLL 312
           +G+F+ +V+  + A F Y GTEL GI A E  NPR+ VPRAI   ++RIV+FY++++F +
Sbjct: 302 EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFI 361

Query: 313 GMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYV 372
           G+ V YND  L             PFV++I+NAG   LP IFNA VL+ V SA NS++YV
Sbjct: 362 GLLVPYNDSRLSASSAVIASS---PFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYV 418

Query: 373 ASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVV 432
            SR LY LA    APK F    + GVPY  ++      LLA++ V++ +   FN+ +N+ 
Sbjct: 419 GSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINIS 478

Query: 433 SIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFT 492
           ++ GL +W+ I + +I F +AL+ +G+ +  L + A L   GAY+A FF  +I  I+ F 
Sbjct: 479 TLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQ 538

Query: 493 VFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFKELIDLEEEEG 551
            F    F    F T YI + +  + F G +     +F+ K E+ D+ +     D  E E 
Sbjct: 539 AFC--PFKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDIDIDS-----DRREIEA 591

Query: 552 KLWDAAQKEKMESSPKNFKWFYEKF 576
            +W+       +  PKN    +EKF
Sbjct: 592 IIWE-------DDEPKN---LWEKF 606

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/590 (32%), Positives = 311/590 (52%), Gaps = 29/590 (4%)

Query: 7   SYRKDLEKIVSNSNTTSKDVENLDLSN--QDDISSQESHLNIDGKHDGIRLKKELEARHV 64
           SY K+ E+  +  +     +  LDL +  ++ I+  +S   ++ + +G +LK+ L +RHV
Sbjct: 9   SYSKEEEEKKTVFDNRQILINELDLESLTREKITRSDSSSEVEAEGNG-KLKQGLSSRHV 67

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFT 124
                                    P  ++I+Y  +  ++Y +M  LGEM  Y+P +G  
Sbjct: 68  QFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGED 127

Query: 125 SYAS------RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
           S  S      RY D +L FA G++Y + ++I+   + TAA+ V+ YW +   V   VWIT
Sbjct: 128 SAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTT--SVPTAVWIT 185

Query: 179 IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           IFL I+  +N            W +S K+L +L LI++ F++  GGGPSH RLGF ++KD
Sbjct: 186 IFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKD 245

Query: 239 PGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLT 297
           PG F  +     GS G F+      +   FA+ LG EL  + ++EC + RRN+ +A K  
Sbjct: 246 PGTFAHH--ITGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRF 303

Query: 298 LYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXX-XXXXPFVVAIKNAGIPVLPHIFNA 356
           ++R++ FY++    + + VAYNDP+LL             PFV+ I+NAGI VLPHI NA
Sbjct: 304 IWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINA 363

Query: 357 CVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMN 416
           C+L   +SA NS ++ +SRSL  +A +  APKIF K N++GVPY S+ L  +   LA++N
Sbjct: 364 CILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLN 423

Query: 417 VSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGV-DKSTLAYAAPLASKGA 475
           VSS +AQVF++F N+ +I G + WI  +I Y+ F +A+    + D+       P  + G 
Sbjct: 424 VSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNMYDR------LPFKTFGQ 477

Query: 476 ----YFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVK 531
               +++L    +I L   +  F+   +   +F+  YI +P+F+I + G+K+    K   
Sbjct: 478 PYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYKHAV 537

Query: 532 PEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           P     Y   E ID+     +  + A+K  M   P +  W   KF+ W+ 
Sbjct: 538 PLLKLYYPVDE-IDVITGLAEAEEVAEKLDMNRIPPSTYW--GKFINWLL 584

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/539 (34%), Positives = 288/539 (53%), Gaps = 23/539 (4%)

Query: 25  DVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXX 84
           DV+   LS     SS E H        G  LK+ L++RHV +                  
Sbjct: 50  DVDVFSLS-----SSTEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSST 104

Query: 85  XXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP-----LDGFTSY-ASRYCDPALGFA 138
                P  + I+Y  +  ++Y +M  +GEM  Y+P      +GF +Y   +Y D +LGFA
Sbjct: 105 LHTCGPAGLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFA 164

Query: 139 VGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXX 198
             ++Y + Y+I+   + TAA+ V++YW +   V    WITIFL  +V +N          
Sbjct: 165 DAWNYYYCYVILVAAECTAASGVVEYWTT--SVPKAAWITIFLAAVVILNFTAVKFYGES 222

Query: 199 XXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVS 258
             W +S K+L ++ LI+L F++  GGGP+HDRLGFR++++PG F  +     GS G F+ 
Sbjct: 223 EFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRG--GSFGSFLD 280

Query: 259 FVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVA 317
                +   FA+ LG E+  + ++E ++ RRN+ +A +  ++R++ FY++    + + VA
Sbjct: 281 IYTGIIKGGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVA 340

Query: 318 YNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRS 376
           YNDP L              PFV+ I+NAGI VLPHI NAC+L   +SA N+ ++ +SRS
Sbjct: 341 YNDPALENALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRS 400

Query: 377 LYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFG 436
           L  +A + +AP+IFAK N+WGVPY ++ L      LAY+N SS +A VFN+F N+  I G
Sbjct: 401 LLTMAQNGQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISG 460

Query: 437 LMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG 496
            + WI + I YI F +A+   G+ +S L Y A       Y+ L    +I L   + VF+ 
Sbjct: 461 FIGWICVCIAYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIP 519

Query: 497 HKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-----KPEEADLYTFKELIDLEEEE 550
             +D KNF+  YI +PVF + + G++  R   F        EE D+ T  E I+ +  E
Sbjct: 520 RFWDAKNFVAAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVTGVEEIEEKTRE 578

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/575 (33%), Positives = 300/575 (52%), Gaps = 35/575 (6%)

Query: 8   YRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMX 67
           +   L   VS ++ +S    +LDLS+ ++           G     R+K+ L+ RH+ M 
Sbjct: 57  FSDQLSYNVSVADNSSAANGDLDLSDTEEA----------GHVQDTRVKRALKQRHIGMI 106

Query: 68  XXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSY 126
                                 PV  LIAY F+G ++Y +   LGEMAT+IP+    T +
Sbjct: 107 ALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEMATFIPVTSSITVF 166

Query: 127 ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVT 186
           + R+  PA G   GY Y F + I    +++    V+QYW   + V    WI IF V +  
Sbjct: 167 SKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWT--DAVPLAAWIAIFWVFVTL 224

Query: 187 INXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS 246
           +N            W++S KVL ++  ++   VI+ GG  S   +GFR++++PG + P  
Sbjct: 225 LNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS-SQGPIGFRYWRNPGPWGPGI 283

Query: 247 EAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYL 306
            +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR++VPRAI   ++RI +FY+
Sbjct: 284 ISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYI 343

Query: 307 VTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366
           +++F +G+ V YND  L             PFV++I+NAG   LP IFNA V++ + SA 
Sbjct: 344 MSLFFIGLLVPYNDHTL---SSGDSYIASSPFVISIQNAGTYALPDIFNAVVMLTIISAA 400

Query: 367 NSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFN 426
           NS++YV SR LY LA    APK FA   K GVP+  +I+     LLA++ V++ +   FN
Sbjct: 401 NSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLVVNNNANTAFN 460

Query: 427 YFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIA 486
           + +N+ ++ GL +W  I +++I F +AL+ +G+ +  L + A L   GAY++ FF  +I 
Sbjct: 461 WLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYSAFFVFVII 520

Query: 487 LIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKELID 545
            I+ F  F    +D   F T YI + + ++ F G + Y R    +K E+ D+ T     D
Sbjct: 521 FIQGFEAFT--PWDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVEDIDIDT-----D 573

Query: 546 LEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWI 580
             E E  +W+       +  PKN    +EKF  W+
Sbjct: 574 RREIEAIIWE-------DDEPKN---LWEKFWAWV 598

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  315 bits (808), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/553 (32%), Positives = 295/553 (53%), Gaps = 15/553 (2%)

Query: 9   RKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXX 68
           R+   K    +N +   +E++   + D+   +      +G +    +K+ L+ARH+SM  
Sbjct: 17  RERYSKKAKGNNGSEIALESITPDSGDEFPEEHEQ---EGDYHETEVKRALKARHISMIA 73

Query: 69  XXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYA 127
                                PV  LIAY F+G +VY +   LGEMAT+IP+    T ++
Sbjct: 74  LGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMATFIPVTSSVTVFS 133

Query: 128 SRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTI 187
            R+  PA G A GY Y F + I    +L+    ++ YW S   V  G WITIF +I+  +
Sbjct: 134 KRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTS--VVPLGAWITIFWIIVTLL 191

Query: 188 NXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSE 247
           N            W++S KV+ ++  ++  F+++ GG  S   +GFR +++PG +     
Sbjct: 192 NFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS-SQGPIGFRNWRNPGPWGTGVI 250

Query: 248 AISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLV 307
           + + ++ +F+ +V+  + A F Y GTEL GI A E KNPR+ VP+AI    +RI+ FY++
Sbjct: 251 SSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYIL 310

Query: 308 TIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACN 367
           ++F +G+ V YNDP +             PFV++I+NAG  +LP IFNA VL+ V SA N
Sbjct: 311 SLFFVGLLVPYNDPRM--DNTSDTDVNASPFVISIRNAGTKILPDIFNAVVLVTVVSAAN 368

Query: 368 SDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNY 427
           S++Y+ SR +Y LA    APK F   N+ GVP   +++  L  L+A++ V++ +   FN+
Sbjct: 369 SNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNW 428

Query: 428 FVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIAL 487
            VN+ ++ GL +W+ I + +I F + L+ +G+ +  L + A      AY+A  F  +I  
Sbjct: 429 LVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIF 488

Query: 488 IKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFKELIDL 546
           I+ +T F   KFD   F T YI + + ++ F G +     +F+ K E+ D+ T +  ID 
Sbjct: 489 IQGYTAF-SPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDTNRREIDA 547

Query: 547 ----EEEEGKLWD 555
               ++E   LWD
Sbjct: 548 IVWEDDEPKNLWD 560

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  318 bits (816), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 189/578 (32%), Positives = 304/578 (52%), Gaps = 36/578 (6%)

Query: 12  LEKIVSNSNTTSKDV--ENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXX 69
           +EKI  N + +S     E LDL         E   + DG     RLK+ L++RHV +   
Sbjct: 126 MEKISKNQSASSNGTVREELDL---------EKSPSADGDAGPHRLKQGLQSRHVQLIAL 176

Query: 70  XXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYAS- 128
                               P  + I+Y  +  ++Y +M  LGEM  ++P DG  S  S 
Sbjct: 177 GGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSS 236

Query: 129 -----RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183
                RY D +LGFA G++Y + Y+I+   + TAA+ V++YW +   V  GVWITIFL +
Sbjct: 237 ANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTT--AVPKGVWITIFLCV 294

Query: 184 IVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243
           +V +N            W +S K+L ++ LI+L F++  GGGP HDRLGFR+++ PG+F 
Sbjct: 295 VVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGSFA 354

Query: 244 PYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302
            +     GS G F       +   FA+ LG EL  + +AEC + RRN+ +A +  ++R++
Sbjct: 355 HHLAG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLI 412

Query: 303 VFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
            FY++    + + V YNDP L+             P+V+ I+NAGI VLPHI N C+L  
Sbjct: 413 FFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCILTS 472

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
            +SA N+ ++ ++RSL  +A   +APK   K N++GVPY ++ +  L   LAY+NVSS +
Sbjct: 473 AWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVSSST 532

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGV-DKSTLAYAAPLASKGAYFALF 480
           A VFN+F N+ +I G + WI   I Y+ F +A+   G+ D+  L +         +F+L 
Sbjct: 533 ADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGLYDR--LPFKTWGQPYTVWFSLT 590

Query: 481 FCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYT 539
              +I +   + +F+   ++  +FI  YI +P+F++ + G+K Y R         +++  
Sbjct: 591 VVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWNHWWHSVSEIDV 650

Query: 540 FKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFL 577
              L+++EE+   +      E++   P  FK   EKF+
Sbjct: 651 TTGLVEIEEKSRDI------EELRLPPATFK---EKFM 679

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  315 bits (807), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 186/531 (35%), Positives = 288/531 (54%), Gaps = 16/531 (3%)

Query: 32  SNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPV 91
           S  DD +  +    ++ +    ++K+ L+ RH+ M                       PV
Sbjct: 69  SRVDDGAESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPV 128

Query: 92  SILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLII 150
             LIAY F+G ++Y V   LGEMAT+IP+    T ++ R+  PA G A GY Y F + I 
Sbjct: 129 GSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAIT 188

Query: 151 TPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVM 210
              +++    V+QYW   + V    WI IF V++  +N            W++  KVL +
Sbjct: 189 YAVEISVIGQVIQYWT--KAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAI 246

Query: 211 LCLIVLLFVIMLGGGPSHDR-LGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFA 269
           +  ++   VI+ GG  SH   +GFR+++ PGAF P   + + + GKF+ +VA  + A F 
Sbjct: 247 VGYLIYALVIVCGG--SHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFT 304

Query: 270 YLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXX 329
           Y GTEL GI A E  NPR+ VPRAI   ++RIV+FY++++F +GM + YND  L      
Sbjct: 305 YQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL---SAQ 361

Query: 330 XXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKI 389
                  PFV++IKNA   VLP IFNA V++ V SA NS++YV SR LY LA+   APK 
Sbjct: 362 DAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQ 421

Query: 390 FAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIY 449
           F+   ++GVPY  ++      LLA++ V++ +   FN+ +N+ ++ GL +W+ I + +I 
Sbjct: 422 FSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIR 481

Query: 450 FDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYI 509
           F +AL+ +G+ +  L + A L   GAY+A FF  +I  I+ +  F    +D   F T YI
Sbjct: 482 FMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFC--PWDVSTFFTSYI 539

Query: 510 GIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKELID---LEEEEGK-LWD 555
            + +  +   G + Y RG   +K E+ D+ T +  I+    E++E K LWD
Sbjct: 540 SLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPKTLWD 590

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  314 bits (805), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 190/539 (35%), Positives = 284/539 (52%), Gaps = 25/539 (4%)

Query: 40  QESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSF 99
            ES L   GK    ++K+ L+ RH+ M                       PV  LIAY F
Sbjct: 87  DESGLPAKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIF 146

Query: 100 VGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAA 158
           +G +VY V   LGEMAT+IP+    T +  R+  PALG + GY Y F + I    +L+  
Sbjct: 147 MGSVVYFVTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVT 206

Query: 159 ALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLF 218
             ++QYW    KV    WI IF VI+  +N            W+SS KVL ++  ++   
Sbjct: 207 GQIIQYWT--YKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYAL 264

Query: 219 VIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGI 278
           VI+ GG      +GFR+++   AF     + +  + +F+ +V+  + A F Y GTEL GI
Sbjct: 265 VIVCGGS-RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGI 323

Query: 279 VAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPF 338
            A E  NPR+ VPRAI   ++RI +FY++++F +G+ V YND  L             PF
Sbjct: 324 SAGEAANPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASS---PF 380

Query: 339 VVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGV 398
           V+++ NAG   LP IFNA +L+ V SA NSD+Y+ASR LY LA    APK F   N++GV
Sbjct: 381 VISMLNAGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGV 440

Query: 399 PYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQG 458
           PY  + +  L   LA++ VS+ +   FN+ +N+ ++ GL +W  I   +I F +AL+ +G
Sbjct: 441 PYLGVFVTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKG 500

Query: 459 VDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICF 518
           + +  L + A     GAY+A FF  LI  I+ +  F    +D K+F T YI + +F + +
Sbjct: 501 ISRDDLPFKARFMPWGAYYAAFFVGLIIFIQGYDAFT--PWDTKSFFTSYISLILFGVLY 558

Query: 519 FG-YKYIRGTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKF 576
            G   Y RG   +K E+ D+ T     D +E E  +W+       E +P+N   ++EKF
Sbjct: 559 LGCLIYYRGRLLIKIEDIDIDT-----DRKEVEAYVWE-------EDAPRN---WWEKF 602

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  313 bits (802), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 181/512 (35%), Positives = 284/512 (55%), Gaps = 14/512 (2%)

Query: 50  HDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMT 109
           HD  ++K+ L+ RH+ M                       PV  LIAY F+G ++Y +  
Sbjct: 89  HD-TQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQ 147

Query: 110 CLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSR 168
            LGEMAT+IP+    T ++ R+  PA G A GY Y F + I    +++    V++YW   
Sbjct: 148 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWT-- 205

Query: 169 EKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSH 228
           +KV    WI IF V+I  +N            W++  KVL ++  ++   +I+ GG  S 
Sbjct: 206 DKVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQ 264

Query: 229 DRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRR 288
             +GFR++++PG + P   +   + G+F+ +V+  + A F Y GTEL GI A E  NPR+
Sbjct: 265 GPIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 324

Query: 289 NVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIP 348
            VPRAI   ++RI +FY++++F +GM V YND  L             PFV++I+NAG  
Sbjct: 325 TVPRAINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASS---PFVISIQNAGTK 381

Query: 349 VLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCIL 408
           VLP IFNA V++ + SA NS++YV SR LY LA+   APK FA   ++GVPY  +I+   
Sbjct: 382 VLPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSA 441

Query: 409 FCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAA 468
             LLA++ V++ +   FN+ +N+ ++ GL +W+ I I++I F +AL+ +G+ +  L + A
Sbjct: 442 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKA 501

Query: 469 PLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGT 527
            L   GAY+A FF  +I  I+ F  F  H +D   F T YI + +  + F G + + R  
Sbjct: 502 KLMPFGAYYATFFVTVIIFIQGFQAFSPH-WDTTAFFTSYISLIILAVLFIGCQIFYRCR 560

Query: 528 KFVKPEEADLYTFKELID---LEEEEGK-LWD 555
            F + E+ D+ + +  I+    E++E K LWD
Sbjct: 561 FFWRVEDIDIDSDRREIEAVIWEDDEPKTLWD 592

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  311 bits (798), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 193/584 (33%), Positives = 308/584 (52%), Gaps = 25/584 (4%)

Query: 1   MSFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELE 60
           MS +QD  +   E  V++  T    V  +D+ +   IS  +   + D       LKK L+
Sbjct: 1   MSGLQD-LKDAGETTVTDKQT--GQVYEIDIESYSQISGPKVSSS-DAPQGDHTLKKGLK 56

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
           +RH+ +                       P  +  +Y  +  ++Y VM  LGEM  Y+P 
Sbjct: 57  SRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPG 116

Query: 121 DGFTSY------ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174
           DG +S        +RY DP+LGFA G++Y + Y+I+   + TAA+ V+QYW +   V  G
Sbjct: 117 DGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTT--AVPKG 174

Query: 175 VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFR 234
            WITIFL ++V +N            W +S K+L +L L+ + F++  GGGP HDRLGFR
Sbjct: 175 AWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFR 234

Query: 235 FYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRA 293
           +++ PGAF  +    SG+ G+F+      +   FA+ LG EL  + +AE ++ RRN+ +A
Sbjct: 235 YWQKPGAFAYH--ITSGNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKA 292

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLL-LQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
            +  +YR++ FY+ +   +G  VAYND  L              PFV+ I+NAGI VLPH
Sbjct: 293 SRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPH 352

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           I N C+L   +S+ NS ++ ASRSL  ++ +  APKI  + N++GVPY ++ L  L   +
Sbjct: 353 IINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCI 412

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           AY+NVSS +A VF +F N+ +I G + WI I I Y+ F +A+  Q + +  + +  P   
Sbjct: 413 AYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNLYER-VPFKTPFQP 471

Query: 473 KGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKF-- 529
            G +F +    +I L   + +F+   ++  +FI  Y+ +P+F++ + G+K + R  K   
Sbjct: 472 YGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWA 531

Query: 530 VKPEEADLYT-FKELIDLEEEEGKLWDAAQKEKMESSPKNFKWF 572
           +   E D+ T  KE+    EEE K  D  +     +  K  +W 
Sbjct: 532 IPVPEIDVTTGLKEI----EEESKECDEKRIVPTTAGGKFMEWL 571

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  311 bits (798), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 186/513 (36%), Positives = 279/513 (54%), Gaps = 16/513 (3%)

Query: 50  HDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMT 109
           HD  R+K+ L+ RH+ M                       PV  LIAY F+G ++Y V  
Sbjct: 87  HD-TRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 110 CLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSR 168
            LGEMAT+IP+    T ++ R+  PA G A GY Y F + I    +++    V+QYW   
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTF- 204

Query: 169 EKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSH 228
            KV    WI IF V+I  +N            W++S KV+ ++  ++   +I+ GG  SH
Sbjct: 205 -KVPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGG--SH 261

Query: 229 DR-LGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPR 287
              +GFR++++PGA      +    + +F+ +V+  + A F Y GTEL GI A E  NPR
Sbjct: 262 QGPIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 321

Query: 288 RNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGI 347
           ++VPRAI   ++RIV+FY++++F +G+ V YNDP L             PFV++I+NAG 
Sbjct: 322 KSVPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASS---PFVISIQNAGT 378

Query: 348 PVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCI 407
            VLP IFNA VL+ V SA NS++YV SR LY LA    APK FA   + GVPY  +I   
Sbjct: 379 KVLPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTA 438

Query: 408 LFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYA 467
           L  LLA++ V+  +   FN+ +N+ ++ GL +W+ I + +I F +AL+ +G+ +  L + 
Sbjct: 439 LLGLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFK 498

Query: 468 APLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRG 526
           A     GAY+A FF  +I  I+ F  F   KFD   F T YI + + ++ F G + Y R 
Sbjct: 499 AKFMPWGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRC 557

Query: 527 TKFVKPEEADLYTFKELIDL----EEEEGKLWD 555
               K E+ D+ + +  ID     ++E   LW+
Sbjct: 558 RFLWKLEDIDIDSDRREIDAIVWEDDEPQNLWE 590

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  311 bits (796), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 182/560 (32%), Positives = 300/560 (53%), Gaps = 26/560 (4%)

Query: 2   SFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEA 61
            F+ + Y  +    V+ + TT + VE+ D + + + S QE             +K++L+ 
Sbjct: 27  EFVDEQYSGEN---VTKAITTERKVED-DAAKETESSPQERR----------EVKRKLKQ 72

Query: 62  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL- 120
           RH+ M                       PV  LI+Y F+G ++Y V   LGEM T+IP+ 
Sbjct: 73  RHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVT 132

Query: 121 DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIF 180
             F+ +A R+  PALG   GY Y   +      +L+    V+QYW   E V    WI IF
Sbjct: 133 SSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWT--EAVPLAAWIVIF 190

Query: 181 LVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPG 240
             ++ ++N             ++S KV+ +L  I+  F ++ G G S   +GFR++++PG
Sbjct: 191 WCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPG 250

Query: 241 AFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYR 300
           A+ P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ +PRAIK  + R
Sbjct: 251 AWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVR 310

Query: 301 IVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLM 360
           I+VFY++++F +G+ V YNDP L             PF+++I+N+G  VLP IFNA VL+
Sbjct: 311 ILVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLI 367

Query: 361 FVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSG 420
            + SA NS++Y+ SR LY L+ ++ AP+  +   + GVPY S++   +F  LA++ VS+G
Sbjct: 368 TILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAG 427

Query: 421 SAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALF 480
           S + FN+ +N+  + G  +W+ I  ++I F +A+R +G+ +  L Y A +    AY+A F
Sbjct: 428 SGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASF 487

Query: 481 FCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYT 539
           F  LI LI+ FT F    F   +F+  YI I +F+  +  ++ + +     K ++ D+ +
Sbjct: 488 FIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDS 546

Query: 540 ----FKELIDLEEEEGKLWD 555
                +EL+ +E E    W 
Sbjct: 547 DRRQIEELVWIEPECKTRWQ 566

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  310 bits (795), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 181/554 (32%), Positives = 297/554 (53%), Gaps = 24/554 (4%)

Query: 14  KIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIR-----------LKKELEAR 62
           K  +NS  T K+ E +D   ++  +S     N   ++DG +           ++++L+ R
Sbjct: 14  KREANSAPTIKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLKER 73

Query: 63  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-D 121
           H+ M                       PV  LI+Y F+G ++Y V   LGEMAT+IP+  
Sbjct: 74  HIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTS 133

Query: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
            F+ +A R+  PALG   GY Y   +      +L+    ++QYW     V    WI IF 
Sbjct: 134 SFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT--HAVPLAAWIVIFW 191

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
            ++  +N             ++S KV+ +L  I+  F I+ G G     +GFR++++PGA
Sbjct: 192 CLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGA 251

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
           + P   + + ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ VPRAIK  + RI
Sbjct: 252 WGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRI 311

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
           +VFY++++F +G+ V YNDP L             PF+++I+N+G  VLP IFNA VL+ 
Sbjct: 312 LVFYILSLFFIGLLVPYNDPKL---DSDGTFVSASPFMISIENSGTKVLPDIFNAVVLIT 368

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
           +FSA NS++Y+ SR LY L+ ++ APK  +   + GVPY +++L  LF  LA++  S+GS
Sbjct: 369 IFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGS 428

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
            + FN+ +N+  + G  +W+ I  ++I F +A++ +G+ +  L Y A +    AY+A FF
Sbjct: 429 GKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFF 488

Query: 482 CCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYTF 540
             LI LI+ FT F    F   +F+  YI + +F I +  ++ + +     K ++ D+ + 
Sbjct: 489 IALIVLIQGFTAF-APTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDS- 546

Query: 541 KELIDLEEEEGKLW 554
               D  E E ++W
Sbjct: 547 ----DRREIEEQVW 556

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  311 bits (798), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 179/492 (36%), Positives = 269/492 (54%), Gaps = 15/492 (3%)

Query: 41  ESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFV 100
           E  ++  G  +  ++K+EL+ RH+ M                       PV  LIAY F+
Sbjct: 88  EEDIDATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFM 147

Query: 101 GFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAA 159
           G LV+ V   LGEMAT+IP+   FT +ASR+     G A GY Y F + I    +L+   
Sbjct: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207

Query: 160 LVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFV 219
            V+++W    KV    WI+IF V+IV +N            W++S KV+ ++  I+    
Sbjct: 208 QVIEFWTF--KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265

Query: 220 IMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIV 279
           ++ G G +   +GFR+++ PG + P   +   ++ +F+ +V+  + A F Y GTEL GI 
Sbjct: 266 MVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324

Query: 280 AAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFV 339
           A E  NPR++VPRAIK    RI++FY++++F +G+ V YNDP L             PF+
Sbjct: 325 AGEAANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKL---SSTDSYVSASPFI 381

Query: 340 VAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVP 399
           +AI+N+G  VLPHIFNA +L  + SA NS++YV SR LYGL+    APK F KT   GVP
Sbjct: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVP 440

Query: 400 YNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGV 459
           + +++    F  LAYM  S+G    FN+ +N+  + G  +W++I I++I F + L+ +G+
Sbjct: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500

Query: 460 DKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFII--- 516
            +  L Y A L    AY+  FF  LI LI+ FT F   KFD   F+T YI   +F+    
Sbjct: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYI 559

Query: 517 ---CFFGYKYIR 525
              C+F  +  R
Sbjct: 560 VAQCYFRTRLWR 571

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  311 bits (798), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 177/553 (32%), Positives = 296/553 (53%), Gaps = 25/553 (4%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQ-ESHLNIDGKHDGIRLKKELEARH 63
            D+ +K+ + I +  + +  +++    +  D I  + E     +       LK+ L++RH
Sbjct: 45  NDNNKKNPQIIYNEKSYSQDELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGLKSRH 104

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGF 123
           + +                       P  + I+Y  +   VY +M  LGEM  ++P +G 
Sbjct: 105 IQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGS 164

Query: 124 TSYAS------RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWI 177
            S  S      +Y DP+LGFA  ++Y + ++I+   +++AA+ V++YW   E V  G WI
Sbjct: 165 DSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWI 224

Query: 178 TIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-LGFRFY 236
           TIFL +IV +N            W +S K+L +  LI+L F++  GGGP  D  LGFR++
Sbjct: 225 TIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYW 284

Query: 237 KDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIK 295
           K+PG+F  +     G  G F+      +   F+  LG EL  + ++EC + RRN+ +A K
Sbjct: 285 KNPGSFAHH--ITGGGGGNFLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASK 342

Query: 296 LTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXX-XXPFVVAIKNAGIPVLPHIF 354
             ++R++ FY++    +G+ VAYNDP+L              PFV+ I+NAGI  +PHI 
Sbjct: 343 RFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIV 402

Query: 355 NACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAY 414
           N C+L   +SA N+ ++ +SRSL  +A +  APKIF + N+ GVPY ++   +L   LAY
Sbjct: 403 NFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAY 462

Query: 415 MNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKG 474
           +NVSS +A VFN+F N+ +I G + WI   + YI F +A     +  + L +  P  +KG
Sbjct: 463 LNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKA-----ITYNKLTHRIPFRAKG 517

Query: 475 A----YFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGT--- 527
                +++LF+  LI L   + +F+   ++ K+FI  YI +P+FI+ + G+K    T   
Sbjct: 518 QQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTRTLLK 577

Query: 528 KFVKP-EEADLYT 539
            +++P ++ D+YT
Sbjct: 578 AWLRPIDKIDVYT 590

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  311 bits (797), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 187/526 (35%), Positives = 283/526 (53%), Gaps = 27/526 (5%)

Query: 54  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGE 113
            +K+ L+ RH+ M                       PV  LI+Y F+G +VY +   LGE
Sbjct: 106 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQSLGE 165

Query: 114 MATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172
           MAT+IP+    T ++ R+  PA G A GY Y F + I    +++    V+QYW   +KV 
Sbjct: 166 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWT--DKVP 223

Query: 173 PGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-L 231
             VWI IF V+I  +N            W++S KVL ++  ++   VI+ GG  SH   +
Sbjct: 224 LAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGG--SHQGPI 281

Query: 232 GFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVP 291
           GFR++++PGA+ P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ VP
Sbjct: 282 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 341

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
           RAI   ++RIV+FY++++F +G+ V YN+P L             PFV++I+NAG   LP
Sbjct: 342 RAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASS---PFVISIQNAGTYALP 398

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
            IFNA VL+ V SA NS++YV SR LY LA    APK F    K GVPY  ++      L
Sbjct: 399 DIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGL 458

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           LA++ V++ +   FN+ +N+ ++ GL +W+ I + +I F +AL  +G+ +  L + A L 
Sbjct: 459 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLM 518

Query: 472 SKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV- 530
             GAY+A FF  +I  I+ F  F    F   +F T YI + +  + F G +     +F+ 
Sbjct: 519 PYGAYYAAFFVTVIIFIQGFQAFC--PFKVSDFFTSYISLILLAVVFTGCQLYYKCRFIW 576

Query: 531 KPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKF 576
           K E+ D+ T     D  E E  +W+       +  PKN    +EKF
Sbjct: 577 KLEDIDIDT-----DRREIEAIIWE-------DDEPKN---LWEKF 607

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  310 bits (794), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 193/579 (33%), Positives = 305/579 (52%), Gaps = 30/579 (5%)

Query: 11  DLE-KIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXX 69
           D+E   ++   T  K  E +D S    +  ++         +  +LK+ L++RHV +   
Sbjct: 29  DIEANTITEQLTKDKHKETIDYSETSSLDEEKQQQ----PEENGKLKQGLKSRHVQLIAL 84

Query: 70  XXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYAS- 128
                               P  +  +Y  +   +Y +M   GEM  Y+P +G  S  S 
Sbjct: 85  GGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSS 144

Query: 129 -----RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183
                +Y D +LGFA  ++Y + ++I+   + TAAA V++YW    KV  G WITIFL  
Sbjct: 145 AYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFC 204

Query: 184 IVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243
           +V +N            W +S K+L +L LI+L F++  GGGPSHDRLGFR+++ PGAF 
Sbjct: 205 VVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFA 264

Query: 244 PYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302
            +     G+ G F+      +   FA+ LG EL  + ++EC + RRN+ +A +  ++R++
Sbjct: 265 DH--ITDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLM 322

Query: 303 VFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
           +FY++    + + VAYNDP L              PFV+ I+NAGI VLPHI N C++  
Sbjct: 323 IFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTS 382

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
            +SA N+ ++ +SRSL  +A    APK F+K N++GVPY ++    LFC LAY+NVSS +
Sbjct: 383 AWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSST 442

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
           A VFN+F N+ +I G + WI   + YI F +A+    +    L Y         +++LF 
Sbjct: 443 ANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFM 501

Query: 482 CCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGT---KFVKPEEADLY 538
             LI L   + +F+   +DYK+FI  YI +PVFI+ + G+K +  +    ++  ++ D++
Sbjct: 502 VSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVF 561

Query: 539 TFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFL 577
           T  E  ++EE   +L      EK    P N  W  +KFL
Sbjct: 562 TGLE--EIEELTNEL-----DEK--RVPPNNAW--DKFL 589

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  308 bits (789), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 183/526 (34%), Positives = 292/526 (55%), Gaps = 14/526 (2%)

Query: 24  KDVENLDLSNQDDISSQESHLNIDGKH----DGIRLKKELEARHVSMXXXXXXXXXXXXX 79
           K V+ LD  N D   + E +  +D +         L++  + RHV M             
Sbjct: 12  KRVDTLDTGNSDTQQNGEVY-ELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVI 70

Query: 80  XXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLD-GFTSYASRYCDPALGFA 138
                     P S+LIA+ F G L+  V+  L EMA++ P+D  F+ YA+RY DPALGFA
Sbjct: 71  GTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFA 130

Query: 139 VGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXX 198
            G++Y  KY I   ++L+A  L++QYW  RE ++  ++I +FLV+++++N          
Sbjct: 131 TGWNYFLKYAIALASELSAIGLLVQYW--REDLSIAIFIVVFLVVLLSLNFMNIKFYGEV 188

Query: 199 XXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVS 258
             W +  K LV++   V   V+  GGGPS + +GFR++++  AF PY   + G+ G+F+ 
Sbjct: 189 EFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREY-AFVPY--LVKGTTGRFLG 245

Query: 259 FVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAY 318
           + A  + + +AY+G+E  G+V  E  NP++ +P A +  ++RI  FY+V + +LG+ ++ 
Sbjct: 246 WWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISP 305

Query: 319 NDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLY 378
           +D  L             PFV+A  NAGI  LP   NA ++MF+ SA N+ LYV SR+ Y
Sbjct: 306 HDKTLANAKTSDASGS--PFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAY 363

Query: 379 GLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLM 438
           GLA D  APKIF   N++GVP+N  +L  L  LL++MN+S+ S+ +F Y  + V++FG +
Sbjct: 364 GLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTL 423

Query: 439 SWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHK 498
           +W+++LI+YI ++RA     V +  + +        AY  LFF  LI     ++ F+   
Sbjct: 424 NWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAG- 482

Query: 499 FDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELI 544
           F YK+FI  YIGI VFI     +K+ + +   +PE+      +E I
Sbjct: 483 FKYKSFIVSYIGIAVFIGNTLFWKFWKKSAATRPEDLRSIMVEEAI 528

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  311 bits (796), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 186/585 (31%), Positives = 313/585 (53%), Gaps = 31/585 (5%)

Query: 6   DSYRKD---LEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEAR 62
           D+ + D   +EKI  + + +S    + +L    D+   E   + DG ++  +LK+ L++R
Sbjct: 56  DNEKDDDIRMEKISKDQSASSNGTIHEELVMDVDL---EKSPSADGDNEPRKLKQGLQSR 112

Query: 63  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG 122
           HV +                       P  + I+Y  +  ++Y +M  LGEM  ++P DG
Sbjct: 113 HVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDG 172

Query: 123 FTSYAS------RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVW 176
             S  S      RY D +LGFA G++Y + Y+I+   + TAA+ V++YW +   V  GVW
Sbjct: 173 SDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT--AVPKGVW 230

Query: 177 ITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFY 236
           IT+FL+++V +N            W +S K+L ++ LI+L F++  GGGP HDRLGFR++
Sbjct: 231 ITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYW 290

Query: 237 KDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIK 295
           + PGAF  +     GS G F       +   FA+ LG EL  + +AEC + RRN+ +A +
Sbjct: 291 QHPGAFAHH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASR 348

Query: 296 LTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHIF 354
             ++R++ FY++    + + V YNDP+L+             PFV+ I+NAGI VLPHI 
Sbjct: 349 RFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHII 408

Query: 355 NACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAY 414
           N C+L   +SA N+ ++ ++RSL  +A   +APK   K N+WGVPY ++    L   LAY
Sbjct: 409 NGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAY 468

Query: 415 MNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGV-DKSTLAYAAPLASK 473
           +NVSS +A VFN+F N+ +I G + WI   I Y+ F +A+   G+ D+  L +       
Sbjct: 469 LNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGLYDR--LPFKTWGQPY 526

Query: 474 GAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP 532
             +F+L    +I +   + +F+   +   +FI  Y+ +P+F++ + G+K Y R       
Sbjct: 527 TVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRTWHQWWL 586

Query: 533 EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFL 577
             +++   + L+++EE+  ++      E++   P + K   +KF+
Sbjct: 587 PVSEIDVTRGLVEIEEKSREI------EELRLPPTSIK---DKFM 622

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  310 bits (793), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 182/557 (32%), Positives = 294/557 (52%), Gaps = 24/557 (4%)

Query: 17  SNSNTTSKDVENLDLSN------QDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXX 70
           S  N+  K + N +L++      +  +  +      +  ++  ++K+EL+ RH+ M    
Sbjct: 40  SKDNSIKKKIPNSELASLTHAYSRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALG 99

Query: 71  XXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASR 129
                              PV  LIAY F+G +VY V   LGEMAT+IP+    T ++ R
Sbjct: 100 GTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQR 159

Query: 130 YCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINX 189
           +  PA G A GY Y F + I    +++    V+QYW   + V    WI IF V++  +N 
Sbjct: 160 FLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWT--DAVPLAAWIAIFWVLVTLMNF 217

Query: 190 XXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAF----RPY 245
                      W++  KV+ ++  ++   +I+ GG      +GFR++++PGA+       
Sbjct: 218 FPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSD 277

Query: 246 SEAISGSK--GKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVV 303
            E I  SK  G+F+ +VA  + A F Y GTEL GI A E  NPR+ VPRAI   ++RIV+
Sbjct: 278 GEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVL 337

Query: 304 FYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVF 363
           FY++++F +G+ V + D  L             PFV++I+NAG  +LP IFNA V++ V 
Sbjct: 338 FYIMSLFFIGLLVPFTDSRL---SDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVL 394

Query: 364 SACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQ 423
           SA NS++YV SR LY LA    APKIFA+  + GVP+  +I   L  LLA++ V + +  
Sbjct: 395 SAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANT 454

Query: 424 VFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCC 483
            FN+ V++ ++ GL +W+ I + ++ F + L+ +G+ +  L + A     G+Y+A F+  
Sbjct: 455 AFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVF 514

Query: 484 LIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKE 542
           +I  ++ F  F  H FD   F T YI + +  + F G + Y R     K E+ D+ + + 
Sbjct: 515 VIIFVQGFQAFSPH-FDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRR 573

Query: 543 LID---LEEEEGK-LWD 555
            I+    E++E K +WD
Sbjct: 574 EIEDAIWEDDEPKTIWD 590

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  309 bits (791), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 183/545 (33%), Positives = 297/545 (54%), Gaps = 21/545 (3%)

Query: 18  NSNTTSKDVE----NLDLSNQDDISSQESHLNIDGKHD-------GIRLKKELEARHVSM 66
           NS +T K+ E      D  + ++  + +S +N D   +       G  +K++L+ RH+ M
Sbjct: 18  NSISTIKEEELICARYDGQDTEEAVAGKSSINNDSAKETETSPRKGGEVKRKLKQRHIGM 77

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTS 125
                                  PV  LI+Y F+G ++Y V   LGEMAT+IP+   F+ 
Sbjct: 78  IALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSV 137

Query: 126 YASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIV 185
           +A R+  PALG   GY Y   +      +L+    ++QYW   + V    WI IF  ++ 
Sbjct: 138 FAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT--DAVPLVAWIVIFWCLLT 195

Query: 186 TINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPY 245
            +N             ++S KV+ +L  I   F I+ G G S   +GFR++++PGA+ P 
Sbjct: 196 LMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPG 255

Query: 246 SEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFY 305
             + + ++G+F+ +V+  + A F Y GTEL GI A E  NPRR VPRAIK  + RI+VFY
Sbjct: 256 IISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFY 315

Query: 306 LVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSA 365
           ++++F +G+ V YNDP L             PF+++I+N+G  VLP IFNA VL+ + SA
Sbjct: 316 ILSLFFIGLLVPYNDPKL---DSEGTFVSSSPFMISIENSGTKVLPDIFNAVVLITILSA 372

Query: 366 CNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVF 425
            NS++Y+ SR LY L+ ++ AP+  +   K GVPY +++    F  LA++  S+GS +VF
Sbjct: 373 GNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVF 432

Query: 426 NYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLI 485
           N+ +N+  + G  +W+ I +++I F +A++ +G+ +  L Y A +    AY+A FF  LI
Sbjct: 433 NWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALI 492

Query: 486 ALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFKELI 544
            LI+ FT F    F   +FI  YI + +FI  +  ++     +FV K ++ D+ + +   
Sbjct: 493 VLIQGFTAF-APTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRR-- 549

Query: 545 DLEEE 549
           D+EE+
Sbjct: 550 DIEEQ 554

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  310 bits (793), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 186/559 (33%), Positives = 303/559 (54%), Gaps = 31/559 (5%)

Query: 23  SKDVENLDLSNQDDISS---QESHLNIDGKHDGI----RLKKELEARHVSMXXXXXXXXX 75
           +K +E +D+ +Q   SS    E   + DG  D       L++ L++RH+ M         
Sbjct: 38  NKTIEFVDVESQQSTSSATISEKLGDGDGDADPFANEGSLQQGLKSRHIQMIALGGAIGT 97

Query: 76  XXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYAS------R 129
                         P  + I+Y  +  +VY +M   GEM  Y+P +G  +  S      R
Sbjct: 98  GLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVAR 157

Query: 130 YCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINX 189
           Y D +LGFA  ++Y + Y+I+   + TAA+ V++YW     V  GVWI IFL I+V +N 
Sbjct: 158 YVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTV--AVPKGVWILIFLGIVVILNF 215

Query: 190 XXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAI 249
                      W +S K+L ++ LI+L F++  GGGP+HDRLGFR+++ PGAF  +   +
Sbjct: 216 GPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEH--IM 273

Query: 250 SGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVT 308
            G  G+F+   +  +   FA+ LG EL  + +AEC++ RRN+ +A +  ++R++ FY++ 
Sbjct: 274 KGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLG 333

Query: 309 IFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACN 367
              + + VAYNDP L+             PFV+ I+NAGI VLPHI NAC+L   +SA N
Sbjct: 334 TLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGN 393

Query: 368 SDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNY 427
           + ++ ++RSL  +A +  AP++F K N++GVPY ++ L      LA++NVSS +A VFN+
Sbjct: 394 AFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNW 453

Query: 428 FVNVVSIFGLMSWIAILITYIYFDRALRAQGV-DKSTL-AYAAPLASKGAYFALFFCCLI 485
           F N+ +I G + WI   + YI F +A+   G+ D+     +  P A    Y++LF   LI
Sbjct: 454 FSNISTISGFIGWICGCVAYIRFRKAIFFNGMYDRLPFKTWGQPYA---VYYSLFVISLI 510

Query: 486 ALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGT----KFVKPEEADLYTFK 541
            L   +  F+   +   +F+  YI +P+F++ + G+K    T     + + ++ D+ T  
Sbjct: 511 TLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWRRVDQIDVTT-- 568

Query: 542 ELIDLEEEEGKLWDAAQKE 560
            L+D+EE   K+ D  + E
Sbjct: 569 GLVDIEERT-KILDETRVE 586

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  309 bits (791), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 182/515 (35%), Positives = 277/515 (53%), Gaps = 13/515 (2%)

Query: 47  DGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYI 106
           +G+     +K+ L+ RH+ M                       PV  LIAY F+  LVY 
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 107 VMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYW 165
           V+  LGEMAT+IP+   FT ++SR+  PA G A GY Y F + I    +L+    ++++W
Sbjct: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188

Query: 166 VSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGG 225
            +   V    WITIF V++   N            W++  KV+ ++  I+    ++ G G
Sbjct: 189 TT--AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246

Query: 226 PSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKN 285
            +   +GFR++++PGA+ P   +   ++G+F+ +V+  + A F Y GTEL GI A E  N
Sbjct: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305

Query: 286 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNA 345
           PR++VPRAIK  ++RI+VFY      +G+ V YNDP L             PF++AI+N+
Sbjct: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENS 362

Query: 346 GIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLIL 405
           G  VLPHIFNA VL  + SA NS++YV SR +YGLA    AP  F +TN  GVPY ++  
Sbjct: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422

Query: 406 CILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLA 465
              F  LAYM +S+G A  FN+ +N+  + G  +W+ I   +I F +AL+ +G+ +  L 
Sbjct: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482

Query: 466 YAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YI 524
           + A      AY+ALFF  +I LI+ FT F    F   +F   Y+ + +FI  + G + + 
Sbjct: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541

Query: 525 RGTKFVKPEEADLYTFKELIDL----EEEEGKLWD 555
           R   F + +E D+ T +  I+     +E    LWD
Sbjct: 542 RCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWD 576

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  308 bits (788), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 178/532 (33%), Positives = 285/532 (53%), Gaps = 24/532 (4%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           L K L++RH+ +                          +L+++  +  +VY +M  L EM
Sbjct: 46  LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEM 105

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
             Y+P  G      SRY DP+LGFA G++Y + Y I+   +L+AAA V+ YW     V  
Sbjct: 106 ICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYW--DNPVPM 163

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
             WITIFLV++V +N            W +S K++ +L L+V+  VI  GG P+HDR GF
Sbjct: 164 AAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGF 223

Query: 234 RFYKDPGAFRPYSEAIS-GSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVP 291
           R++K+PG   P++ +++ GS G+F+      + + FA+ L  EL GI   E ++ RRN  
Sbjct: 224 RYWKNPG---PFAMSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTE 280

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVL 350
           +A +  +YRI+ FY+    ++G+ ++  DP L++            PFV  I NAGIPVL
Sbjct: 281 KASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVL 340

Query: 351 PHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFC 410
            H+ N  +L   +SA NS +Y ++R +  LA +  APK   K N++GVPYN++I+C L  
Sbjct: 341 DHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVA 400

Query: 411 LLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPL 470
            LAY+NV + SA VF +  N+ +I G + W A+ I +I F R +    + +S + Y  PL
Sbjct: 401 CLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRIPYQGPL 459

Query: 471 ASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKF 529
               AY+  F   ++ L   F VFL  +++  +F+  Y+ +P++++ + G+K + R   +
Sbjct: 460 QPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWY 519

Query: 530 VKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
           +  E+ D+ T   L++ EEE         K      PKN    +EKFL W+ 
Sbjct: 520 IPVEQIDVIT--GLVEAEEE--------SKMTPPRIPKN---LWEKFLYWLL 558

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  306 bits (784), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 175/534 (32%), Positives = 291/534 (54%), Gaps = 17/534 (3%)

Query: 29  LDLSNQDDISSQE-SHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXX 87
           L   NQD    +E   ++++ + + +R  +EL+ RH+ M                     
Sbjct: 2   LGGHNQDSKMKEEIREISVEVEAETVR--RELKQRHMGMIALGGTIGTGLFIGVSTPLMN 59

Query: 88  XXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFK 146
             PV  LIAY F+  L Y V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F 
Sbjct: 60  AGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFS 119

Query: 147 YLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFK 206
           + I    +L+    V+Q+W     V    WI+IF V++  +N            W++  K
Sbjct: 120 WCITFALELSVVGQVIQFWTF--AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVK 177

Query: 207 VLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYA 266
           V+ ++  ++  F ++ G G +   +GFR+++ PGAF P   A   ++ +F+ +V+  + A
Sbjct: 178 VVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINA 236

Query: 267 LFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQX 326
            F + GTEL GI A E  NPR+ VPRAIK  ++RI+ FY++++F +G+ V Y+D    + 
Sbjct: 237 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDD---WKL 293

Query: 327 XXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKA 386
                     PF++AI+N+G  VLPHIFNA ++  + SA NS++YV SR +YGL+    A
Sbjct: 294 TSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLA 353

Query: 387 PKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILIT 446
           P I ++T + GVP+ ++++  LF  LAYM  S+G  + FN+ +N+  + G  +W+ I ++
Sbjct: 354 PGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLS 413

Query: 447 YIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFIT 506
           +I F +AL  +G+ +  L + A      AY+ +FF  LI +I+ FT F    ++  +F+T
Sbjct: 414 HIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLT 471

Query: 507 GYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYT----FKELIDLEEEEGKLWD 555
            YI + +FI  +  ++ + R     + E+ D+ T     +E + +E+E    WD
Sbjct: 472 AYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWD 525

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  307 bits (786), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/529 (34%), Positives = 284/529 (53%), Gaps = 22/529 (4%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDL-SNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           + S  K LE  VS+        E L + S+  D +  E     +G      +K+ L+ RH
Sbjct: 16  KPSVSKKLEDYVSS--------ETLPIYSHSGDNAPCEKG---EGDCRETEVKRALKPRH 64

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DG 122
           +SM                       PV  LIAY F+G +VY V   LGEMAT+IP+   
Sbjct: 65  ISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSS 124

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182
            T ++ R+  PA G A GY Y F + I    ++     V+QYW   + V    WI IF V
Sbjct: 125 ITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWT--DAVPLAAWIAIFWV 182

Query: 183 IIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-LGFRFYKDPGA 241
           ++   N            W++S KV+ ++  ++   VI+ GG  SH   +GFR++++PG 
Sbjct: 183 LVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGG--SHQGPIGFRYWRNPGP 240

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
           + P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ VPRAI    +RI
Sbjct: 241 WGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRI 300

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
           + FY++++F +G+ V Y+D   L+           PFV++I+NAG  VLPHIFNA V++ 
Sbjct: 301 LFFYILSLFFIGLLVPYDD---LRLSNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMIT 357

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
           + SA NS++YV SR LY LA+   APK F    K GVPY  +I+  L  LLA++ V++ +
Sbjct: 358 IISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNA 417

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
            + FN+ VN+ ++ GL +W+ I ++++ F + L+ +G+ +  L + A L   GAY+A FF
Sbjct: 418 NEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFF 477

Query: 482 CCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV 530
             +I +I+ F  F   KF   +F T YI + +  + F G +     +F+
Sbjct: 478 IGVIIIIQGFKAFT-PKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFI 525

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  308 bits (789), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/526 (34%), Positives = 282/526 (53%), Gaps = 27/526 (5%)

Query: 54  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGE 113
            +K+ L+ RH+ M                       PV  LIAY F+G ++Y +   LGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 114 MATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172
           MAT+IP+    T ++ R+  PA G + GY Y F + I    +++    V+QYW   +KV 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWT--DKVP 222

Query: 173 PGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-L 231
              WI IF V+I  +N            W++S KVL ++  ++   VI+ GG  SH   +
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGG--SHQGPI 280

Query: 232 GFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVP 291
           GFR++++PGA+ P   + + S+G+F+ +V+  + A F Y GTEL GI A E  NPR+ VP
Sbjct: 281 GFRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 340

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
           RAI   ++RIV+FY++++F +G+ V YN+P L             PFV++I+NAG   LP
Sbjct: 341 RAINKVVFRIVIFYIMSLFFIGLLVPYNEPRL---SPSSAVIASSPFVISIQNAGTYALP 397

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
            IFNA VL+ V SA NS++YV SR LY LA    APK F    K GVPY  ++      L
Sbjct: 398 DIFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGL 457

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           LA++ V++ +   FN+ +++ ++ GL +W+ I + +I F +AL+ +G+ +  L + A L 
Sbjct: 458 LAFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLM 517

Query: 472 SKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV- 530
             GAY+A FF  +I  I+ F  F    F    F T YI + +  + F   +     +F+ 
Sbjct: 518 PYGAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSYISLILLAVVFISCQLYYKCRFIW 575

Query: 531 KPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKF 576
           K E+ D+ +     D  E E  +W+       +  PKN    +EKF
Sbjct: 576 KLEDIDIDS-----DRREIEAIIWE-------DDEPKN---LWEKF 606

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  305 bits (782), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 188/550 (34%), Positives = 292/550 (53%), Gaps = 38/550 (6%)

Query: 18  NSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXX 77
           +SN T   +  LD    DD   Q+             +K+EL+ RH+SM           
Sbjct: 14  DSNDTPTTISTLD----DDQEKQQD------------VKRELKKRHISMIALGGTIGTGL 57

Query: 78  XXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDPALG 136
                       P+  LIAY F+G +V+ V   LGEM T+IP+   FT +A R+  PA G
Sbjct: 58  FLGIARPLIIAGPIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFG 117

Query: 137 FAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXX 196
            A GY Y F + +    +L+    ++Q+W     V    WI+I  V++   N        
Sbjct: 118 AANGYMYWFSWAMTFALELSVVGQIIQFWTM--AVPLAAWISIVWVLLTISNLFPVRIYG 175

Query: 197 XXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGS---K 253
               W++S KVL +L  I+    I+ G G +   +GFR++K+PG   P+   I  S   +
Sbjct: 176 EIEFWIASVKVLAILGFIIYGICIICGAGVTGP-VGFRYWKNPG---PWGMGIISSNVNE 231

Query: 254 GKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLG 313
            +F  +V+  + A F + GTEL GI A E + PR+ VP+AIK  ++RI+VFY+ ++ ++G
Sbjct: 232 ARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIG 291

Query: 314 MTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVA 373
           + V YNDP L             PF++ I+NAG  +LPHIFNA +L+ + SA NS++Y+ 
Sbjct: 292 LLVPYNDPKL---QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIG 348

Query: 374 SRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVS 433
           SR LYGLA +  APK F  T+K GVPY +++   +F  LAYM  ++G  + F + +N+V 
Sbjct: 349 SRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVG 408

Query: 434 IFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTV 493
           + G  +W+ I  ++I F +AL+ +G+ ++ L Y A L    AY+A+FF  +I +I+ FT 
Sbjct: 409 VAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTS 468

Query: 494 FLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFKELI-------D 545
           F   KF   NF   YI + +FII +  ++     + V K ++ DL T +  I       D
Sbjct: 469 F-APKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDD 527

Query: 546 LEEEEGKLWD 555
           +E++    WD
Sbjct: 528 VEDKNKNWWD 537

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  307 bits (787), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 183/525 (34%), Positives = 281/525 (53%), Gaps = 25/525 (4%)

Query: 54  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGE 113
            +++ L+ RH+ M                       PV  LIAY F+G +VY V   LGE
Sbjct: 105 HVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSLGE 164

Query: 114 MATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172
           MAT+IP+    T ++ R+  PA G + GY Y F + I    +++    V++YW +  KV 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTT--KVP 222

Query: 173 PGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232
            GVWI IF V+I  +N            W++S KVL ++  ++   VI+ GG      +G
Sbjct: 223 LGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGPIG 281

Query: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
           FR++++PGA+ P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ VPR
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           AI   ++RIV+FY++++F +G+ V Y DP L             PFV++I+NAG   LP 
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASS---PFVISIQNAGTYALPD 398

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           IFNA VL+ V SA NS++YV SR LY LA    APK F    K GVPY  ++      LL
Sbjct: 399 IFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 458

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           A++ V++ +   FN+ +N+ ++ GL +W+ I +++I F +AL  +G+ +  L + A    
Sbjct: 459 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMP 518

Query: 473 KGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-K 531
            GAY+A FF  +I  I+ F  F    F   +F T YI + +  + F G +     +F+ K
Sbjct: 519 YGAYYASFFVTVIIFIQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQLYYKCRFIWK 576

Query: 532 PEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKF 576
            E+ D+ +     D  E E  +W+       +  PKN    +EKF
Sbjct: 577 LEDIDIDS-----DRREIEAIIWE-------DDEPKN---LWEKF 606

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  307 bits (786), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 185/556 (33%), Positives = 299/556 (53%), Gaps = 28/556 (5%)

Query: 17  SNSNTTSKDVEN-LDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXX 75
           S S T S+ + + L  +        E H+    KH  +  K+ L+ RH++M         
Sbjct: 60  STSPTGSELIPDCLQSATNTGTLCTEEHV----KHRSV--KRALKPRHIAMIALGGTIGT 113

Query: 76  XXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPA 134
                         PV  LIAY FVG +++ V   LGEM T+IP+   FT ++ R+  PA
Sbjct: 114 GLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPA 173

Query: 135 LGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXX 194
            G A GY Y F + +    +L+    V+Q+W +   V    WI IF  ++   N      
Sbjct: 174 FGAANGYMYWFSWAMTFAVELSVLGKVIQFWTT--AVPLAAWIVIFWFLLTLSNMFPVKY 231

Query: 195 XXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKG 254
                 W++  KVL ++  ++    I  G GP H   GFR+++DPGA+ P   A   S+ 
Sbjct: 232 YGEIEFWIAFLKVLSLVGFLIFCLCITSGAGP-HGPFGFRYWRDPGAWGPGIIAEDQSEA 290

Query: 255 KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGM 314
           +F+ +V+  + A F Y GTEL GI A E  NPR+ VP+AIK  + RI+ FY+ ++F +GM
Sbjct: 291 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGM 350

Query: 315 TVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVAS 374
            V +NDP L             PF++AI+N+G+ +LP IFN  +L+ + SA NS++YV S
Sbjct: 351 LVPFNDPKLTSATSFVSSS---PFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGS 407

Query: 375 RSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSI 434
           R L+GLA  N AP+ F +T K GVP+ +++   LF  LA++ +++   +VFN+ +++V+I
Sbjct: 408 RILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAI 467

Query: 435 FGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVF 494
            G  +W+ I +++I F +AL  +G+ +++L + A      AY+A  F  LI LI+ FT F
Sbjct: 468 AGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAF 527

Query: 495 LGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTK-FVKPEEADLYTFKELIDLEEEEGKL 553
              +F+  +F+  YI + +F+I +  ++ ++  + F K E+ DL +     D ++ E   
Sbjct: 528 -APRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVEDIDLDS-----DRKDIEDIR 581

Query: 554 WDAAQKEKMESSPKNF 569
           W+       + SPK F
Sbjct: 582 WE-------DDSPKTF 590

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  305 bits (781), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 177/515 (34%), Positives = 283/515 (54%), Gaps = 15/515 (2%)

Query: 50  HDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMT 109
           HD   +K+EL+ RH+ M                       PV  LI+Y F+G LVY V  
Sbjct: 69  HDA-EVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQ 127

Query: 110 CLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSR 168
            LGEMAT+IP+   FT +A R+  P++G A GY Y F + +    +L+    V+QYW   
Sbjct: 128 SLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT-- 185

Query: 169 EKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSH 228
             V    WI+IF V+I   N            W++  KV+ ++  ++    ++ G G + 
Sbjct: 186 YAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTG 245

Query: 229 DRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRR 288
             +GFR++++PG + P   +   ++ +F+ +V+  +   F Y GTEL GI A E  NPR+
Sbjct: 246 P-VGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRK 304

Query: 289 NVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIP 348
            VPRAIK  ++RI+ FY+ ++F +G+ V YND  L             PF++AIKN+G P
Sbjct: 305 AVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDAL---NNTDSYVASSPFIIAIKNSGTP 361

Query: 349 VLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCIL 408
           VLPHIFNA +   + SA NS++YV SR L+GL+ +  APKI ++T K GVP+ ++++  +
Sbjct: 362 VLPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSV 421

Query: 409 FCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAA 468
              LAYM  S+G    FN+ +N+ ++ G  +W+ I +++I F +AL+ +G+ +  L + A
Sbjct: 422 VGALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKA 481

Query: 469 PLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTK 528
            L    AY+A F   +I +I+ FT F   KF   +F   YI I +FI  +  ++ I   +
Sbjct: 482 ALMPGLAYYASFLMFVIIIIQGFTAF-APKFSGSDFAAAYISIFLFIGIWCLFQIIFRCR 540

Query: 529 FV-KPEEADLYTFKELIDLEEEEGKLWDAAQKEKM 562
           F+ K E+ D+ T     D  + E  +W+ A+ + +
Sbjct: 541 FIHKVEDVDIDT-----DRRDIEAVVWEDAEPKTV 570

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  305 bits (780), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 182/558 (32%), Positives = 298/558 (53%), Gaps = 31/558 (5%)

Query: 19  SNTTSKDVENLDLS-------NQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXX 71
           S  T   +E+ ++        +Q+  SSQ+S L   G H    ++++L+ RHVSM     
Sbjct: 11  SQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSG-HGRNAVQRQLKPRHVSMIALGG 69

Query: 72  XXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRY 130
                             PV  LI+Y F+G + Y V   LGEMAT+IP+   FT +  R+
Sbjct: 70  TIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRF 129

Query: 131 CDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXX 190
               LG A GY Y F + +    +L+    +++YW S   V    WI IF V I   N  
Sbjct: 130 LSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTS--AVPNAAWIAIFWVPITLSNLV 187

Query: 191 XXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAIS 250
                     W++  KV+ ++  +V    ++ G G +   +GFR++++PG   P+ + I 
Sbjct: 188 PVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGP-VGFRYWRNPG---PWGDGII 243

Query: 251 GS---KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLV 307
                +G+F+ +V+  V A F Y GTEL GI A E  NPR+ VP+AI    +RI++FY+ 
Sbjct: 244 SHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVG 303

Query: 308 TIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACN 367
           ++F +G+ V +ND  L             PF++AI+N+G  +LP IFNA +L  + SA N
Sbjct: 304 SLFFIGLLVPFNDEKLTSSDSYSAGS---PFIIAIQNSGTKILPDIFNAVILATIISAAN 360

Query: 368 SDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNY 427
           S++YV SR LYGLA +  AP+ FA+TN+ GVP  +++    F  L Y++VS+G+++ F++
Sbjct: 361 SNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDW 420

Query: 428 FVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIAL 487
            +N+ +I G  SW+ I + ++ F +AL+ QG+ +  L + A L   GAY++ FF  LI +
Sbjct: 421 LLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIII 480

Query: 488 IKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFKELIDL 546
           I+ FT  L   F+  NF   YI + +F++ +  ++    T+ + + E  D+ + +  +D 
Sbjct: 481 IQGFTS-LAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDA 539

Query: 547 EEEE--------GKLWDA 556
           ++ +        GK W A
Sbjct: 540 QQWDNTEPTTLWGKFWAA 557

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  305 bits (780), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 179/529 (33%), Positives = 286/529 (54%), Gaps = 21/529 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LKK L++RH+ +                       P  +L +Y  +  ++Y VM  LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 115 ATYIPLDGFTSYAS------RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSR 168
             ++P     S  S      RY DP+LGFA G++Y + Y+I+   + TAA+ V+ YW + 
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTT- 223

Query: 169 EKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSH 228
             V  G WI IFL ++  +N            W +  K+L ++ L+ + F++  GGGP+H
Sbjct: 224 -AVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 229 DRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPR 287
           DRLGFR+++ PGAF  +    +G+ G+F+      +   FA+ LG EL  I ++E  + R
Sbjct: 283 DRLGFRYWQHPGAFAYH--ITTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 288 RNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXX-XXPFVVAIKNAG 346
           RN+ +A +   YR+V FY+ +   +G+ V+  DP+L              PFV+AI+NA 
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAH 400

Query: 347 IPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILC 406
           I VLPHI NAC+L   +S+ NS ++ ASRSL  +A D  AP+I  + N+ GVPY ++ L 
Sbjct: 401 IKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALS 460

Query: 407 ILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAY 466
             F  LA++NVSSGSA+ F +F N+ +I G + WI I + Y+ F +A+  +G+ +  + +
Sbjct: 461 AAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYER-VPF 519

Query: 467 AAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIR 525
            +PL   G YF +    LI L   +  F+   ++  +F+  YI +P+F++ + G+K Y R
Sbjct: 520 KSPLQPYGTYFFIVVVSLICLTNGYASFV--NWNASDFVAAYITLPIFVVLWVGHKIYTR 577

Query: 526 --GTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWF 572
              T  +   E D+ T   L ++EEE  K+ DA +     +  K  +W 
Sbjct: 578 TWSTWLLPVAEVDVTT--GLAEIEEET-KILDAQRIPPANAWQKFEQWL 623

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  304 bits (779), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 184/553 (33%), Positives = 292/553 (52%), Gaps = 19/553 (3%)

Query: 14  KIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXX 73
           K+ ++S+     V + D  + D + S     + +G     ++K+ L+ RHVSM       
Sbjct: 76  KLKAHSDDFEMYVYSQDEPSTDPLGSDTE--SGEGDMQEGKVKRALKPRHVSMIALGGTI 133

Query: 74  XXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCD 132
                           PV  LIAY F+G +VY V   +GEMAT+IP+    T ++SR+  
Sbjct: 134 GTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLS 193

Query: 133 PALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXX 192
           PA G A GY Y F + I    +L+    V++YW   E V    WI IF V++   N    
Sbjct: 194 PAFGVANGYMYWFNWAITFAVELSVTGQVIEYWT--EAVPRAAWIAIFWVLVTLANFFPV 251

Query: 193 XXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGS 252
                   W++S KVL ++  ++   VI+ GG      +GFR++++PG +     +    
Sbjct: 252 QFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS-KQGPIGFRYWRNPGPWGAGIISKDKD 310

Query: 253 KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLL 312
           +G+F+ +VA  + A F Y GTEL GI A E  NPRR VPRAI    +RI+ FY++++F +
Sbjct: 311 EGRFLGWVASLINASFTYQGTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFV 370

Query: 313 GMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYV 372
           G+ V YN   L +           PFV++I+NAG   LP IFNA VL+ + SA NS++YV
Sbjct: 371 GLLVPYNHSSLDKTTTVIASS---PFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYV 427

Query: 373 ASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVV 432
            SR L+ LA    APK+F+     GVP+  +I+  L  LLA++ V+  + + FN+ +N+ 
Sbjct: 428 GSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINIS 487

Query: 433 SIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFT 492
           ++ GL +W+ I I++I F + L+ +G+ +  L + + L   GAY+A F+  +I  ++ F 
Sbjct: 488 TLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQ 547

Query: 493 VFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKELIDL---EE 548
            F  H F    F T YI + + ++ F G + + R   F + E+ D+ + +   D    E+
Sbjct: 548 AFSPH-FKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWED 606

Query: 549 EE-----GKLWDA 556
           +E     GK W A
Sbjct: 607 DEPTTLWGKFWTA 619

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  301 bits (772), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 195/566 (34%), Positives = 300/566 (53%), Gaps = 35/566 (6%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQ-DDISSQESHLNIDGKHDGIRLKKELEARH 63
           Q    K+  K++    ++S     L+  +Q D  SSQE  +           ++ L+ RH
Sbjct: 9   QPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERGI-----------QRALKPRH 57

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DG 122
           VSM                       PV  LI+Y F+G L + V   LGEMAT+IP+   
Sbjct: 58  VSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASS 117

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182
           FT +  R+  PALG A GY Y F + I    +L+    ++QYW     V    WI IF V
Sbjct: 118 FTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWT--LGVPNAAWIIIFWV 175

Query: 183 IIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAF 242
            I   N            W++  KV+ ++  ++    ++ G G +   +GFR++++PG  
Sbjct: 176 PISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGP-VGFRYWRNPG-- 232

Query: 243 RPYSEAI---SGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLY 299
            P+ + I   S S+G+F+ +V+  V A F Y GTEL G+ A E  NPR+ VP+AI+    
Sbjct: 233 -PWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFL 291

Query: 300 RIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVL 359
           RI++FY+ ++F +G+ V +NDP L             PF++AI+N+G   LP IFNA +L
Sbjct: 292 RILLFYVGSLFFIGLLVPFNDPKL---DSTANYSASSPFIIAIQNSGTRALPDIFNAVIL 348

Query: 360 MFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSS 419
             + SA NS++YV SR LYGLA +  APKI  + N+ GVPY  + +  LF  L Y++VSS
Sbjct: 349 TTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSS 408

Query: 420 GSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFAL 479
           GSA+ F++ +N+ +I G  +W+ I + +I F +AL+ QG+ +  L + A L   GAY+A 
Sbjct: 409 GSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAA 468

Query: 480 FFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLY 538
           FF  LI +I+ FT F   KF+  NF   Y+ + +FI  +  ++ I  ++ + K E+ D+ 
Sbjct: 469 FFILLIIIIQGFTAF-APKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDID 527

Query: 539 TFKELIDLEEEE--------GKLWDA 556
           + +  I+ E  E        GK W A
Sbjct: 528 SDRREIEAEVWEDDEPTNLWGKFWAA 553

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  301 bits (772), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 184/556 (33%), Positives = 301/556 (54%), Gaps = 29/556 (5%)

Query: 18  NSNTTSKDVENLDLSNQDDISS---QESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXX 74
           ++ +   D++ +++  Q D SS    E  LN    HD   +K+EL+ RH+ M        
Sbjct: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA-EVKRELKQRHIGMIALGGTIG 81

Query: 75  XXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDP 133
                          PV  LIAY FVG L Y V   LGEMAT+IP+   FT +ASR+  P
Sbjct: 82  TGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSP 141

Query: 134 ALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXX 193
           ++G AVGY Y F + +    +L+    ++ YW     V    WI+IF VI+  +N     
Sbjct: 142 SIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF--AVPIAAWISIFWVILTALNMFPVK 199

Query: 194 XXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGS- 252
                  W+++ KV+ ++  ++    ++ G G +   +GFR++++PG   P+ + ++ + 
Sbjct: 200 FYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPG---PWGDGLTSNG 255

Query: 253 --------KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVF 304
                    G+F+ +    + A F Y GTEL GI A E  NPR+ VPRAIK  ++RI++F
Sbjct: 256 VEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLF 315

Query: 305 YLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFS 364
           Y+ ++F +G+ V ++DP L             PF++AI+N+G  +LP IFNA +L+ + S
Sbjct: 316 YIGSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIENSGTKILPDIFNAIILITIIS 372

Query: 365 ACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQV 424
           A NS++YV SR L+ LA    APKI ++T K GVP+ S++   +F +LAYM  + G   V
Sbjct: 373 AGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTV 432

Query: 425 FNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCL 484
           F++ VN+ +I G  +W+ ILI++I F + L+ +G+ +  L + A L    AY+A+F   +
Sbjct: 433 FDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVI 492

Query: 485 IALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFK-- 541
           I + + FT F    FD  +F   YI + +F + +  ++     +++ K E+ D+ + +  
Sbjct: 493 IIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRD 551

Query: 542 -ELIDLEEEEGK-LWD 555
            E I  E+ E K  WD
Sbjct: 552 VEKIIWEDPEPKTFWD 567

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  301 bits (771), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 182/561 (32%), Positives = 295/561 (52%), Gaps = 22/561 (3%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIR---LKKELE 60
           + ++Y K+ ++ +S S     D     + N+ D+       ++DG+   +R   +K+ L+
Sbjct: 26  LNETYVKEYDRSIS-SPPKENDGYGYRVDNEYDVDD-----SVDGEKGEVRSTEVKRALK 79

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
            RH+ M                       PV +LIAY F+  + + VM  LGEMATYIP+
Sbjct: 80  PRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGEMATYIPV 139

Query: 121 -DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITI 179
              F+ ++ R+  PA G A GY Y F + I    +L+    ++QYW    KV    WI+I
Sbjct: 140 TSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTF--KVPVAAWISI 197

Query: 180 FLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDP 239
           F V+I  +N            W++  KV+ ++  I+  F+++ G G +   +GFR+++  
Sbjct: 198 FWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKTGP-VGFRYWRHG 256

Query: 240 GAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLY 299
            AF     + + ++ +F+ +V+  + A F Y GTEL GI A E  NPR+ VP++IK TL+
Sbjct: 257 YAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIKRTLW 316

Query: 300 RIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVL 359
           RI++FY+ ++  +G+ V +ND  L             PF++AIKN+G   LP IFNA +L
Sbjct: 317 RILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASS---PFILAIKNSGTKALPDIFNAVIL 373

Query: 360 MFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSS 419
             V SA NSD+YV SR +Y +A +  AP I AK +K GVPY +++       LAY+  SS
Sbjct: 374 TTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLETSS 433

Query: 420 GSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFAL 479
             A VFN+ +N+  + G  SW  I  +++ F +AL+ +G+ ++ L + A      A ++ 
Sbjct: 434 SGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIYSF 493

Query: 480 FFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLY 538
           FF  LI L++ FT F  H F   +F+  YI + +F + +  ++ + R    V   E D+ 
Sbjct: 494 FFMTLIILVQGFTCFTPH-FQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDID 552

Query: 539 TFKELIDLE----EEEGKLWD 555
           T +  +D E    E    LWD
Sbjct: 553 TDRRDVDAEVWEDEPPKTLWD 573

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  300 bits (769), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 192/565 (33%), Positives = 292/565 (51%), Gaps = 33/565 (5%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHV 64
           Q   R D  ++   SN T       + S +DD          +G     ++K+ L+ RHV
Sbjct: 14  QGKTRSDEFQMYVYSNETQNGGSGHNSSFEDD----------EGDLQEGQVKRALKPRHV 63

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGF 123
           SM                       PV  LIAY F+G +VY V   +GEMAT+IP+    
Sbjct: 64  SMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMATFIPVTSSI 123

Query: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183
           T +++R+  PA G A GY Y F + I    +++    V+QYW   + V    WI IF V 
Sbjct: 124 TVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWT--KAVPLAAWIGIFWVA 181

Query: 184 IVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243
           I   N            W++S KV+ ++  ++   +I+ GG      +GFR++++PG   
Sbjct: 182 ITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS-KQGPIGFRYWRNPG--- 237

Query: 244 PYSEAI-SGSK--GKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYR 300
           P+ + I SG K  G+F+ +VA  + A F Y GTEL GI A E  NPR+ VP+AI    +R
Sbjct: 238 PWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFR 297

Query: 301 IVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLM 360
           I+ FY++++F +G+ V YN P L +           PFV++I++AG  +LP IFNA VL+
Sbjct: 298 ILFFYILSLFFVGLLVPYNHPGLDKHTSVIASS---PFVISIQSAGTRILPDIFNAVVLV 354

Query: 361 FVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSG 420
            + SA NS++YV SR L+ LA    APK F+     GVPY  +I   L  LLA++ V   
Sbjct: 355 TIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDN 414

Query: 421 SAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALF 480
           + + FN+ +N+ ++ GL +W+ I I++I F + L+ +G+ +  L + + L   GAY+A F
Sbjct: 415 ANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAF 474

Query: 481 FCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICF-FGYKYIRGTKFVKPEEADLYT 539
           +  +I  ++ F  F   KF    F TGYI + +  + F     Y R   F + E+ D+ +
Sbjct: 475 WVAVIIFVQGFQAFC-PKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNRLEDIDIDS 533

Query: 540 FKELID---LEEEE-----GKLWDA 556
            +  ID    EEEE     GK W A
Sbjct: 534 DRREIDALIWEEEEPTTLWGKFWVA 558

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  301 bits (770), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 186/569 (32%), Positives = 298/569 (52%), Gaps = 33/569 (5%)

Query: 7   SYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNI----------DGKHDGIRLK 56
           S RK + +  +NSN+      +L+ S  D  +      N           +G      +K
Sbjct: 45  SKRKRINRSRANSNS------DLEGSAADGTARARDIDNADVDDDDYYMDEGVVKEAEVK 98

Query: 57  KELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMAT 116
           ++L+ RH+ M                       PV  LIAY F+  +V+ V   LGEMAT
Sbjct: 99  RQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGEMAT 158

Query: 117 YIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGV 175
           +IP+   FT ++SR+  PA+G A GY Y F + +    +L+    ++Q+W     V    
Sbjct: 159 FIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWT--HAVPLSA 216

Query: 176 WITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRF 235
           WI I+ VI+  +N            W++S KVL ++  ++    ++ G G +   +GFR+
Sbjct: 217 WIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGP-VGFRY 275

Query: 236 YKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIK 295
           +++PG + P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ VPRAIK
Sbjct: 276 WRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 335

Query: 296 LTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFN 355
              +RI++FY++++F +G+ V Y+D  L             PF++AI+N+G  +LPHIFN
Sbjct: 336 KVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISAS---PFIIAIENSGTKILPHIFN 392

Query: 356 ACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYM 415
           A +L  + SA NS++YV SR L+GLA    APK F  T++ GVPY S+     F  LA++
Sbjct: 393 AVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAFL 452

Query: 416 NVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGA 475
            VSSG A+ FN+ +N++S+ G  +W+ I I ++ F +AL+ +G+ +  L + A      A
Sbjct: 453 EVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHLA 512

Query: 476 YFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGI-PVFIICFFGYKYIRGTKFVKPEE 534
           Y+++FF  +I +I+ FT F    F+  +F+  YI I   F +      Y R       EE
Sbjct: 513 YYSIFFMTIIIIIQGFTAF-APTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEE 571

Query: 535 ADLYTFKELID--LEEEEG------KLWD 555
            D+ T +  +D  + E+ G      K WD
Sbjct: 572 VDIDTDRRDVDAIIWEDSGPKTFWDKFWD 600

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  300 bits (768), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 196/595 (32%), Positives = 305/595 (51%), Gaps = 36/595 (6%)

Query: 1   MSFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELE 60
           MS +QD        +V   +  +  V  LDL++  + S +   L    +     LKK L+
Sbjct: 1   MSNLQDLKDAGETSVV---DKQTGQVYELDLTSYSNDSEKNGSLPNKPQSGDHNLKKGLK 57

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
           + H+ +                       P  + I+Y  +  ++Y VM  L EM  ++P 
Sbjct: 58  SAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPG 117

Query: 121 --------DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172
                      ++  +RY D +LGFAVG++Y++ Y+I+   + TAA+ V+ YW +   V 
Sbjct: 118 LPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTT--AVP 175

Query: 173 PGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232
              WITIFL IIV +N               S K+  +L +I++  V+  GGGP+HDRLG
Sbjct: 176 KAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLG 235

Query: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVP 291
           FRF+KDPGA+  Y  A  G  G+    +   + A FA+ LG EL  + + E ++ RRN+ 
Sbjct: 236 FRFWKDPGAW-AYHLA-DGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIE 293

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVL 350
           +A +  ++R++ FY V+    G+ V+ NDP+LL             PFV+ I+NAGI VL
Sbjct: 294 KAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVL 353

Query: 351 PHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFC 410
           PHI N C+L   +S+ NS +Y  +RSL  L+ +  APKIF + N+WGVPY  +     F 
Sbjct: 354 PHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFS 413

Query: 411 LLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGV-DKSTLAYAAP 469
            LAY+NVSS +A VFN+F N+ +I G + WI   + Y+ F +A+    + D+  L +  P
Sbjct: 414 CLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNLYDR--LPFKTP 471

Query: 470 LASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIR--G 526
                 +F +    +I LI  +  F+   ++YK+FI  YI +P+F+I + G+K Y R   
Sbjct: 472 FQPYFTWFYIILIAIICLINGYESFV--HWNYKDFIAAYITLPLFLILWLGHKAYTRTWS 529

Query: 527 TKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581
              +   E D+ T   L ++EEE  +L            P+N    +EK L W+F
Sbjct: 530 QWMISVSEIDVTT--GLREIEEETKEL------NARRIPPRN---LWEKILEWLF 573

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  301 bits (770), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 186/562 (33%), Positives = 296/562 (52%), Gaps = 27/562 (4%)

Query: 9   RKDLEKIVSNSNTTSKDVENLDLSNQDDIS-SQESHLNIDG--------KHDGIRLKKEL 59
            KD +KI +++N  S D+ ++     D ++ S+  HL  D         ++    +K+ L
Sbjct: 51  EKDKKKI-AHTNQFSSDIHSI----TDSLARSRLPHLGDDDDEEDAEEAQYHDTEVKRAL 105

Query: 60  EARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP 119
           + RH+ M                       PV  LIAY F+G ++Y +   LGEMAT+IP
Sbjct: 106 KQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGEMATFIP 165

Query: 120 L-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
           +    T ++ R+  PA G A GY Y F + I    +++    V++YW   +KV    WI 
Sbjct: 166 VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWT--KKVPLAAWIA 223

Query: 179 IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           IF V +  +N            W++  KVL +   ++   +I+ GG  S   +GFR++++
Sbjct: 224 IFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-SQGPIGFRYWRN 282

Query: 239 PGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTL 298
           PG +     +   +  +F+ +V+  + A F Y GTEL GI A E  NPR++VPRAI   +
Sbjct: 283 PGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVV 342

Query: 299 YRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 358
           +RI +FY++++F +G+ V Y+DP L             PFV++I+NAG  +LP IFNA V
Sbjct: 343 FRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASS---PFVISIQNAGTKILPDIFNAIV 399

Query: 359 LMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVS 418
           ++ V SA NS++YV SR LY LA    APK FA   + GVPY  ++      LLA++ V+
Sbjct: 400 MITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFLVVN 459

Query: 419 SGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFA 478
           + +   FN+ +N+ ++ GL +W+ I I++I F +AL+ +G+ +  L + A      AY+A
Sbjct: 460 NNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAAYYA 519

Query: 479 LFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADL 537
            FF  +I  I+ F  F  H FD   F T YI + +  + F G + Y R   F K E+ D+
Sbjct: 520 TFFVTVIIFIQGFQAFSPH-FDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDIDI 578

Query: 538 YT----FKELIDLEEEEGKLWD 555
            T     +E+I  ++E    WD
Sbjct: 579 DTDRREIEEVIWEDDEPKTYWD 600

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  298 bits (764), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 193/559 (34%), Positives = 291/559 (52%), Gaps = 22/559 (3%)

Query: 10  KDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXX 69
           +D EK+   +     DVE+ D+ + D+   Q    N     D  +LK+ L+ RH+ M   
Sbjct: 6   QDKEKV--KATAYEADVEDCDIRSTDETLKQGVLHN-----DRTKLKQGLKERHIKMLTL 58

Query: 70  XXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFT-SYAS 128
                               PV +LIAY FVG +V      + E+A+++P  G T  +A 
Sbjct: 59  VGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAE 118

Query: 129 RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTIN 188
           ++ D ++GF  G+  +  Y  + P +L+A A++++YW     ++P V+ITIF V+ V  N
Sbjct: 119 QFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---ISPAVFITIFGVLFVVTN 173

Query: 189 XXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEA 248
                            K++++  LI+   VI LGG    +RLGF +++DPG F  Y   
Sbjct: 174 IYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEY--I 231

Query: 249 ISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVT 308
           + GS GKFV F +     +++Y G +   I+A E KN R  +    K    RI+V YLVT
Sbjct: 232 VGGSIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLVT 291

Query: 309 IFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNS 368
           +F+L + V YND L+             PFV+A+  AGI VLPHI NA VL   +SA N 
Sbjct: 292 VFVLTLIVPYNDALIASGTGTAKSS---PFVIAMNRAGIKVLPHIVNALVLTSAWSAGNL 348

Query: 369 DLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYF 428
            +   SR+L+ LA  N+APKIF KT+K G+PY  +I    F  LAYM+ S  S+ VF +F
Sbjct: 349 AIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWF 408

Query: 429 VNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALI 488
             +VS   L+ WI I   +IY DRAL+AQG  +S L Y+ P+A   A+F+     +  L 
Sbjct: 409 QELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLT 468

Query: 489 KNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYT----FKELI 544
             F  F+   FD ++F T Y  IP+ I  F  +K  + T++++PEE DL +     +E  
Sbjct: 469 GGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRYLRPEEVDLASIFDDIRENP 528

Query: 545 DLEEEEGKLWDAAQKEKME 563
           +  E+   +W     +K+E
Sbjct: 529 EHIEKSKPIWARLLVKKVE 547

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  300 bits (768), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 179/573 (31%), Positives = 306/573 (53%), Gaps = 35/573 (6%)

Query: 5   QDSYRKDLEKIVSNSNTTSK-----DVENLDLS----NQDDISSQESHLNIDGKHDGIRL 55
             S R + E +  NS+   +      + N DLS    N ++    E  +N DG+ +  +L
Sbjct: 45  NSSLRIEKETLTFNSSKLEECKIEDKISNFDLSQIGYNGNETIISEELINEDGRKN--KL 102

Query: 56  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA 115
           K+ L ARH+ +                       P  ++ +Y  +  +VY +M  LGEM 
Sbjct: 103 KQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNVLGEMV 162

Query: 116 TYIPLDGFTSYAS------RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSRE 169
            Y+P DG  S  S      RY D +L FA G++Y + ++++   + TAA+ V++YW    
Sbjct: 163 CYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEYWT--- 219

Query: 170 KVNPG-VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSH 228
           KV P   WI +F +II  +N            W +  K+L ++ LI+L F++  GGGP+H
Sbjct: 220 KVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGGGPNH 279

Query: 229 DRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPR 287
           DRLGFR++  PG+F   +   +GS G F+      +   F++ LG EL  + ++EC +PR
Sbjct: 280 DRLGFRYWITPGSFA--NTITNGSFGNFLDVYKGIILGAFSFILGPELVVLPSSECSDPR 337

Query: 288 RNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAG 346
           RN+ +A K  ++R++ FY++    + + V+YNDP+L              PFV+ I+NAG
Sbjct: 338 RNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGIQNAG 397

Query: 347 IPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILC 406
           I VLPHI N C+L+  +S+ N+ L+ +SRSL  +AI+++APK   K N++GVPY ++I+ 
Sbjct: 398 IDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVAVIVS 457

Query: 407 ILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAY 466
           I+   +AY+N S  ++ VF +F N+ +I G + WI + +TY+ F +A+   G+ K  L Y
Sbjct: 458 IILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM-KDRLPY 516

Query: 467 AAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK---- 522
                     ++L    +I +   F + +   ++  +FI  Y+ +P+F++ + G+K    
Sbjct: 517 TTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIGHKFYKY 576

Query: 523 ----YIRGTK-FVKPEEADLYTFKELIDLEEEE 550
               + R  + + + E+ D+ T  E I++E E+
Sbjct: 577 RFKIFTRQCRWWYQVEDIDVITGLEEIEMESEK 609

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  297 bits (760), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 187/552 (33%), Positives = 280/552 (50%), Gaps = 19/552 (3%)

Query: 1   MSFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKH-DGIRLKKEL 59
           MS I D      EK+          +   D+  + DI S E  +     H D  +LK+ L
Sbjct: 1   MSEIGDESTNSQEKV-------KPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTKLKQGL 53

Query: 60  EARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP 119
           + RH+ M                       PV +LIAY FVG +V      + E+A+++P
Sbjct: 54  KERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMP 113

Query: 120 LDGFT-SYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
             G T  +A ++ D ++GF  G+  +  Y  + P +L+A A++++YW     V+P V+IT
Sbjct: 114 ATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---VSPAVFIT 168

Query: 179 IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           +F ++ V  N                 K++++  LI+   VI LGG    +RLGF ++++
Sbjct: 169 VFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWRE 228

Query: 239 PGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTL 298
           PG F  Y   + G  GKFV F A     +++Y G +   I+A E KN R  +    K   
Sbjct: 229 PGPFANY--LVGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVF 286

Query: 299 YRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 358
            RI+V YLVT+F+L + V YND L+             PFV+A+  AGI VLPHI NA +
Sbjct: 287 LRIIVLYLVTVFILTLIVPYNDKLI---ATGTGTARSSPFVIAMNRAGIKVLPHIVNALI 343

Query: 359 LMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVS 418
           L   +SA N  +   SR+L+ LA  N+APKIF +T+K G+PY  +I    F  LAYM+ S
Sbjct: 344 LTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCS 403

Query: 419 SGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFA 478
             SA VF +F  +VS   L+ WI I   +I+ DRAL+AQG  +S L Y+ P+    A+F+
Sbjct: 404 KSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFS 463

Query: 479 LFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLY 538
                +  L   F  F+   FD ++F T Y  IP+ I  F  +K  + TK+++P E DL 
Sbjct: 464 GIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYLRPHEVDLE 523

Query: 539 TFKELIDLEEEE 550
           +  + I    E 
Sbjct: 524 SIFDDIKENPEH 535

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  295 bits (756), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 183/578 (31%), Positives = 302/578 (52%), Gaps = 32/578 (5%)

Query: 1   MSFIQDSYRKDLE---KIV--SNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRL 55
           MS +  +  + LE   KIV  S  +    D++  +  N    +  + +++ + K +   +
Sbjct: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEV 60

Query: 56  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA 115
           K++L  RH++M                       PV  LIAY F+G +VY V   LGEMA
Sbjct: 61  KRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA 120

Query: 116 TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174
           T+IP+   FT ++ R+  PALG A GY Y F + +    +L+    ++Q+W     V   
Sbjct: 121 TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF--AVPLP 178

Query: 175 VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFR 234
            WI+IF VI+   N            W++  KV  +L  I+  F I+ G G +   +GFR
Sbjct: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFR 237

Query: 235 FYKDPGAFRPYSEAISGS---KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVP 291
           ++++PG   P+   I  S   + +F+ + +  + A F + GTEL GI A E  NPR+ VP
Sbjct: 238 YWRNPG---PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVP 294

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
           +AI+  ++RI+VFY++++F +G+ V Y+D   ++           PF++AI+N+G  +LP
Sbjct: 295 KAIRKVVFRILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFIIAIENSGTKILP 351

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
           HIFN  +L+ + SA NS++Y+ SR L+GLA +   PK+FAKT K GVP  +++   LF  
Sbjct: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           LA+M  S+G  + F + +NVV + G  SW+ I   +I F + L+++G+ ++ L + A   
Sbjct: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471

Query: 472 SKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV- 530
              AY+A     +I   + FT F   KFD  NF   YI + +F I +  ++     ++V 
Sbjct: 472 PYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVW 530

Query: 531 KPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKN 568
           K  + D+       D  E E ++W        +++P N
Sbjct: 531 KLVDIDIDK-----DRREIEDRVWQ-------DTTPAN 556

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  293 bits (751), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 174/521 (33%), Positives = 276/521 (52%), Gaps = 33/521 (6%)

Query: 20  NTTSKDVENL-DLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXX 78
           N  + +VE+L +  NQ D+                  K+EL+ RHV+M            
Sbjct: 31  NHNTSEVESLCEKPNQSDV------------------KRELKPRHVTMISLGGTIGTGLF 72

Query: 79  XXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGF 137
                      PV  L+AY FV  + Y V   LGEMAT+IP+   FT +ASR+  PALG 
Sbjct: 73  IGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGA 132

Query: 138 AVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXX 197
           A GY Y   + I    +++    ++ YW   + V    W+ IF V++  IN         
Sbjct: 133 ANGYLYWLSWCITFALEISVIGRLILYW--SDAVPITAWMAIFWVLLTAINLIPVKFYGE 190

Query: 198 XXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSK---G 254
              W++S KV+ +LC +    V++ GG     R+GFR++KDPG   P+   I   +    
Sbjct: 191 FEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPG---PWGVGIVSQEIHTA 246

Query: 255 KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGM 314
           +F+ +V+  + A F + GTEL G+ A E KNPRR VP+AI    +RI++FY+ ++ ++G+
Sbjct: 247 QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGL 306

Query: 315 TVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVAS 374
            V Y+DP L+Q           PFVVAI  AG  VLP I N  +++ + SA NS++YV S
Sbjct: 307 LVRYDDPQLIQDGSTTNANAS-PFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGS 365

Query: 375 RSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSI 434
           R LYGL     AP   ++T   GVPY +++   +F  L Y+NVSS S  VF++ +++ ++
Sbjct: 366 RVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAV 425

Query: 435 FGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVF 494
            G  +W+ I +++I F + L+ +G+ +  L + A     GAY+A FF  +I L++ FT F
Sbjct: 426 SGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF 485

Query: 495 LGHKFDYKNFITGYIGIPVFIICFFGYKYI-RGTKFVKPEE 534
               F   +F+  YI   +F++ +  ++++ +G  F   +E
Sbjct: 486 --TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVDE 524

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  294 bits (752), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 185/558 (33%), Positives = 285/558 (51%), Gaps = 13/558 (2%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           I+  +  D   +   S      +E  D+    ++         +G      +K+ L+ RH
Sbjct: 22  IKGMFSTDSGTLSKRSKAGEDSIELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRH 81

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DG 122
           VSM                       PV  LIAY F+G +VY V   LGEMAT+IP+   
Sbjct: 82  VSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSS 141

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182
            T ++ R+  PA G A GY Y F + I    +L+    ++ YW   + V    WI IF V
Sbjct: 142 ITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWT--DAVPLAAWIAIFWV 199

Query: 183 IIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAF 242
           ++   N             ++S KV+ ++  ++   +I+ GG  S   +GFR++++PG +
Sbjct: 200 LLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS-SQGPIGFRYWRNPGPW 258

Query: 243 RPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302
              + A + +K +F+ +V   V A F Y GTEL GI A E  NPR+ VP+AI    +RI+
Sbjct: 259 GTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRIL 318

Query: 303 VFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFV 362
           VFY+ ++F +G+ V YN P   Q           PFV++I+NAG  VLP IFNA VL+ +
Sbjct: 319 VFYIGSLFFVGLLVPYNSP---QLESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTI 375

Query: 363 FSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSA 422
            SA NS++YV SR LY LA+   APK F+   K GVPY  +I   L  LLA++  +  + 
Sbjct: 376 LSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENAN 435

Query: 423 QVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFC 482
             FN+ +N+ ++ GL +W  I + +I F + L+ +G+ + +L + A L   GAY+A FF 
Sbjct: 436 TAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFV 495

Query: 483 CLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFK 541
            LI  I+ FT F   +FD   F T YI + + ++ F   + Y R     K E+ D+ + +
Sbjct: 496 GLIVFIQGFTAF-APRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDR 554

Query: 542 ELIDL----EEEEGKLWD 555
             ID     ++E   LW+
Sbjct: 555 REIDAIIWEDDEPKNLWE 572

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  291 bits (744), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 164/477 (34%), Positives = 272/477 (57%), Gaps = 14/477 (2%)

Query: 90  PVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYL 148
           PV  LI+Y F+G ++Y V   LGEMAT+IP+   F+ +A R+  PALG   GY Y   + 
Sbjct: 25  PVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 84

Query: 149 IITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVL 208
                +L+    ++QYW   + V    WI IF  ++  +N             ++S KV+
Sbjct: 85  FTFALELSVLGQIIQYWT--DAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVI 142

Query: 209 VMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALF 268
            +L  I+  F ++ G G     +GFR++++PGA+ P   +   ++G+F+ +V+  + A F
Sbjct: 143 ALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 202

Query: 269 AYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXX 328
            Y GTEL GI A E  NPR+ VPRAIK  + RI+VFY++++F +G+ V YNDP L     
Sbjct: 203 TYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL---DS 259

Query: 329 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPK 388
                   PF+++I+N+G  VLP IFNA VL+ + SA NS++Y+ SR LY L+ ++ AP+
Sbjct: 260 DGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAPR 319

Query: 389 IFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYI 448
             +   K GVPY +++   +F  LA++  S+GS + FN+ +N+  + G  +W+ I  ++I
Sbjct: 320 FLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 379

Query: 449 YFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGY 508
            F +A+  +G+ ++ L Y A +    AY+A FF  LI LI+ FT F    F   +F+  Y
Sbjct: 380 RFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVDFVAAY 438

Query: 509 IGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKELIDLEEEEGKLW-DAAQKEKME 563
           I + +F+  +F ++ + +    +K ++ D+ +     D  E E ++W +  +K K +
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDS-----DRREIEEQVWIEPLRKTKWQ 490

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  292 bits (748), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 185/537 (34%), Positives = 277/537 (51%), Gaps = 19/537 (3%)

Query: 24  KDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXX 83
           K+     + +  D  SQ S L+I+ +  GI   + L++RHV +                 
Sbjct: 22  KEKTQFSIHSTGDEVSQGSVLDIESQKPGI--VRGLKSRHVQLIALGSAIGTGLFIGSGG 79

Query: 84  XXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYASR---YCDPALGFAVG 140
                 P  +LIAY+ +   V+ VM  + EM T IPL G ++  S    Y +  L F  G
Sbjct: 80  ALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCG 139

Query: 141 YSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXX 200
           ++  +   +I P ++TA AL++QYW      NP ++I+IFLV+ V I             
Sbjct: 140 WNLFYAQAMIAPAEVTACALLVQYWT---DANPAIFISIFLVLSVAITMLPVKVFGESEF 196

Query: 201 WLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-LGFRFYKDPGAFRPYSEAISGSKGKFVSF 259
           W+SS K+L ++ LI++  VI  GGGP+ +  LGF ++K PGAF+PY   + G  GKF++F
Sbjct: 197 WVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPY--LVEGGTGKFLAF 254

Query: 260 VAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAY 318
               + + F++ L  E+    AAE   PRRN+PRA K  +YR+ +FY+  I ++G+ V Y
Sbjct: 255 WTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGY 314

Query: 319 -NDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSL 377
            ND LL             PFV+ IK AGI VLPHI NA +L   +S     LY ASR+L
Sbjct: 315 DNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTL 374

Query: 378 YGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 437
           + +A    AP+I    NK+GVPY    +  LFCLLAY+N S+ S+ VFN+  N+ +I G 
Sbjct: 375 HSMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGF 434

Query: 438 MSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGH 497
           +SW+ + I YI F   +    ++   + +  P     AY A+ F  ++ L   F VF+  
Sbjct: 435 VSWVLVSIAYIRFRNVIDVLKLNDR-IPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKG 493

Query: 498 KFDYKNFITGYIGIPVFIICFFG----YKYIRGTKFVKPEEADLYTFKELIDLEEEE 550
            +D  NF   YI +   ++ F G    YK  R     + E+ D+     L + EE E
Sbjct: 494 NWDTSNFFAAYITLGFVLVLFVGSTIYYKEWRCRDIAEIEQ-DILPKITLAEAEEYE 549

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  288 bits (737), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 177/559 (31%), Positives = 285/559 (50%), Gaps = 23/559 (4%)

Query: 13  EKIVSNSNTTSKDVE-NLDLSNQDDISS--------QESHLNIDGKHDGIRLKKELEARH 63
           +  VS ++T S+ ++    L N  ++ S         E H   +G +    +K+ L+ARH
Sbjct: 5   DTAVSETSTRSRYIKKGKTLENDIELQSVTPATGEFPEDHTE-EGDYQETEVKRALKARH 63

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DG 122
           +SM                       PV  L+AY F+G +VY +   LGEMAT+IP+   
Sbjct: 64  ISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSS 123

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182
            T ++ R+  PA G A GY Y F + I    +L+    ++QYW  R  +    WI IF V
Sbjct: 124 VTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPI--AAWIVIFWV 181

Query: 183 IIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD-PGA 241
           ++  +N            W++S KVL ++  ++  F+I+ GG      +G       P  
Sbjct: 182 LVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGS-KQGPIGLPATGGIPAR 240

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
               S   +  +  F+ +V+  + A F Y GTEL GI A E  NPR+NVP+AI    +RI
Sbjct: 241 GARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRI 300

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
           + FY+ ++  +G+ V Y+DP L             PFV++IKNAG  +LP IFNA VL+ 
Sbjct: 301 LFFYIGSLLFVGLLVPYDDPRL--NSESSTDVNASPFVISIKNAGTKILPDIFNAVVLIT 358

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
           V SA NS++Y+ SR  Y LA+   APK  A   K GVPY  +++  L  L++++ ++  +
Sbjct: 359 VISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNA 418

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
           +  F++ VN+ ++ GL +W+ I + +I F + L+ +G+ +  L + A      AY+A FF
Sbjct: 419 STAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFF 478

Query: 482 CCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTF 540
             +I  I+ +T F   KFD   F T YI + + ++ F G +     +F+   E+ D+ + 
Sbjct: 479 VTVIIFIQGYTAFT-PKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSD 537

Query: 541 KELIDL----EEEEGKLWD 555
           +  ID     E+E   +WD
Sbjct: 538 RREIDAIVWEEDEPKNIWD 556

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  288 bits (738), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 167/496 (33%), Positives = 272/496 (54%), Gaps = 10/496 (2%)

Query: 33  NQDDISSQESHLNID-GKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPV 91
               +S  E    +D G      +K+EL+ RH+ M                       PV
Sbjct: 66  GSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPV 125

Query: 92  SILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLII 150
             LIAY F+  +V+ V   LGEMAT+IP+   FT ++SR+  P++G A GY Y F + I 
Sbjct: 126 GSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAIT 185

Query: 151 TPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVM 210
              +L+    ++Q+W   + V    WI I+  I+  +N            W++S KV+ +
Sbjct: 186 FALELSVVGQIIQFWT--DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAI 243

Query: 211 LCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY 270
           +  ++    ++ G G +   +GFR++++PG + P   +   ++G+F+ +V+  + A F Y
Sbjct: 244 MGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY 302

Query: 271 LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXX 330
            GTEL GI A E  NPR+ VPRAIK   +RI++FY++++F +G+ V ++DP L       
Sbjct: 303 QGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYV 362

Query: 331 XXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIF 390
                 PF++AI+N+G  VLPHIFNA +L  + SA NS++YV SR ++GLA    AP+ F
Sbjct: 363 SSS---PFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWF 419

Query: 391 AKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYF 450
             T K GVPY +++    F  LA++ VSSG A+ FN+ +N+V + G  +W+ I I ++ F
Sbjct: 420 GITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRF 479

Query: 451 DRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIG 510
            + L  +G+ +  L + A L    AY+A+FF  +I +I+ FT F    F+  +F+  YI 
Sbjct: 480 IQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAF-APTFNGSDFVAAYIS 538

Query: 511 IPVFIICFFGYK-YIR 525
           + +F   +  ++ Y R
Sbjct: 539 VFLFFFLWVSFQLYFR 554

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  283 bits (725), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 177/539 (32%), Positives = 282/539 (52%), Gaps = 16/539 (2%)

Query: 14  KIVSNSNTTSKDV--ENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXX 71
           K V +S+ T + V  +  ++  ++ ++  E+       +D  +LK+ L+ARH+ M     
Sbjct: 3   KTVKSSSLTKEKVAIDEAEVQLEEGVTLDETIKQGVLHNDRTKLKQGLKARHIKMLTLVG 62

Query: 72  XXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFT-SYASRY 130
                             PV +LIAY  VG +V      + E+A+++P  G T  ++ ++
Sbjct: 63  VFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQF 122

Query: 131 CDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXX 190
            D A+GF  G+  +  Y  + P +L+A A+V+ YW     ++P ++ITIF V+ +  N  
Sbjct: 123 IDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYWTD---LSPAIFITIFGVLFILTNIY 177

Query: 191 XXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAIS 250
                     +    K+ ++  LI+   VI LGG    +RLGF ++++PG F  Y   + 
Sbjct: 178 TIRFYGEIEYFFGWLKLALIAILIITGLVIDLGG-TKQERLGFHYWRNPGPFAEY--LVG 234

Query: 251 GSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIF 310
           G  GKFV F A     +++Y G +   I+A E KN R  +    K    RI++ YL+T+F
Sbjct: 235 GDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVF 294

Query: 311 LLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDL 370
           +L + V YND L+             PFV+A++ AGI VLPHI NA +L   +SA N  +
Sbjct: 295 VLTLIVPYNDKLI---ATGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAI 351

Query: 371 YVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVN 430
              SR+L+ LA  N+APKIF KT+K G+P+  ++    F  LAYM+ S  SA VF++F  
Sbjct: 352 IEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQE 411

Query: 431 VVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKN 490
           +VS   L+ WI I   +I+ DRALRAQG  +  L Y+  +A   A+F+     +  L   
Sbjct: 412 LVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGG 471

Query: 491 FTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEE 549
           F  F+   FD ++F + Y  IP+ I  F  +K  + T++++P E DL +  E  D+ E 
Sbjct: 472 FYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYLRPHEVDLQSIFE--DIREN 528

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  285 bits (729), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 178/566 (31%), Positives = 291/566 (51%), Gaps = 25/566 (4%)

Query: 14  KIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXX 73
            + S     +  +++  L N+D   SQ   L+++ +      +++L  R VSM       
Sbjct: 82  NVTSLEEGETATIDDFVLQNRDSPKSQS--LSLEER----IARRKLLPRQVSMIGIGGAI 135

Query: 74  XXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCD 132
                           P S+LIA+     +   +  C+  M TY+P+ G F  +  R+ D
Sbjct: 136 GTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVD 195

Query: 133 PALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXX 192
            + GFAVG++Y          ++TA  LV++YW   +K+     I++ +++  ++N    
Sbjct: 196 QSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWT--DKIPKAALISMLIILFGSLNLYSV 253

Query: 193 XXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGS 252
                   +LS  KV++ + LI+   V+M GG P H  LGF+ + +PGAF  Y     GS
Sbjct: 254 FFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYIS--DGS 311

Query: 253 KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLL 312
            G+F  F++  V+AL+ + G +  G  A+E  NPR+ +P + +    R+++FY+     +
Sbjct: 312 VGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICV 371

Query: 313 GMTVAYNDPLLLQXXXXXXXXX-XXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLY 371
           G+ + YNDP +++            P+V A+K  GI VLPHI N  +L  + SA NS LY
Sbjct: 372 GILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLY 431

Query: 372 VASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNV 431
            ASR L+ LA+DN+AP+IF  T K GVP    I  ++ C LAY++VS+ +  V  +F+NV
Sbjct: 432 SASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNV 491

Query: 432 VSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNF 491
            +    + +I I ++Y+ F +   AQ VD  +L Y +      A+ +LF+  L+ L+  +
Sbjct: 492 ETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGY 551

Query: 492 TVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYT-FKELIDLEEEE 550
           TVFL   +D ++F+  Y  IP F++  FG+K  +GTK V+P E DL+T  +EL D    E
Sbjct: 552 TVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPLEMDLFTGIEELAD----E 607

Query: 551 GKLWDAAQKEKMESSPKNFKWFYEKF 576
            + W          +P    WF   F
Sbjct: 608 DRYW--------AENPPTLNWFDRAF 625

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  277 bits (709), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 166/525 (31%), Positives = 273/525 (52%), Gaps = 15/525 (2%)

Query: 33  NQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVS 92
            +DD+      + ID K    ++++ L++RH+ +                       P  
Sbjct: 38  QEDDLERGSIDVLIDEKPSH-QMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAP 96

Query: 93  ILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSY---ASRYCDPALGFAVGYSYLFKYLI 149
           +LI+Y  + F V+ +M  L EM    P+ G  S    A  Y +  L F  G++  +   +
Sbjct: 97  LLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAM 156

Query: 150 ITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLV 209
           I P+++TA+ L++QYW      N  ++++IF+VI + +             W+S  K++ 
Sbjct: 157 IAPSEITASTLLIQYWT---DANSAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLIT 213

Query: 210 MLCLIVLLFVIMLGGGPS-HDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALF 268
           +  LI+L  VI  GGGP+ H  LGF ++K PGAF+P+    +G+ GKF++     + + F
Sbjct: 214 ITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHIS--TGNTGKFLAVWTAIIKSGF 271

Query: 269 AY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAY-NDPLLLQX 326
           A+ L  E     +AE   PRRN+PRA    ++R+++FY+    ++G+TV Y N  LL   
Sbjct: 272 AFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAI 331

Query: 327 XXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKA 386
                     PFV+ IK  GI VLPHI NA +L   +SA  +++Y ASR L+ +A+   A
Sbjct: 332 ASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNA 391

Query: 387 PKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILIT 446
           PKIFA+ N++GVPY S+I+   FC LAY+N S+ ++QVF +  N+ +I G +SW+ + IT
Sbjct: 392 PKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSIT 451

Query: 447 YIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFIT 506
           Y+ F R +    ++   + +  P     AYF+  F  +++L   + VF    +   +F  
Sbjct: 452 YVRFRRVIDYLDLNDR-IKFRKPFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFA 510

Query: 507 GYIGIPVFIICF-FGYKYIRGTKFVKPEEADLYTFKELIDLEEEE 550
            YI I   ++ F  G  Y +  +F   EE       + ID+ +EE
Sbjct: 511 NYITIGFVVVLFIMGTAYYKEWRFRDMEEIRSELIPK-IDMADEE 554

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  277 bits (708), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 174/566 (30%), Positives = 290/566 (51%), Gaps = 28/566 (4%)

Query: 16  VSNSNTTSKDVENLDLSNQDDI---SSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXX 72
           +S S   S  ++    S+ +D+   S Q S+ +I+      ++ + L+ RH+ +      
Sbjct: 13  ISLSPYISNRIKEQAFSSVNDVIGDSDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSA 72

Query: 73  XXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG---FTSYASR 129
                            P  +LIAY  + F V+ +M  + EM   IPL G     S A  
Sbjct: 73  IGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKT 132

Query: 130 YCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINX 189
           Y +  + F  G++  +   +I P ++TA AL++QYW      N  ++I+IF+V+ + +  
Sbjct: 133 YLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWT---DANSAIFISIFIVVSILLTM 189

Query: 190 XXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-LGFRFYKDPGAFRPYSEA 248
                      W+SS K+L ++ LI++  VI  GGGP+ D  LGF ++K+PGAF P+   
Sbjct: 190 LPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLA- 248

Query: 249 ISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLV 307
             G+ G+F++     + + F++ L  E     +AEC  PRRN+P+A +  +YR+ +FY+V
Sbjct: 249 -EGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIV 307

Query: 308 TIFLLGMTVAYN-DPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366
              ++G+ V +N D L+             PFV+ I+ AGI +LPHI NAC+L   +S  
Sbjct: 308 GTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHIINACILTSAYSCG 367

Query: 367 NSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFN 426
              LY +SR+LY +A+   APKIFAK N++G PY S  L  LF  LAY+N S  ++ VFN
Sbjct: 368 TGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFN 427

Query: 427 YFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIA 486
           +  N+ +I G +SWI + +TYI F + + A  ++   + +  P     AY    F  +++
Sbjct: 428 WLSNIATISGFVSWIFVSMTYIRFRKVINALDLNDR-VPFRRPFQVPLAYLTCGFFFILS 486

Query: 487 LIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDL 546
           L   + VF+   ++  +F   Y+      I F  + Y+ G+ + K      +TF++  ++
Sbjct: 487 LTNGYAVFVKGNWNVSDFFASYV-----TIGFVIFLYLVGSFYYKQ-----WTFRDFKEI 536

Query: 547 EEEEGKLWDAAQKEKMES---SPKNF 569
           E E     D A +E+       P+NF
Sbjct: 537 EVEILPKIDIADEEERNDVIPVPRNF 562

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  268 bits (686), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 178/543 (32%), Positives = 279/543 (51%), Gaps = 14/543 (2%)

Query: 10  KDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGK--HDGIRLKKELEARHVSMX 67
            + E++ S     ++ V+  +    D +  Q ++   +G   +D  RLK+ L+ RH+ M 
Sbjct: 3   NEKEELPSGELKKTEAVQVCETYEADSVEPQNANEPEEGVLYNDRTRLKQGLKERHIKML 62

Query: 68  XXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFT-SY 126
                                 P  + +AY  VG +V      + E+A+++P  G T  +
Sbjct: 63  TLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAEVASFMPATGATIRH 122

Query: 127 ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVT 186
           A ++ D ++GF  G+  +  Y  + P +L+A A+V++YW     +NP VWITIF ++ V 
Sbjct: 123 AEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD---INPAVWITIFGILFVL 177

Query: 187 INXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS 246
            N            +    K+++++ LIV   VI LGG    +RLGF ++++PG F  Y 
Sbjct: 178 TNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQERLGFHYWREPGPFAEY- 235

Query: 247 EAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYL 306
             + G  GKFV F A     +++Y G +   I+A E KN R  +    +    RI+V YL
Sbjct: 236 -IVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGARNVFLRIIVLYL 294

Query: 307 VTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366
           + + +L + V YND L+             P+V+AI+ A I +LPHI NA +L   +SA 
Sbjct: 295 IAVLVLTLIVPYNDKLI---ATGTGTAKSSPYVIAIQRANIKILPHIINAIILTSAWSAG 351

Query: 367 NSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFN 426
           N  +   SR+L+ LA  N+APKIF  TNK G+PY  +     F  L+YM+VSS SA VF+
Sbjct: 352 NLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSYMSVSSSSANVFS 411

Query: 427 YFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIA 486
           +F  +VS   L+ WI I   +I+ DRAL+AQG  +S L ++  L    A+F+     +  
Sbjct: 412 WFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGPFAAWFSGIMSLIFL 471

Query: 487 LIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDL 546
           L   F  F+   FD ++F T Y  IP+ II F  +K  + TK+++P E DL +  E I  
Sbjct: 472 LTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYLRPAEVDLESIFEDIRQ 531

Query: 547 EEE 549
             E
Sbjct: 532 NPE 534

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  269 bits (688), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 174/581 (29%), Positives = 292/581 (50%), Gaps = 42/581 (7%)

Query: 1   MSFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIR-LKKEL 59
           MS   D    ++     N     KD     +S +  I   E  +    K    R LK  L
Sbjct: 5   MSESSDMATTNISVYDKNDKNNIKD----GVSFEKPIIYSEVDIESGAKESSSRNLKHGL 60

Query: 60  EARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP 119
           ++RH+ +                       P +++I+Y  +  +VY +M   GEM  Y+P
Sbjct: 61  QSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLP 120

Query: 120 LD-------GFTSY-ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKV 171
            +       G+ +Y  S+Y D +LGFA  ++Y + ++++   + TAA+ +++YW S  K+
Sbjct: 121 GNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTS--KI 178

Query: 172 NPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR- 230
              V I +FL +I  +N            W +  K+  +  LI++ FVI  GG P+++  
Sbjct: 179 PKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDN 238

Query: 231 --LGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPR 287
             +GF ++K+P +FR Y    +GS G F+      +   FA+ LG EL  + ++EC + R
Sbjct: 239 SFVGFHYWKNPSSFRDY--VTNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQR 296

Query: 288 RNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAG 346
           RN+ +A +  +YR++ FY+     + + V YNDP LL             PFV+ I+NAG
Sbjct: 297 RNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAG 356

Query: 347 IPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILC 406
           I +LPHI N C+L    SA N+ L+ ++R+L  +  +  AP+IF++ N+ GVPY +L L 
Sbjct: 357 ITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLS 416

Query: 407 ILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAY 466
           I+   LA++N S+ SA+VF +F N+ +I G + W    I Y+ F R      +D + L  
Sbjct: 417 IMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRT-----IDYNGLYD 471

Query: 467 AAPLASKG----AYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGY- 521
             P  +KG     +++  F  ++ L   +   +   ++Y++FI  YI +PVF++ +FG+ 
Sbjct: 472 RLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHI 531

Query: 522 ---KYIRGTKFVKP-EEADLYTFKELIDL------EEEEGK 552
                 R  K+ KP +E D+ T  E I+L      EE +G 
Sbjct: 532 IYSGRWRQRKWWKPVDEIDVVTGLEEIELKTKIADEERQGH 572

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  271 bits (692), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 178/577 (30%), Positives = 287/577 (49%), Gaps = 32/577 (5%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLS-----NQDDISSQESHLNIDGKHDGIRLKKELE 60
           DS+++  E+  +  +  ++D+EN DL+     N  D    +   N   K +   LKK ++
Sbjct: 90  DSFKR-AEQQPNQQHNLAEDLEN-DLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIK 147

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP- 119
            RHV M                       P  ++I Y+ +G  +Y ++   GEMA     
Sbjct: 148 PRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSN 207

Query: 120 -LDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
            L GF +Y S   DP  GFAV + Y  ++L + P +L   +L ++YW +   VNP  ++ 
Sbjct: 208 LLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTT--TVNPDAFVV 265

Query: 179 IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           IF V+I+ I             + +  K+L+++   +L  +I  GG  +   LG +++ D
Sbjct: 266 IFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHD 325

Query: 239 PGAFRPYSEAISGSKG--KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKL 296
           PGAFR       G+ G  +F   +A FV A FA+  TE   + AAE  NPR+ +P A K 
Sbjct: 326 PGAFR-------GTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKK 378

Query: 297 TLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNA 356
            LYR++  ++ TI LLG  V ++   L+            P+V+AI   G+ V+PH  NA
Sbjct: 379 VLYRVICIFVGTIALLGFLVPWDSDQLM--GAGGSATKASPYVLAISIHGVRVVPHFINA 436

Query: 357 CVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMN 416
            +L+ VFS  NS  Y +SR L GLA    APK F   ++ G P+ ++    LF ++A+  
Sbjct: 437 VILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCA 496

Query: 417 VSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAY 476
            S    QVF + + +  +  L +WIAI +++I F RA+  QG     + + A L   G+Y
Sbjct: 497 ASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSY 556

Query: 477 FALFFCCLIALIKNFTVFLG-----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-F 529
           +A     L ALI  F V +         D + F   Y+ +P+ I  +FGYK + R  + F
Sbjct: 557 YATIMMVL-ALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLF 615

Query: 530 VKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
           ++ ++ DL +++++ D  EE  K  D   KEK+++ P
Sbjct: 616 IRAKDIDLDSYRQVFD--EELLKQEDEEYKEKLKNGP 650

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  264 bits (675), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 168/494 (34%), Positives = 258/494 (52%), Gaps = 18/494 (3%)

Query: 13  EKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXX 72
           EK+ S    T+ D + L+  ++   ++++  L     +D  RLK+ L+ RH+ M      
Sbjct: 13  EKVKSKICETNVDEQELECGSE---TAKQGVL----YNDRTRLKQGLKERHIKMLTLVGV 65

Query: 73  XXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFT-SYASRYC 131
                            PV +LIAY FVG +V      + E+A+++P  G T  +A ++ 
Sbjct: 66  FGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFI 125

Query: 132 DPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXX 191
           D ++GF  G+  +  Y  + P +L+A A++++YW     V+P V+IT+F V+ V  N   
Sbjct: 126 DESVGFTFGW--ISTYSSLMPGELSATAVIMKYWT---DVSPAVFITVFGVLFVATNIYT 180

Query: 192 XXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISG 251
                         K++++  LI+   VI LGG    +RLGF +++DPG F  Y   ++G
Sbjct: 181 IRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFANY--LVAG 238

Query: 252 SKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFL 311
             GKFV F A     +++Y G +   I+A E KN R  +    K    RI+V YLVT+F+
Sbjct: 239 HIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVLYLVTVFV 298

Query: 312 LGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLY 371
           L + V YND L+             PFV+A+  AGI VLPHI NA +L   +SA N  + 
Sbjct: 299 LTLIVPYNDKLI---ATGTGTAKSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAII 355

Query: 372 VASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNV 431
             SR+L+ LA  N+AP+IF KT+K G+PY  +I    F  LAYM+ S  SA VF +F  +
Sbjct: 356 EGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSATVFGWFQEL 415

Query: 432 VSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNF 491
           VS   L+ WI I   +I+ DRAL+AQG  +S L  +  +A   A+F+     +      F
Sbjct: 416 VSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVIFLFTGGF 475

Query: 492 TVFLGHKFDYKNFI 505
             F+   FD ++F+
Sbjct: 476 YNFMHGHFDIESFL 489

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  265 bits (676), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 165/514 (32%), Positives = 268/514 (52%), Gaps = 17/514 (3%)

Query: 56  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA 115
           +++L  R VSM                       P S+LIA+     +   +  C+  M 
Sbjct: 46  RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVMV 105

Query: 116 TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174
           TY+P+ G F  +  R+ D + GF+VG++Y          ++TA  LV+++W   +K+   
Sbjct: 106 TYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWT--DKIPKA 163

Query: 175 VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFR 234
             I+I + +  ++N            +LS  KV++ + LI    V+M GG P H  LGF+
Sbjct: 164 ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGFK 223

Query: 235 FYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAI 294
            + +PGAF  Y     GS GKF  F++  ++AL+ + G +  G  A+E  NPR+ +P + 
Sbjct: 224 NWSNPGAFAEYIS--KGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSF 281

Query: 295 KLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXX-XXPFVVAIKNAGIPVLPHI 353
           +    R+++FY+     +G+ V +ND  +++            P+V A+K  GI VLPHI
Sbjct: 282 RKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPHI 341

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L  + SA NS LY ASR L+ LA++ +APK+F K  K GVP    +  +L C LA
Sbjct: 342 VNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYCCVAVLLVCGLA 400

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           Y++VS+ +  V  +F+NV +    + +I I I+Y+ F +  +AQ +D  TL Y++     
Sbjct: 401 YLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFLPY 460

Query: 474 GAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPE 533
             + +LF+  L+  +  + VFL   +D ++FI  Y  IP FI+ F G+K  + T+FVKP 
Sbjct: 461 LGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFVKPV 520

Query: 534 EADLYTFKELIDLEEEEGKLWDAAQKEKMESSPK 567
           E DL  F  + +L EE+   W+       E+ PK
Sbjct: 521 EMDL--FSGIAELAEEDA-YWE-------ENPPK 544

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  261 bits (667), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 173/569 (30%), Positives = 286/569 (50%), Gaps = 32/569 (5%)

Query: 14  KIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXX 73
            + S  ++T++  + +  + + DI  + S  +ID       + + L++RHV         
Sbjct: 24  SLTSRDHSTNQKKDAIITAVEQDIE-RGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAI 82

Query: 74  XXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYAS---RY 130
                           P  +LI+YS + F V+ +M  + EM   IPL G +S AS    Y
Sbjct: 83  GTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTY 142

Query: 131 CDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXX 190
            +    F  G++  +   ++ P ++TA AL+++YW      N  +++TIF+++   ++  
Sbjct: 143 LNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWT---DANAAIFVTIFMILATLLSLL 199

Query: 191 XXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPS-HDRLGFRFYKDPGAFRPYSEAI 249
                      +S  K+L +L LI++  VI  GGGP+ H  LGF ++  PGAF  Y   +
Sbjct: 200 PVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSY--LV 257

Query: 250 SGSKGKFVSFVAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVT 308
            GS G F++     + + FA+ +  E+    +AE   PR+N+PRA +  +YR+ VFY++ 
Sbjct: 258 KGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLG 317

Query: 309 IFLLGMTVAYNDPLLLQXXXX-XXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACN 367
             ++G+ V Y++  L +            PFV+ I+ AGI +LPHI NAC+L   +S   
Sbjct: 318 CLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCST 377

Query: 368 SDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNY 427
           S+LY ASR L+ LA+   APK F+K NK+GVPY S+    LF +LAY+N S  S  VFN+
Sbjct: 378 SELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNW 437

Query: 428 FVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKG----AYFALFFCC 483
             N+ +I G ++W+ + ITY+ F +       D   +    P   +G    AY +  F  
Sbjct: 438 LSNIATISGFVNWVFVSITYLRFRKI-----TDYLKINDRVPYRRRGQRALAYASAIFFA 492

Query: 484 LIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKEL 543
           L+A+   F VF+   ++  +F T Y+      I F G  +I  + + K      +TF+++
Sbjct: 493 LLAITNGFYVFIAGNWNVSDFFTCYV-----TIGFVGVLFIGSSIYYKE-----WTFRDM 542

Query: 544 IDLEEE-EGKLWDAAQKEKMESSPKNFKW 571
             +  E   K+  A Q+EK E  P    W
Sbjct: 543 DVVGREIMPKIDQADQEEKEEYLPPPKNW 571

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  261 bits (666), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 171/575 (29%), Positives = 283/575 (49%), Gaps = 35/575 (6%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVS 65
           DS+R+       +   T++D+EN  +S      S++ H   +G  D   L+K +  RHV 
Sbjct: 76  DSFRR-----AEDDEETAEDLENELVSTLSPSKSKQLHGQKNGDDDA-HLQKSIRPRHVL 129

Query: 66  MXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMAT-YIPLDG-F 123
           M                       P +++I Y  +G  +Y ++   GEMA  Y  L G F
Sbjct: 130 MMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNF 189

Query: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183
            +Y S   D  + F V + Y  ++L + P +L  A++ + YW +  KVN  V++ IF V+
Sbjct: 190 NAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTT--KVNSDVFVVIFFVL 247

Query: 184 IVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243
           I  IN            + +S KVL+M    +L  VI  GG  +   +G +++ +PGAFR
Sbjct: 248 ITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR 307

Query: 244 PYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVV 303
                   S  +F   ++ F  A FA+  +E   I A+E  NPRR +P A K  +YRI+ 
Sbjct: 308 G-----DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILF 362

Query: 304 FYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVF 363
            +L +I L+G  V Y+   LL            P+V+A+ + G+ V+PH  NA +L+ V 
Sbjct: 363 IFLTSITLVGFLVPYDSTELLGSGGSASSQAS-PYVIAVASHGVRVVPHFINAVILLSVL 421

Query: 364 SACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQ 423
           S  NS  Y + R LY LA    APK F   ++ G P  ++++  +F ++A+ + S     
Sbjct: 422 SVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEED 481

Query: 424 VFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCC 483
           VF + +++  +  L +W AI +++I F RA++ QG     + + + +   G+ +A     
Sbjct: 482 VFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIM-M 540

Query: 484 LIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEADL 537
           ++ALI  F V +        D +NF   Y+ +P+ I+ +FGYK Y +  K F++ ++ DL
Sbjct: 541 ILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDL 600

Query: 538 YTFK-----ELIDLEEEEGKLWDAAQKEKMESSPK 567
            + +     EL+  EEEE        KEK+ + PK
Sbjct: 601 ISHRTIFDGELVRQEEEE-------YKEKLRNGPK 628

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  259 bits (663), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 179/570 (31%), Positives = 289/570 (50%), Gaps = 30/570 (5%)

Query: 11  DLEKIVSNS-NTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIR-LKKELEARHVSMXX 68
           DL+  ++ S + TS D         D ISS  S  N   +++    LKK ++ RHV M  
Sbjct: 74  DLDNDITTSISRTSMDAALNKTKFDDAISSSISETNKGHQNEKSEDLKKTIKPRHVIMIS 133

Query: 69  XXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMAT-YIPLDG-FTSY 126
                                P +++I Y+ +G  +Y ++   GE+A  Y  L+G F +Y
Sbjct: 134 LGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAY 193

Query: 127 ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVT 186
            S   DPALGF+V + Y  ++L + P +L  A++ ++YW +  KV+P V++ IF V+I+ 
Sbjct: 194 PSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTT--KVDPDVFVVIFYVLIIA 251

Query: 187 INXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS 246
           IN            + +  KVL+M    +L  +I  GG  +   LG +++ DPGAF    
Sbjct: 252 INTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAF---- 307

Query: 247 EAISGSKG--KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVF 304
              +G K   +F   +  FV A FA+  TE   + AAE  NPR+ +P A K  LYRIV  
Sbjct: 308 ---NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCI 364

Query: 305 YLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFS 364
           +L +I L+G  V YN   LL            P+V+A+ + G+ V+PH  NA +L+ V S
Sbjct: 365 FLASITLIGFLVPYNSDQLLGSGGSGIKAS--PYVIAVSSHGVRVVPHFINAVILLSVLS 422

Query: 365 ACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQV 424
             NS  Y +SR L  LA    APK F   ++ G P+ ++++  LF ++A+   S    +V
Sbjct: 423 VGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEV 482

Query: 425 FNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCL 484
           F++ + +  +  L +WI I +++I F RA++ QG     + Y   L+  G Y + +   +
Sbjct: 483 FSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGY---LSQSGVYGSAYAAIM 539

Query: 485 --IALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEAD 536
             +ALI  F V +      K D +NF   Y+ +P+ I  +FGY+ + R  K F++ ++ D
Sbjct: 540 LFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWKLFIRAKDID 599

Query: 537 LYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
           L T +++ D  E   +  D   KEK+ + P
Sbjct: 600 LDTHRQIFD--ENILRQEDEEYKEKLRNGP 627

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  255 bits (652), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 158/532 (29%), Positives = 267/532 (50%), Gaps = 25/532 (4%)

Query: 46  IDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVY 105
           I+G+    ++ ++L++RH+ +                       P  +LI+Y  + F V+
Sbjct: 60  IEGQEH--QVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVW 117

Query: 106 IVMTCLGEMATYIPLDGFTSY---ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVL 162
            +M  L EM   +P+ G TS       Y +  L F  G +  +   +I P+++TA A+++
Sbjct: 118 CIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILI 177

Query: 163 QYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIML 222
           QYW      N  ++I+IF+V+ V++             W+S  K+  +  L++L  VI  
Sbjct: 178 QYWT---DANSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFF 234

Query: 223 GGGPSHDR-LGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY-LGTELCGIVA 280
           GG P+ D+ LGF ++K PGAF P+   + G+ GKF++     + + F+Y L  E+    A
Sbjct: 235 GGAPNQDKVLGFHYWKHPGAFNPH--LVPGNTGKFLACWTAIIKSGFSYVLVPEVVVSCA 292

Query: 281 AECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXX-XXXXXXXPFV 339
           AE K+PRRN+PR  +  +YR+ +FY+     +G+ V Y++  LL             PFV
Sbjct: 293 AEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFV 352

Query: 340 VAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVP 399
           + I+  GI VLPHI NAC+L   +S   S LY ASR L+ +A++   PKIFA TN++G P
Sbjct: 353 IGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTP 412

Query: 400 YNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRAL-RAQG 458
           Y S     +FCLLAY+N S  S+ VF +  N+ +I G + W+ + + Y+ F + +  A  
Sbjct: 413 YYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANL 472

Query: 459 VDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICF 518
            DK  + +        AY +  F  +++L   + VF+   ++  +F   Y  + +  + +
Sbjct: 473 TDK--MPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLY 530

Query: 519 FGYK-YIRGTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNF 569
            G   Y +  K    +E       ++   +EEE        K ++   PKN+
Sbjct: 531 IGAAIYYKTIKLRDLDEVAAEIIPKIAMADEEE--------KGEVPIVPKNW 574

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  256 bits (655), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 168/571 (29%), Positives = 281/571 (49%), Gaps = 29/571 (5%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           ++ +   DL   +S S+  ++++E  + S  D+I +   H     K D   LKK ++ RH
Sbjct: 74  VEATQMNDLTSAISPSSRQAQELEKNESS--DNIGANTGH-----KSD--SLKKTIQPRH 124

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPL-D 121
           V M                       P  +LI Y+ +G ++Y ++   GEMA  Y  L  
Sbjct: 125 VLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTG 184

Query: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
           G+ +Y S   D   GFAV + Y  ++L + P +L  A++ ++YW +   VNP V++ IF 
Sbjct: 185 GYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVNPDVFVIIFY 242

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
           V+++TIN            + +  K+L+M    +L  +I +GG  +   +G +++ DPGA
Sbjct: 243 VLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGA 302

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
           F     AI     +F    A  V A FA+ G+E   I  AE  NPR+ +P A K  +YRI
Sbjct: 303 FNG-KHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRI 357

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
           +  +L TI LLG  V YN   LL            P+V+A+ + G+ V+PH  NA +L+ 
Sbjct: 358 LFLFLATIILLGFLVPYNSDQLL--GSTGGGTKASPYVIAVASHGVRVVPHFINAVILLS 415

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
           V S  NS  Y ++R    L+    APK+F+  ++ G P  ++ +  LF ++A+   S   
Sbjct: 416 VLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKE 475

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
            QVF + + +  +  L +W AI ++++ F RA++ QG     L + +     G+ +A   
Sbjct: 476 EQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIM 535

Query: 482 CCLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYK--YIRGTKFVKPEEA 535
             LI LI  F V +      K D + F   Y+ +P+ I  + GYK  +     F++ ++ 
Sbjct: 536 MILI-LIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKI 594

Query: 536 DLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
           DL + +++ D  EE  K  D   +E++ + P
Sbjct: 595 DLDSHRQIFD--EELIKQEDEEYRERLRNGP 623

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  255 bits (651), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 174/557 (31%), Positives = 279/557 (50%), Gaps = 35/557 (6%)

Query: 27  ENLDLSNQDDISSQE---SHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXX 83
           EN+  S  + I  ++   S L +  +++ +R    L++RH+ +                 
Sbjct: 23  ENMKASVNEVIDEEQGSISELEVKPQNEMVR---GLKSRHIQLIALGDAIGTGLFIGSGG 79

Query: 84  XXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG---FTSYASRYCDPALGFAVG 140
                 P  ILI+Y  + F V+ ++  L EM   IPL G     S A  Y    L F  G
Sbjct: 80  ALSTCGPAPILISYIVMSFFVWTIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCG 139

Query: 141 YSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXX 200
           ++  +   +I P+++TA A+++QYW      N  ++I+IF+V  V I             
Sbjct: 140 WNLFYAMAMIAPSEITACAMLIQYWT---DANSAIFISIFIVFSVAITMLPVRVFGESEF 196

Query: 201 WLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-LGFRFYKDPGAFRPYSEAISGSKGKFVSF 259
            +SS K+L ++ LI++  VI  GGGPS D  LGF ++K PGAF+ +   + GS GKF++ 
Sbjct: 197 CVSSIKLLTIVGLIIVGIVIFFGGGPSQDHILGFHYWKKPGAFKEH--LVPGSTGKFLAV 254

Query: 260 VAVFVYALFAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAY 318
               + + F++ L  E     +AE  +PRRN+PRA +  +YR+ +FY+  + ++ + V  
Sbjct: 255 WTAIIKSGFSFVLVPETVASCSAESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGS 314

Query: 319 NDPLLLQXXXX-XXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSL 377
           +D  LL             P+V+ IK AGI VLPHI NAC+L   +S   ++LY  SR L
Sbjct: 315 DDANLLNAIHSGASNAAASPYVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRIL 374

Query: 378 YGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 437
           + +A+   AP+IFAK N++GVPY S  +  LF LLAY+N S  S+ VFN+  N+ +I G 
Sbjct: 375 HSMAMKGDAPQIFAKVNRFGVPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGF 434

Query: 438 MSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA---SKG-AYFALFFCCLIALIKNFTV 493
           +SW+ + +TY  F        +DK  L    P      KG AY  + F  L++L   + V
Sbjct: 435 ISWVFVSVTYTRFRTV-----IDKLDLNDRIPFRRRFQKGFAYACIAFFVLLSLTNGYAV 489

Query: 494 FLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKELIDLEEEEGK 552
           F+   ++  +F   Y+ I    + F G   Y +  +F    E       + ID+ +E+  
Sbjct: 490 FIKGNWNTSDFFASYVTIGFVAVLFIGSTIYYKELRFRDVSEIGREIIPK-IDIADED-- 546

Query: 553 LWDAAQKEKMESSPKNF 569
                ++  +   PKN+
Sbjct: 547 -----ERNDVPVVPKNW 558

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  255 bits (652), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 166/512 (32%), Positives = 266/512 (51%), Gaps = 22/512 (4%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           L+ +L+ RH+ M                       P  ILI +   G ++Y ++  + E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 115 ATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+  GFT+YA+R+ D + GFA  ++Y+ ++++  P ++ AA++ + YW + +K   
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F V+IV IN              S  K+L+++  I+L  +++ GGGP    +G 
Sbjct: 204 G-FVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGA 262

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           R++  PGAF     A   S  KF  F +VFV A F++ G+EL G+ AAE  NPR++VP A
Sbjct: 263 RYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGA 317

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K   +RI +FY++ + L+GM V Y DP L+            PFV+AIKN GI  LP +
Sbjct: 318 AKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAAS--PFVIAIKNQGISGLPTL 375

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS +Y  SR+L  LA     PK F+  ++ G P   + +   F L+A
Sbjct: 376 VNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIA 435

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S    +VF++ + +  +  L +W  I + +I F RAL AQG   + LA+A+P    
Sbjct: 436 FVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVW 495

Query: 474 GAYFALFFCCLIALIKNFTVF---LGHKFDYKNFITGYIGIPVFIICFFGYKYIRGT--K 528
           GA + LF  C+I L   F V    LG      +F  GY+ +P+ +  + G+K  +     
Sbjct: 496 GAAWGLFL-CIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKL 554

Query: 529 FVKPEEADLYTFKELIDL-------EEEEGKL 553
           F+K E+ D+ T +  +DL       EEE   L
Sbjct: 555 FIKAEDMDIDTGRRELDLDLLRQQVEEERAAL 586

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  255 bits (652), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 170/571 (29%), Positives = 281/571 (49%), Gaps = 29/571 (5%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           ++ +   DL   +S S+   +++E  + S  D+I ++  +     K D   LKK ++ RH
Sbjct: 74  VETAQMNDLASAISPSSRQRQELEKNESS--DNIGARTGN-----KSD--SLKKTIQPRH 124

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPL-D 121
           V M                       P  +LI Y  +G ++Y ++   GEMA  Y  L  
Sbjct: 125 VLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALVYSNLTG 184

Query: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
           G+ +Y S   D   GFAV + Y  ++L + P +L  A++ ++YW +   VNP V++ IF 
Sbjct: 185 GYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVNPDVFVIIFY 242

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
           V+++TIN            + +  K+L+M    +L  +I +GG  +   +G +++ DPGA
Sbjct: 243 VLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGA 302

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
           F         S  +F   VA  V A FA+ G+E   I  AE  NPR+ VP A K  +YRI
Sbjct: 303 FNGKH-----SIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRI 357

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
           +  +L TI LLG  V YN   LL            P+V+A+ + G+ V+PH  NA +L+ 
Sbjct: 358 LFLFLATIILLGFLVPYNSNQLL--GSSGGGTKASPYVIAVASHGVRVVPHFINAVILLS 415

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
           V S  NS  Y ++R L  L+    AP++F   +K G P  ++ +  LF ++A+   S   
Sbjct: 416 VLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKE 475

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
            QVF + + +  +  L +W AI +++I F RA++ QG     L + +     G+ +A   
Sbjct: 476 DQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIM 535

Query: 482 CCLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYKYIRG--TKFVKPEEA 535
             LI LI  F V +      K D + F   Y+ +P+ I  + GYK  +     F++ ++ 
Sbjct: 536 MILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIRADKI 594

Query: 536 DLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
           DL + +++ D  EE  K  D   +E++++ P
Sbjct: 595 DLISHRQIFD--EELIKQEDEEFRERLKNGP 623

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  254 bits (648), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 164/543 (30%), Positives = 277/543 (51%), Gaps = 26/543 (4%)

Query: 32  SNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPV 91
           SN  D   +E   +   K D  +LKK +++RHV M                       P 
Sbjct: 77  SNNPD---KEDGSDAGDKGDN-KLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPA 132

Query: 92  SILIAYSFVGFLVYIVMTCLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLI 149
            ++I Y+ +G  +Y ++   GE+A  Y  L G F +Y S   DPALGF+V + Y  ++L 
Sbjct: 133 GLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLC 192

Query: 150 ITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLV 209
           + P +L  A++ ++YW +   VNP +++ IF V+I+TIN            + ++FKVL+
Sbjct: 193 VMPLELVTASITIKYWTT--SVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLM 250

Query: 210 MLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSK--GKFVSFVAVFVYAL 267
           +   ++L  ++  GG  +   +G +++ DPG+F       SG K    F   V+  V A 
Sbjct: 251 ISGFLILGIIVNCGGAGNDGYIGGKYWNDPGSF-------SGDKPIDHFKGVVSTLVTAA 303

Query: 268 FAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXX 327
           FA+  TE   + AAE  NPR+++P A K  LYRI+V Y+ +I L+G  V +N   L+   
Sbjct: 304 FAFGATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSG 363

Query: 328 XXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAP 387
                    P+V+AI + G+ V+PH+ NA +L+ V S  NS  Y +SR L  LA    AP
Sbjct: 364 GSATHAS--PYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAP 421

Query: 388 KIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITY 447
                 ++ G P  ++++  +F L++++  S     VF + + +  +  L +W AI +++
Sbjct: 422 SFLKYVDREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSH 481

Query: 448 IYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVF--LGH-KFDYKNF 504
           I F RA++ QG     L + + +   G+Y+A     LI + + +T    +G  K D + F
Sbjct: 482 IRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAF 541

Query: 505 ITGYIGIPVFIICFFGYKYIRG--TKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKM 562
              Y+ +P+ I  +FGYK  +   T ++   + DL + + + D  E+  K  DA  +EK+
Sbjct: 542 FENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFD--EDVLKQEDAEYREKL 599

Query: 563 ESS 565
            +S
Sbjct: 600 RNS 602

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  254 bits (650), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 170/575 (29%), Positives = 282/575 (49%), Gaps = 35/575 (6%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDIS-SQESHLNIDGKHDGIRLKKELEARHV 64
           DS+R+  E I + +N   +D+EN   +    +S +++       +     L+K ++ RHV
Sbjct: 85  DSFRR-AEDIDAPTN---RDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHV 140

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPLDG- 122
            +                       P  ++I Y+ +G  +Y ++   GEMA  Y  L G 
Sbjct: 141 LLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGN 200

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182
           F +Y S   D A GF+V + Y  ++L + P +L  A++ +QYW +   VN  V++ IF V
Sbjct: 201 FNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTT--TVNADVFVVIFYV 258

Query: 183 IIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAF 242
           +I+ IN            + +S KVL+M    +L  VI  GG  +   +G +++ +PGAF
Sbjct: 259 LIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF 318

Query: 243 RPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302
           R        S  +F   ++ F  A FA+  +E   I A+E  NPRR +P A K  +YRI+
Sbjct: 319 RG-----DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRIL 373

Query: 303 VFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFV 362
             +L +I L+G  V YN   L+            P+V+A+ + G+ V+PH  NA +L+ V
Sbjct: 374 FIFLTSITLVGFLVPYNSTELM--GSGSAATKASPYVIAVASHGVRVVPHFINAVILLSV 431

Query: 363 FSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSA 422
            S  NS  Y + R LY L+    AP  F   ++ G P  ++I+  LF ++A+   SS   
Sbjct: 432 LSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEE 491

Query: 423 QVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFC 482
            VF + + +  +  L +WIAI +++I F RA++ QG     + + + +   G+ +A    
Sbjct: 492 DVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMM 551

Query: 483 CLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYKYIRG--TKFVKPEEAD 536
            L ALI  F V +        D +NF   Y+ +P+ I+ +FGYK  +     F++ ++ D
Sbjct: 552 TL-ALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDID 610

Query: 537 LYTFK-----ELIDLEEEEGKLWDAAQKEKMESSP 566
           L + +     ELI  EEEE        KE++ + P
Sbjct: 611 LVSHRKIYDGELIKQEEEE-------FKERLRNGP 638

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  253 bits (646), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 168/580 (28%), Positives = 287/580 (49%), Gaps = 23/580 (3%)

Query: 5   QDSYRKDLEKIVSNSNTTSKD----VENLDLSNQDDISSQESHLN-IDGKHDGIRLKKEL 59
           Q+    DL    S  +   K     V++     + ++    S L+ I  +     L+  L
Sbjct: 26  QEPLSHDLSSTGSEEHKKGKVWTRFVDSFRERERLEVDPNMSELDQIAFRTANSPLQHHL 85

Query: 60  EARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP 119
           + RH+ M                       P  ILI +   G ++Y ++  LGE+A   P
Sbjct: 86  KNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGELAVLFP 145

Query: 120 LDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
           + G FT+YA+R+ D + GFA   +Y+ ++L++ P ++ AA++ + YW +  +   G ++ 
Sbjct: 146 VSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRDG-FVA 204

Query: 179 IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           +F + I  IN              S  KV+ ++  I+L  ++  GGGP    +G R++  
Sbjct: 205 LFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGGRYWH- 263

Query: 239 PGAFRPYSEAISGSKG-KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLT 297
                PY   +  S G +F    +VFV A F++ G+EL G+ +AE  NPR++VP+A K  
Sbjct: 264 ----HPYGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPKAAKQV 319

Query: 298 LYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNAC 357
            +RI +FYL+ + ++G+ V Y +  L+            PFV+AI   GI  LP + N  
Sbjct: 320 FWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAAS--PFVIAITTHGIRGLPSVVNVV 377

Query: 358 VLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNV 417
           +L+ V S  NS +Y  SR+L  LA  N  PK F   ++ G P  S+++   F L+A++  
Sbjct: 378 ILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLVAFVAQ 437

Query: 418 SSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYF 477
           S    +VFN+ + +  +  L +W  I + +I F +AL AQG     L++ +P    G+Y+
Sbjct: 438 SKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGVYGSYW 497

Query: 478 ALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKP 532
            LF   L+  I  F V L   G K + K F   Y+  P+ I C+ G+K Y +  K F+K 
Sbjct: 498 GLFMIILM-FIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKNWKIFIKA 556

Query: 533 EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWF 572
           E+ D+ T ++  DL+    ++  A ++  + + P  ++W+
Sbjct: 557 EDMDIDTGRKDDDLDLLRQEV--AEERAVLATKPWWYRWW 594

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  253 bits (645), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 158/545 (28%), Positives = 275/545 (50%), Gaps = 20/545 (3%)

Query: 9   RKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXX 68
           R +  ++V +   ++ DV+ +    +D    +++  N   +   + L ++L  RH+    
Sbjct: 27  RMEEVEVVESLTKSNYDVQVMGKKYEDMDDVEKAIFNTTKRS--LNLNRDLSIRHLLTLA 84

Query: 69  XXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYA 127
                                P S++IA++ +   ++ ++  LGE+A   P+  GF  Y 
Sbjct: 85  VGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGELAAVFPVVGGFNVYV 144

Query: 128 SRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTI 187
           +R  DP+LGFAV  +YL ++ ++ P +L AA++ ++YW     VN   W+ +F V I   
Sbjct: 145 TRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYW--NNSVNSDAWVAVFYVCIFLA 202

Query: 188 NXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSE 247
           +             LS  K+L +    +L  V++ GGGP +  +G +++ DPG+F     
Sbjct: 203 SLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAKYWNDPGSF----- 257

Query: 248 AISGSKG-KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYL 306
            +  S G +F    +VFV A F+Y GTEL G+ AAE  NPR  +P+A K T + I + YL
Sbjct: 258 -VGASPGSQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKASKRTFWLITLSYL 316

Query: 307 VTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366
           + + ++G  V ++DP LL            P V+AI+N GI  LP + NA +L+ + S  
Sbjct: 317 LVLTIIGCLVRHDDPKLLSASSSVDVAAS-PLVIAIENGGIQGLPSLMNAIILIAIISVA 375

Query: 367 NSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFN 426
           NS +Y  SR +  +A     P+IF   +  G P  ++I  ++F LL+++  S+   ++F 
Sbjct: 376 NSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFV 435

Query: 427 YFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIA 486
           +   +  +  L  W+AI I++I F RAL  QG     L Y +     G+++      L+ 
Sbjct: 436 WLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGCVVIILV- 494

Query: 487 LIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKF-VKPEEADLYTF 540
           LI +F   L        D+++F  GY+ +P+F+ CF G+K Y R   + ++  + D+ T 
Sbjct: 495 LIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKRNWSWMIRSNKIDVNTG 554

Query: 541 KELID 545
           + +ID
Sbjct: 555 RRMID 559

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  253 bits (645), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 149/499 (29%), Positives = 267/499 (53%), Gaps = 15/499 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           L+++L+ RH+ M                       P  ILI +  +  ++  +   LGEM
Sbjct: 84  LQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEM 143

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G +T+YA+R+ D + GFA   +Y+ + L++ P ++ AA++ + YW  + +   
Sbjct: 144 AVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYR- 202

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
             ++ +F + IV+IN              S  KV+ ++  I+L  +++ GGGP+H+ +G 
Sbjct: 203 AAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGS 262

Query: 234 RFYKDPGAFRPYSEAISGSKG-KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
           +F+ +PGAF      +  + G KF    +VFV A F++  TEL G+ AAE ++PR++VP+
Sbjct: 263 KFWSNPGAF------VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPK 316

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K   +RI +FY++++ ++G+ V Y DP LL            PFV+A+KN GI  LP 
Sbjct: 317 AAKQVFWRITLFYILSLLMVGLLVPYTDPRLL--GSSIVDAAASPFVLALKNHGIKGLPS 374

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           + N  +L  V S  NS ++  SR L  L+     P +F   ++ G P  S+I    F LL
Sbjct: 375 VINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLL 434

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
            ++ VS    ++F++ +++  +  L  W+ I + +I F +AL AQ      LA+A+P+  
Sbjct: 435 CFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGI 494

Query: 473 KGAYFALFFCCLIALIKNF-TVFLGH-KFDYKNFITGYIGIPVFIICFFGYK-YIRGTK- 528
            G+Y+++F   ++ +++ +  +F GH K    NF   Y+ +P+ +  + G+K Y +  K 
Sbjct: 495 WGSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKL 554

Query: 529 FVKPEEADLYTFKELIDLE 547
            + P+  D+ T +  +D+E
Sbjct: 555 LIDPKYMDIDTGRRELDIE 573

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  253 bits (645), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 166/562 (29%), Positives = 282/562 (50%), Gaps = 38/562 (6%)

Query: 33  NQDDISSQESHL-----NIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXX 87
           ++++I S   H+     N+    +  +L K+L  RH+                       
Sbjct: 61  SKENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNT 120

Query: 88  XXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFK 146
             P S+++A+  V   ++ ++  LGE+A   P+  GF  Y +R+ +P+ GFAV  +YL +
Sbjct: 121 GGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQ 180

Query: 147 YLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFK 206
           + ++ P +L AA++ ++YW     +N   W+ IF   I   N             LS  K
Sbjct: 181 WAVLLPLELVAASITIRYW--NNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIK 238

Query: 207 VLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGK-FVSFVAVFVY 265
           +L ++   +L  V+  GGGPS + +G R++ DPGAF      +  + G+ F    AVFV 
Sbjct: 239 ILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF------VGDTPGRRFKGVCAVFVT 292

Query: 266 ALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQ 325
           A F+Y GTEL  + AAE  NPR  +P+A K T + I + Y+  + ++G  V YND  LL 
Sbjct: 293 AAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLN 352

Query: 326 XXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNK 385
                      P V+AI+N GI  LP + NA +L+ + S  NS +Y  SR +  +A    
Sbjct: 353 GNSSVDAAAS-PLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGN 411

Query: 386 APKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILI 445
            PK     +K G P  ++   ++F LL+++  S    +VF +   +  +  L  W +I +
Sbjct: 412 LPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINL 471

Query: 446 TYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLI--ALIKNFTVFL----GHKF 499
           ++I F +A++AQ    + L +   ++  G Y + + C +I   LI +F   L        
Sbjct: 472 SHIRFRQAMKAQDRSLNELPF---VSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGA 528

Query: 500 DYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEADLYTFKELIDLE--EEEGKLWD 555
           D ++F  GY+ +P+FI+C+ G+K Y +  + +VK ++ DL T +  IDL+  ++E +L  
Sbjct: 529 DAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRL-- 586

Query: 556 AAQKEKMESSPKNFKWFYEKFL 577
             ++E+M   P     FY +FL
Sbjct: 587 --EREQMAQKP-----FYIRFL 601

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  251 bits (642), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 169/576 (29%), Positives = 280/576 (48%), Gaps = 38/576 (6%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKD-----VENLDLSNQDDISSQESHLNIDGKHDGIRLKKE 58
           +++SY +    I  N+N   +      V++      DD+   +       K     +KK 
Sbjct: 13  LEESYDRVTPAIALNANGGGRGLFRDFVDSFKKKQDDDVVGYDEETGTSSK-----MKKT 67

Query: 59  LEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TY 117
           +++RH+ M                       P  ++I Y     ++Y ++   GE+   Y
Sbjct: 68  IKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAGELGICY 127

Query: 118 IPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVW 176
             + G +T+Y+S   DPALGF+V + Y  +++ + P QL  AA+ ++YW      NP ++
Sbjct: 128 SGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTD---TNPDIF 184

Query: 177 ITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFY 236
           + I   +IV IN              ++ KVL+M+  ++L  +I  GG  +   +G R++
Sbjct: 185 VAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYIGARYW 244

Query: 237 KDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKL 296
             PGAF       +G KG       VF YA FAY G E+  + A+E +NPR+++P A K 
Sbjct: 245 HTPGAFS------TGFKG----VCYVFCYAAFAYGGIEVMVLTASEQENPRKSIPSACKK 294

Query: 297 TLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNA 356
            +YRI++ Y++T  ++   V Y+ P L             PFV+AI + GI V+PHI NA
Sbjct: 295 VIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRAS---PFVIAIASHGISVVPHIINA 351

Query: 357 CVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMN 416
            +L+ V S  NS LY A R L  L+    APK+F   ++ G P    ++ +   LLA++ 
Sbjct: 352 VILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAFIA 411

Query: 417 VSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAY 476
            S     VF++ + +  +  L  WI+I ++++ F  A++AQG     + Y +     G++
Sbjct: 412 ASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWGSW 471

Query: 477 FALFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFV 530
           FA+    L  L+  F V +     G K   K+F   Y+  PV I  +FGYK Y +  +  
Sbjct: 472 FAI-IVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRLC 530

Query: 531 KP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESS 565
            P  E DL + +++ D  E+E K  D   KEKM ++
Sbjct: 531 IPATEVDLNSHRKIFD--EDELKQEDLDWKEKMRTA 564

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  251 bits (642), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 163/535 (30%), Positives = 266/535 (49%), Gaps = 19/535 (3%)

Query: 22  TSKDVENLDLSNQDDISSQESHLNIDGKHDGIR---LKKELEARHVSMXXXXXXXXXXXX 78
           +SKD   ++ +  D  SS     N D + + I    L K+L  RH+              
Sbjct: 50  SSKDSPGINQTTNDITSSDRFRRNEDTEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLY 109

Query: 79  XXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGF 137
                      P S++I +  +   ++ V+  LGE++   P+  GF  Y+ R+ +P+  F
Sbjct: 110 VNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAF 169

Query: 138 AVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXX 197
           AV  +YL ++L++ P +L AA++ ++YW   +K+N   W+ IF   I   N         
Sbjct: 170 AVNLNYLAQWLVLLPLELVAASITIKYW--NDKINSDAWVAIFYATIALANMLDVKSFGE 227

Query: 198 XXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFV 257
               LS  K+L ++   +L  V+  GGGP    +G +++ DPGAF  +S     S  +F 
Sbjct: 228 TEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHS-----SGTQFK 282

Query: 258 SFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVA 317
              +VFV A F+Y G E+  + AAE KNPR  +P+A K T + I   Y+  + L+G  V 
Sbjct: 283 GLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVP 342

Query: 318 YNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSL 377
            NDP LL            P V+AI+N GI  LP + NA +L+ V S  NS +Y  SR +
Sbjct: 343 SNDPRLLNGSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCM 401

Query: 378 YGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 437
             +A     PK   + +K G P N+++L + F LL+++  S   A+VF +   +  +  +
Sbjct: 402 VAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTI 461

Query: 438 MSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL-- 495
             W+AI +++I F +A++ Q      L + +    KG+++  F    + LI +F   L  
Sbjct: 462 FCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYG-FIVLFLVLIASFWTSLFP 520

Query: 496 --GHKFDYKNFITGYIGIPVFIICFFGYK-YIRG-TKFVKPEEADLYTFKELIDL 546
             G     ++F  GY+  P+ I+C+ G+K Y R  T  VK E+ DL T ++ +DL
Sbjct: 521 LGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVDL 575

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  252 bits (644), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 168/565 (29%), Positives = 279/565 (49%), Gaps = 29/565 (5%)

Query: 10  KDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXX 69
            DL   +S S+  + ++E  + +  D I+    H     K D   LKK ++ RHV M   
Sbjct: 80  NDLTSAISPSSRQAHELEKDETT--DKIAPHTGH-----KSD--SLKKTIQPRHVLMIAL 130

Query: 70  XXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPL-DGFTSYA 127
                               P  +LI Y+ +G ++Y ++   GEMA  Y  L  G+ +Y 
Sbjct: 131 GTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYP 190

Query: 128 SRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTI 187
           S   D   GFAV + Y  ++L + P +L  A++ ++YW +   VNP V++ IF V+++TI
Sbjct: 191 SFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVNPDVFVIIFYVLVITI 248

Query: 188 NXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSE 247
           N            + +  K+L+M    +L  +I +GG  +   +G +++ +PGAF     
Sbjct: 249 NIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGV-H 307

Query: 248 AISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLV 307
           AI     +F   VA  V A FA+ G+E   I  AE  NPR+ +P A K  +YRI+  +L 
Sbjct: 308 AID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLA 363

Query: 308 TIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACN 367
           TI ++G  V YN   LL            P+V+AI + G+ V PH  NA +L+ V S  N
Sbjct: 364 TIIIVGFLVPYNSDQLL--GSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMAN 421

Query: 368 SDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNY 427
           S  Y ++R    L+    APKIF+  ++ G P  ++ +  LF ++A+   S    QVF +
Sbjct: 422 SSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTW 481

Query: 428 FVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIAL 487
            + +  +  L +W AI +++I F RA++ QG     L + +     G+ ++     LI L
Sbjct: 482 LLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILI-L 540

Query: 488 IKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEADLYTFK 541
           I  F V +      K D + F   Y+ +P+ I+ + GYK + +  K F++ ++ DL + +
Sbjct: 541 IGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHR 600

Query: 542 ELIDLEEEEGKLWDAAQKEKMESSP 566
           ++ D  EE  K  D   +E++ + P
Sbjct: 601 QIFD--EELIKQEDDEYRERLRTGP 623

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  251 bits (642), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 165/565 (29%), Positives = 275/565 (48%), Gaps = 29/565 (5%)

Query: 10  KDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXX 69
            DL   +S S+  ++ +E  D +++         +N    +    LKK ++ RHV M   
Sbjct: 80  NDLTSAISPSSRNAQGLEKNDSTDK---------INPPAGNKSGSLKKTIQPRHVLMIAL 130

Query: 70  XXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPL-DGFTSYA 127
                               P  +LI Y+ +G ++Y ++   GE+A  Y  L  G+ +Y 
Sbjct: 131 GTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGGYNAYP 190

Query: 128 SRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTI 187
           S   D   GFAV + Y  ++L + P +L  A++ ++YW +   VNP V++ IF V+++TI
Sbjct: 191 SFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVNPDVFVIIFYVLVITI 248

Query: 188 NXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSE 247
           N            + +  K+L+M    +L  +I +GG  +   +G +++ DPGAF     
Sbjct: 249 NIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAFNGKH- 307

Query: 248 AISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLV 307
               S  +F   VA  V A FA+ G+E   I  AE  NPR+ +P A K  +YRI+  +L 
Sbjct: 308 ----SIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLA 363

Query: 308 TIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACN 367
           TI +LG  V YN   LL            P+V+AI + G+ V+PH  NA +L+ V S  N
Sbjct: 364 TIIMLGFLVPYNSDQLL--GSGGGGTKASPYVIAIASHGVRVVPHFVNAVILLSVLSMAN 421

Query: 368 SDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNY 427
           S  Y ++R    L+    APK F+  ++ G P  ++ +  LF ++A+   S    QVF +
Sbjct: 422 SSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTW 481

Query: 428 FVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIAL 487
            + +  +  L +W AI  ++I F RA++ QG     L + +     G+ +A     LI L
Sbjct: 482 LLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLI-L 540

Query: 488 IKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEADLYTFK 541
           I  F V +      K D + F   Y+ +P+ I  + GYK + +  K F++ ++ DL + +
Sbjct: 541 IGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKIDLESHR 600

Query: 542 ELIDLEEEEGKLWDAAQKEKMESSP 566
           ++ D  EE  K  D   +E++ + P
Sbjct: 601 QIFD--EELIKQEDEEYRERLRNGP 623

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  249 bits (637), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 172/557 (30%), Positives = 283/557 (50%), Gaps = 23/557 (4%)

Query: 21  TTSKDVEN----LDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXX 76
           TTS D +N    L   +QD  S  E+    +   +   L K L  RH+            
Sbjct: 5   TTSSDFKNEKWTLKEESQDIPSITETRQEEEETLNNTNLSKNLSVRHLVTLAVGGSIGTG 64

Query: 77  XXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPAL 135
                        P S+++ +  +   ++ V+  LGE+A   P+  GF  Y +R+ DP++
Sbjct: 65  LFVNSGTALSDGGPASLVVGWVIISTCLFTVINSLGELAAAFPIVGGFNVYITRFVDPSV 124

Query: 136 GFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXX 195
           GFAV  +YL ++L++ P +L AA+L ++YW   +K+N   W+ IF V IV  N       
Sbjct: 125 GFAVNLNYLAQWLVLLPLELVAASLTIKYW--NDKINSDAWVAIFYVTIVLANMLEVKSF 182

Query: 196 XXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGK 255
                 LS  K+L ++   +L  V+  GGGPS   LGF+++ +PGAF   + A      K
Sbjct: 183 GETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYLGFKYWNNPGAFVGGTNA-----SK 237

Query: 256 FVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMT 315
           F    +VFV A F++ G E+  + AAE KNPR+ +P+A K T + +   Y+V + L+G  
Sbjct: 238 FKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAAKRTFWLVTSSYVVILTLVGCL 297

Query: 316 VAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASR 375
           V YND  LL            P V+AI+N GI  LP + NA +L+ + S  NS +Y  SR
Sbjct: 298 VPYNDSRLLNAATSVDAAAS-PLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSR 356

Query: 376 SLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIF 435
            +  +A     PK+ +K +K G P N+LI+ ++F LL+++  S    +VF +   +  + 
Sbjct: 357 CMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIAASDKQNEVFTWLSALSGLS 416

Query: 436 GLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVF- 494
            +  W+AI  + I F RA++ Q      L Y +     GA++ +    L+ +   +T   
Sbjct: 417 TIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAWYGVLVLFLVIVASFWTSMF 476

Query: 495 -LGHKF-DYKNFITGYIGIPVFIICFFGYK--YIRGTKF-VKPEEADLYTFKELIDLEEE 549
            LG    D ++F   ++ +P+ ++C+FG+K  + R  +  +  EE D+ + +++ID   E
Sbjct: 477 PLGSAHADAESFFESFLSLPILLVCYFGHKLYFARNWRLQIGAEEMDIDSGRKIID---E 533

Query: 550 EGKLWDAAQKEK-MESS 565
           EG   +  ++EK M SS
Sbjct: 534 EGLKQEREEEEKAMNSS 550

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  249 bits (637), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 164/566 (28%), Positives = 286/566 (50%), Gaps = 23/566 (4%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHV 64
            +S ++D   I + S+  +K++      N  ++ S+E   +IDG +    L K+L  RH+
Sbjct: 46  SNSLKEDNVMIQTTSSGATKNINGTSNPNDSNMLSKE---DIDGSN----LNKDLNIRHL 98

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGF 123
                                    P S++I +  V   ++ V+  LGE+A   P+  GF
Sbjct: 99  LTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGGF 158

Query: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183
           + Y +R+ DP++ F++  +YL ++L++ P +L AA++ ++YW   +K+N   W++IF  +
Sbjct: 159 SVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYW--NDKINSDAWVSIFYTV 216

Query: 184 IVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243
           I  +N             LS  K+L ++   +L  V+  GGGP    +G +++ DPGAF 
Sbjct: 217 IGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAFV 276

Query: 244 PYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVV 303
            ++   +GS+  F    +VFV A F+Y G E+  + AAE  +PR+ +P A K T + I  
Sbjct: 277 GHT---AGSQ--FKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITA 331

Query: 304 FYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVF 363
            Y+  + L+G  V Y+DP LL            P V+AI+N GI  LP + NA +L+ V 
Sbjct: 332 SYVTILTLIGCLVPYDDPRLLNGSSSVDVASS-PLVIAIENGGIKGLPSLMNAIILIAVL 390

Query: 364 SACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQ 423
           S  NS +Y  SR +  +AI    PK   + +K G P N+ ++ + F L++++  S   A+
Sbjct: 391 SVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDKQAE 450

Query: 424 VFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFA---LF 480
           VF +   +  +  +  W+ I I++I F RA+  QG     + Y + +   G+++    LF
Sbjct: 451 VFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILF 510

Query: 481 FCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLY 538
              + A   +       + +   F  GY+ +P+ + C+ G+K Y +  +   P  E DL 
Sbjct: 511 LVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKNWRLFTPYNEIDLD 570

Query: 539 TFKELIDLE--EEEGKLWDAAQKEKM 562
           + K  IDLE   EE K+ + A K+++
Sbjct: 571 SGKRDIDLELLREEKKMEELALKKQL 596

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  250 bits (638), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 162/569 (28%), Positives = 281/569 (49%), Gaps = 32/569 (5%)

Query: 17  SNSNTTSKDVENLDLSNQ--DDISSQESHLNIDG--------KHDGIRLKKELEARHVSM 66
           SNSN T+  +   D S+Q  ++++ + S++ +DG        +     LKK ++ RH  M
Sbjct: 98  SNSNGTTP-ISTKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVM 156

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP--LDGFT 124
                                  P  ++I Y+ +G  VY ++   GE+A      + GF 
Sbjct: 157 MSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFN 216

Query: 125 SYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVII 184
           +Y     DPALGF+V + +  ++L + P +L  A++ ++YW +   VNP V++ IF V+I
Sbjct: 217 TYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTT--SVNPDVFVVIFYVLI 274

Query: 185 VTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRP 244
           V IN            + +  K+L+++   +L  +I  GG  +   +G ++++DPGAFR 
Sbjct: 275 VVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRG 334

Query: 245 YSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVF 304
            +        +F   VA FV A FA+  +E   + A+E  NPR+ +P A K  +YRI+  
Sbjct: 335 DTPI-----QRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFV 389

Query: 305 YLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFS 364
           +L ++ L+G  V Y    LL            P+V+A+ + G+ V+PH  NA +L+ V S
Sbjct: 390 FLASLTLVGFLVPYTSDQLL--GAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLS 447

Query: 365 ACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQV 424
             N   Y +SR L  LA    APK F   ++ G P  ++++  LF ++A+   S     V
Sbjct: 448 VANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDV 507

Query: 425 FNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCL 484
           F + + +  +  L +WI I +++I F RA++ QG     + Y + +   G+ +A+    L
Sbjct: 508 FTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVL 567

Query: 485 IALIKNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFGYKYIRG--TKFVKPEEADL 537
            ALI  F V +     G K   ++F   Y+ +P++I  +  YK  +   + F+  ++ DL
Sbjct: 568 -ALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDL 626

Query: 538 YTFKELIDLEEEEGKLWDAAQKEKMESSP 566
            + + + D  EE  K  D   KE++ + P
Sbjct: 627 VSHRNIFD--EELLKQEDEEYKERLRNGP 653

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  249 bits (637), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 169/575 (29%), Positives = 281/575 (48%), Gaps = 27/575 (4%)

Query: 1   MSFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELE 60
            +FI    R D E+  +  +  +K  E     ++D     E    + GK +   LK  ++
Sbjct: 75  QNFIDSFKRADKEQPSTLEHDLTKTFEGTLEPSEDGTQPAE----VAGKSE--ELKHSIK 128

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP- 119
            RHV M                       P  ++I Y+ +G  +Y ++   GEMA     
Sbjct: 129 PRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSK 188

Query: 120 -LDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
            + GF SY S   +PALGF+V + Y  ++L + P +L  A++ ++YW +  KV+P V++ 
Sbjct: 189 LIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTT--KVDPDVFVV 246

Query: 179 IFLVIIVTINXXXXXXXXXXXXWL-SSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYK 237
           IF V+I+ IN            +  +S K+L++L   +L  +++ GG      +G R++ 
Sbjct: 247 IFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWH 306

Query: 238 DPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLT 297
           DPGAFR    AI     +F   V+  V A FA+  +E+ G+ A+E  NPR+ +P A K  
Sbjct: 307 DPGAFRG-EHAID----RFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKM 361

Query: 298 LYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNAC 357
           +YRIV  YL ++ ++G  V +N   LL            P+V+A+   G+ V+PH  NA 
Sbjct: 362 IYRIVCIYLGSVVIVGFLVPWNSDQLL--GSSGGGVKASPYVLAVSTHGVRVVPHFINAV 419

Query: 358 VLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNV 417
           +L+ V S  NS  Y +SR L GLA    APKIF   ++ G P   + +  L  ++++   
Sbjct: 420 ILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCAT 479

Query: 418 SSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYF 477
           S    QVF + + +  +  L +W AI +++I F RA+  QG     + + +     G+++
Sbjct: 480 SPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWY 539

Query: 478 ALFFCCLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVK 531
           A     LI LI  F V +      + D + F   Y+  P+ I  +FGYK Y +  + F++
Sbjct: 540 AFIMMMLI-LIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIR 598

Query: 532 PEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
            ++ DL   +++ D E    +      KEKM ++P
Sbjct: 599 AKDIDLDINRDVFDEELIRQEE--EEYKEKMRNAP 631

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  248 bits (632), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 161/522 (30%), Positives = 273/522 (52%), Gaps = 17/522 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK  L+ RH+ M                       P S+LI +   G ++Y ++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGEL 145

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + G+A  ++Y+ ++L++ P ++ +A++ + +W +  K   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F ++IV IN              S  KV+ ++  I+L  ++  GGGP    +G 
Sbjct: 206 G-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGG 264

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPGAF     A      KF    +VFV + F++ G+EL G+ A+E  +PR++VP+A
Sbjct: 265 KYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKA 319

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K   +RI +FY++++ ++G+ V YNDP L+            PFV+AIK  GI  LP +
Sbjct: 320 AKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAAS--PFVIAIKTHGIKGLPTV 377

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS +Y  SR++  LA     P+IFA  ++ G P   + +   F L+A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIA 437

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S     VFN+ + +  +  L +W  I I +I F +AL AQG D   L++ +P    
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 474 GAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK- 528
           G+Y+ LF   +I  I  F V L   G     + F   Y+  P+ +  + G+K Y R  K 
Sbjct: 498 GSYWGLFM-VVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRNWKL 556

Query: 529 FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFK 570
           F+  E+ D+ T +  +DLE  + ++  A +K  M + PK ++
Sbjct: 557 FIPAEDMDIDTGRREVDLELLKQEI--AEEKAIMATKPKWYR 596

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  248 bits (632), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 163/531 (30%), Positives = 278/531 (52%), Gaps = 21/531 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           L++ L+ RH+ M                       P  +LI +  +G ++Y V+  +GE+
Sbjct: 77  LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGEL 136

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + GFA+ Y+Y+ ++L++ P ++ AA++ + +W +  K   
Sbjct: 137 AVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRD 196

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F ++IV IN              S  KV+ ++  I+L  V++ GGGP    +G 
Sbjct: 197 G-FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGG 255

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ +PGAF   S   +GS+  F    +VFV A F++ GTEL G+ +AE  NPR+ +PRA
Sbjct: 256 KYWHNPGAF---SGDDAGSR--FKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRA 310

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K   +RI++FY++++ L+G+ V +    L+            PFV+AI+  GI  LP +
Sbjct: 311 AKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAAS--PFVLAIQTHGIKGLPSV 368

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS +Y  SRS+  LA     P IFA  ++ G P  ++I   +F LL+
Sbjct: 369 INVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLS 428

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S     VFN+ + +  +  L SW AI I +I F RAL AQG     LA+ +     
Sbjct: 429 FIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIA 488

Query: 474 GAYFALFFCCLIALIKNFTVF---LGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK- 528
           G+YF +    L+ LI  F V    +G   + ++F + Y+  PV +  +  +K + R  K 
Sbjct: 489 GSYFGVILVLLV-LIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKL 547

Query: 529 FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGW 579
           F + ++ D+ T +  +D E    ++  A +K  + + P    W+Y  +  W
Sbjct: 548 FTRAKDIDIDTGRREMDTEALRQEI--AEEKMLLSTRP----WWYRLYFFW 592

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  247 bits (630), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 165/543 (30%), Positives = 268/543 (49%), Gaps = 25/543 (4%)

Query: 20  NTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXX 79
           N T+ DV + D     +   QE   N +       L K+L  RH+               
Sbjct: 58  NQTTNDVTSSDHFRGSEGIEQEDINNTN-------LSKDLSVRHLLTLAVGGAIGTGLYV 110

Query: 80  XXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFA 138
                     P S++I +  +   ++ V+  LGE++   P+  GF  Y+ R+ +P+  FA
Sbjct: 111 NTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFA 170

Query: 139 VGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXX 198
           V  +YL ++L++ P +L AA++ ++YW   +K+N   W+ IF   I   N          
Sbjct: 171 VNLNYLAQWLVLLPLELVAASITIKYW--NDKINSDAWVAIFYATIALANMLDVKSFGET 228

Query: 199 XXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVS 258
              LS  K+L ++   +L  V+  GGGP    +G +++ DPGAF  +S     S  +F  
Sbjct: 229 EFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHS-----SGTQFKG 283

Query: 259 FVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAY 318
             +VFV A F+Y G E+  + AAE KNPR  +P+A K T + I   Y+  + L+G  V  
Sbjct: 284 LCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPS 343

Query: 319 NDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLY 378
           NDP LL            P V+AI+N GI  LP + NA +L+ V S  NS +Y  SR + 
Sbjct: 344 NDPRLLNGSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMV 402

Query: 379 GLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLM 438
            +A     PK   + +K G P N+++L + F LL+++  S   A+VF +   +  +  + 
Sbjct: 403 AMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIF 462

Query: 439 SWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL--- 495
            W+AI +++I F +A++ Q      L + +    KG+++  F    + LI +F   L   
Sbjct: 463 CWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYG-FIVLFLVLIASFWTSLFPL 521

Query: 496 -GHKFDYKNFITGYIGIPVFIICFFGYK-YIRG-TKFVKPEEADLYTFKELID--LEEEE 550
                + ++F  GY+  P+ I+C+FG+K Y R  T  VK E+ DL T ++ +D  L  EE
Sbjct: 522 GSSGANAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVDLALRREE 581

Query: 551 GKL 553
            K+
Sbjct: 582 MKV 584

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  246 bits (629), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 167/579 (28%), Positives = 278/579 (48%), Gaps = 36/579 (6%)

Query: 6   DSYRKDLEKIVSNSNTTSK-----DVENLDLSNQD--DISSQESH-LNIDGKHDGIRLKK 57
           DS+++  ++  +NS  TS        ENLD   ++  D+  QE+  L          LK+
Sbjct: 51  DSFKRAEQQ--NNSEITSAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQ 108

Query: 58  ELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-T 116
            ++ RHV +                       P  +LI YS +G  +Y ++   GE+A +
Sbjct: 109 TIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVS 168

Query: 117 YIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGV 175
           Y  L G F  Y S   DPA GF+V + Y  ++L + P +L  A++ ++YW +   VN  +
Sbjct: 169 YSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTT--TVNADI 226

Query: 176 WITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRF 235
           ++ IF V+I+ IN            + +  K+L+M+   +L  VI  GG  +   +G R+
Sbjct: 227 FVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRY 286

Query: 236 YKDPGAF---RPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
           +  PGAF   RP           F   +A  V A FA+  TE   + AAE  NPR+ +P 
Sbjct: 287 WHTPGAFAGDRPIDH--------FKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPS 338

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K  LYRI+  +L +I L+G  V Y+   L+            P+V+A+   G+ V+PH
Sbjct: 339 AAKKVLYRILFIFLGSITLVGFLVPYDSDQLM--GSGGSATKASPYVLAVSTHGVKVVPH 396

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
             NA +L+ V S  NS  Y +SR LY LA    APK F   ++ G P+ +++   +F ++
Sbjct: 397 FINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAII 456

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           ++   S    QVF + + +  +  + +W AI +++I F +A+  Q      + + A    
Sbjct: 457 SFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGV 516

Query: 473 KGAYFALFFCCLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYKYIRG-- 526
            G+Y+  F   +I LI  F V +      K D + F   Y+ +P+ I+ + GYK  +   
Sbjct: 517 WGSYYVCFMLVMI-LIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDW 575

Query: 527 TKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESS 565
           + F++    DL   +++ D  EE  K  D   +EK+++ 
Sbjct: 576 SLFIRANNIDLDKHRQIFD--EELLKQEDEEYREKLKNG 612

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  246 bits (627), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 172/548 (31%), Positives = 269/548 (49%), Gaps = 28/548 (5%)

Query: 32  SNQD--DISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXX 89
           +N D  D S      +I+      + K+ +++RHV M                       
Sbjct: 57  ANSDTFDASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGG 116

Query: 90  PVSILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTSYASRYCDPALGFAVGYSYLFKY 147
           P  +LI YS V  + YI+M   GEMA   P     F  Y+S +   + GFA  + Y  ++
Sbjct: 117 PAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQW 176

Query: 148 LIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKV 207
           L + P +L  A+L ++YW S   +NP  +I IF  +IV I+              S+ KV
Sbjct: 177 LTVLPLELITASLTIKYWNS--SINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKV 234

Query: 208 LVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYAL 267
            ++   I+L  VI  GG  +   +G  ++++PGAF   S       G F     V V A 
Sbjct: 235 SMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGGSPI-----GHFKGIAYVLVTAY 289

Query: 268 FAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXX 327
           F+Y G EL  +   E  NPR+ VP A K  +YRI++ Y++T+ L+G  V YN   L+   
Sbjct: 290 FSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSS 349

Query: 328 XXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAP 387
                    P+V+A+ + G+ V+PHI NA +L+ V S  NS +Y A R L  LA    AP
Sbjct: 350 GKSATHAS-PYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAP 408

Query: 388 KIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITY 447
           KIF+  ++ G P  +L+ C +F LL+++  S    QVF +   +  +  L +W AI +++
Sbjct: 409 KIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSH 468

Query: 448 IYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL-----GHKFDYK 502
           + F  A++ QG   S L Y +     G+ +A+FF  +I  +  F V L     G K D +
Sbjct: 469 VRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFF-NIIVFVAQFWVALAPIGNGGKADAE 527

Query: 503 NFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELID---LEEEEGKLWDAA 557
            F   Y+  P++I C+ GYK Y +  K + P +E DL + + + D   L++E     D  
Sbjct: 528 AFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQE-----DDE 582

Query: 558 QKEKMESS 565
            KEK+++S
Sbjct: 583 HKEKLKNS 590

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  246 bits (627), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 275/532 (51%), Gaps = 23/532 (4%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK  L+ RH+ M                       P  I+I +     ++Y ++  LGE+
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + GFA  ++Y  ++L   P ++ +A++ + YW + E+   
Sbjct: 155 AVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRD 214

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F ++IV IN              S+ KVL ++  I+L  V++ GGGP    +G 
Sbjct: 215 G-FVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGG 273

Query: 234 RFYKDPGAFRPYSEAISGSKG-KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
           R++ +PGAF      +  + G +F    +VFV A F++ G+EL GI AAE  NPR++VPR
Sbjct: 274 RYWHNPGAF------VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPR 327

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K  ++RIV+FY+ ++ ++G+ V Y DP L+            PFV+AI   GI  LP 
Sbjct: 328 AAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASAS--PFVIAIVTHGIRGLPS 385

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           + N  +L+ V S  NS ++  SR++  L+     P+IF   ++ G P   +I+   F L+
Sbjct: 386 VINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLI 445

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           A++  S    +VF + + +  +  L +W  I + +I F  AL+AQG   + L + +P   
Sbjct: 446 AFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGI 505

Query: 473 KGAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK 528
            G+ + LF   L+  I  F V L   G K   + F   Y+  P+ +  +FG+K Y +  K
Sbjct: 506 IGSSWGLFMLLLM-FIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWK 564

Query: 529 -FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGW 579
            F+K E+ D+ T +   DLE  + ++    ++EK   + K   W+Y ++  W
Sbjct: 565 LFIKAEDMDIDTGRRETDLELLKQEI----EEEKAILATKG--WWYRQYQFW 610

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  246 bits (629), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 172/550 (31%), Positives = 278/550 (50%), Gaps = 22/550 (4%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           +++S  KD   I SN      D E L LSN D          I+ K D   LKK ++ RH
Sbjct: 103 VKNSPEKDTASITSNEMMI--DEEILSLSNLDGQRVPPPR-KIENKSD--ELKKTIKPRH 157

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPL-D 121
           V M                       P  +L+ +  +G  +Y ++  +GEMA  Y  L  
Sbjct: 158 VLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVG 217

Query: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
           GF +Y S   DPA GF+V + Y  ++L + P +L  A++ ++YW +  KV+P V++ IF 
Sbjct: 218 GFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTT--KVDPDVFVIIFY 275

Query: 182 VIIVTINXXXXXXXXXXXXWL-SSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPG 240
           V+I+ IN            ++ +S K+L+M+   +L  +I+ GG  +   +G +++ +PG
Sbjct: 276 VLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPG 335

Query: 241 AFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYR 300
           AFR    AI     +F   +A  V A FA+  +E  G+ A+E  NPR+ +P A K  LYR
Sbjct: 336 AFRG-EHAID----RFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYR 390

Query: 301 IVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLM 360
           IV  +L +I ++G  V Y+   LL            P+V+A+   G+ V+PH  NA +L+
Sbjct: 391 IVCMFLASITIVGFLVPYDSDQLLGSSGGGVKAS--PYVLAVSTHGVKVVPHFINAVILI 448

Query: 361 FVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSG 420
            V S  NS  Y +SR L  LA    APKIF   ++ G P   + +  LF ++A+   S  
Sbjct: 449 SVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPK 508

Query: 421 SAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFA-- 478
             +VF + + +  +  L +WIAI ++++ F RA+  QG     L + + + + G+ +A  
Sbjct: 509 EDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAI 568

Query: 479 LFFCCLIALIKNFTVFLGH-KFDYKNFITGYIGIPVFIICFFGYK-YIRG-TKFVKPEEA 535
           +  C LIA        +G  K D KNF   Y+ +P+ +  +FGYK Y +  T F++ ++ 
Sbjct: 569 MMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKDI 628

Query: 536 DLYTFKELID 545
           DL + + + D
Sbjct: 629 DLVSHRNIFD 638

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  245 bits (626), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 165/563 (29%), Positives = 271/563 (48%), Gaps = 30/563 (5%)

Query: 11  DLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXX 70
           D  K    S T +K +      N  D+      +  D K     LKK +++RHV M    
Sbjct: 56  DSFKRAEGSTTRTKQINE----NTSDLEDGVESITSDSK-----LKKSMKSRHVVMMSLG 106

Query: 71  XXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTSYAS 128
                              P +++I Y  V F+ Y ++   GEMA   P     F +Y+S
Sbjct: 107 TGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSS 166

Query: 129 RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTIN 188
            +   + GFA  + Y F++L + P +L  A++ +Q+W   +K+NP ++I IF V +V I+
Sbjct: 167 IFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFW--NDKINPDIYILIFYVFLVFIH 224

Query: 189 XXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEA 248
                         +  K+L++   I+L  VI  GG  +   +G  ++ +PGAF     A
Sbjct: 225 FFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----A 279

Query: 249 ISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVT 308
              S G+F +   + V A F++ G EL  +   E  NPR++ P A K ++YRIVV YL+T
Sbjct: 280 GDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLT 339

Query: 309 IFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNS 368
           + L+G  V YND  L+            P+V+A    G+ ++PHI NA +L+ V S  NS
Sbjct: 340 MILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVPHIINAVILISVVSVANS 397

Query: 369 DLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYF 428
            LY   R +  LA    APK     ++ G P  +LI+C +F ++A++  SS    VF + 
Sbjct: 398 SLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWL 457

Query: 429 VNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALI 488
             +  +  L +W +I+++++ F +A++ QG     L Y A     G+ + +FF  L+  +
Sbjct: 458 AAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILV-FV 516

Query: 489 KNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFK 541
             F V L     G K D ++F   Y+  P+++  +FGY  Y R    + P ++ DL   +
Sbjct: 517 AQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHR 576

Query: 542 ELIDLEEEEGKLWDAAQKEKMES 564
            + D E    +  D   KEK+ +
Sbjct: 577 RIYDPELMRQE--DEENKEKLRN 597

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  246 bits (628), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 168/589 (28%), Positives = 284/589 (48%), Gaps = 43/589 (7%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVEN--LDLSNQDDISSQESHLNIDGK---HDGIR------ 54
           DS+++  E    NS  +S  +      +S  D  S  ++ LN  G      GI+      
Sbjct: 78  DSFKR-AEGSHPNSPDSSNSIGGGATPISTNDSSSQLDNELNPKGSFVTESGIKQPSQEQ 136

Query: 55  ------LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVM 108
                 LKK ++ RH+ M                       P  ++I Y+ +G  +Y ++
Sbjct: 137 DQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCII 196

Query: 109 TCLGEMATYIP--LDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWV 166
              GE+A      + GF +Y S   DPALGF+V + Y  ++L + P +L  A++ ++YW 
Sbjct: 197 QACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWT 256

Query: 167 SREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGP 226
              KV+P V++ IF V+I+ IN            + +  K+L+++   +L  +I  GG  
Sbjct: 257 V--KVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAG 314

Query: 227 SHDRLGFRFYKDPGAFRPYSEAISGSKG--KFVSFVAVFVYALFAYLGTELCGIVAAECK 284
           +   +G R++ +PGAFR       G+ G  +F   VA FV A FA+  +E   + A+E  
Sbjct: 315 TDGYIGSRYWHNPGAFR-------GNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQS 367

Query: 285 NPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKN 344
           NPR+ +P A K  +YRI+  +L ++ L+G  V Y    LL            P+V+A+ +
Sbjct: 368 NPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLL--GASGSATKASPYVIAVAS 425

Query: 345 AGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLI 404
            G+ V+PH  NA +L+ V S  N   Y +SR L  LA    APK F   ++ G P  +++
Sbjct: 426 HGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAML 485

Query: 405 LCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTL 464
           +  +F ++A+   S     VF + + +  +  L +WI I +++I F RA++ QG     +
Sbjct: 486 VSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEV 545

Query: 465 AYAAPLASKGAYFALFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIGIPVFIICFF 519
            Y + +   G+ +A+    L ALI  F V +     G K   ++F   Y+ +P+ I  + 
Sbjct: 546 GYKSQVGIWGSMYAIVMMVL-ALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYV 604

Query: 520 GYKYIRG--TKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
            YK  +   T F+  ++ DL T +++ D  EE  K  D   +EK+ + P
Sbjct: 605 FYKVWKKDWTLFIPADKIDLVTDRQIFD--EELLKQEDEEYQEKLRNGP 651

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  244 bits (624), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 166/568 (29%), Positives = 278/568 (48%), Gaps = 30/568 (5%)

Query: 22  TSKDVENLDLSNQDDISSQESHLNIDGKH---DGIRLKKELEARHVSMXXXXXXXXXXXX 78
           ++K    +  +  D  SS+ S  N D +    +   L K+L  RH+              
Sbjct: 50  STKGSPGMKQTTNDITSSERSRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLY 109

Query: 79  XXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGF 137
                      P S++I +  +G  ++ V+  LGE++   P+  GF  Y  R+ +P+  F
Sbjct: 110 VNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAF 169

Query: 138 AVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXX 197
           AV  +YL ++L++ P +L AA++ ++YW   +K+N   W+ IF   I   N         
Sbjct: 170 AVNLNYLAQWLVLLPLELVAASITIKYW--NDKINSDAWVAIFYATIALANMLDVKSFGE 227

Query: 198 XXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFV 257
               LS  K+L ++   +L  V+  GGGP    +G +++++PGAF  ++     S  KF 
Sbjct: 228 TEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHN-----SGTKFK 282

Query: 258 SFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVA 317
              +VFV A F+Y G E+  + AAE KNPR  +P+A K T + I   Y+  + L+G  V 
Sbjct: 283 GLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVP 342

Query: 318 YNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSL 377
            NDP LL            P V+AI+N  I  LP + NA +L+ V S  NS +Y  SR +
Sbjct: 343 SNDPRLLNGSSSVDAASS-PLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCM 401

Query: 378 YGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 437
             +A     PK   + +K G P N+++L + F LL+++  S+  A+VF +   +  +  +
Sbjct: 402 VAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTI 461

Query: 438 MSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL-- 495
             W+AI +++I F +A++ Q      L + +     G+++  F    + LI +F   L  
Sbjct: 462 FCWMAINLSHIRFRKAMKVQERSLDELPFISQTGVLGSWYG-FVVLFLVLIASFWTSLFP 520

Query: 496 --GHKFDYKNFITGYIGIPVFIICFFGYK-YIRG-TKFVKPEEADLYTFKELIDLEEEEG 551
                   ++F  GY+  P+ I+C+FG+K Y R  T  VK E+ DL T ++ +DL     
Sbjct: 521 IGSSGASAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDL----- 575

Query: 552 KLWDAAQKEKMESSPKNF--KWFYEKFL 577
                 ++E+M+   +N   K F  +FL
Sbjct: 576 ----TLRREEMKIERENLAKKSFITRFL 599

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  244 bits (623), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/500 (30%), Positives = 253/500 (50%), Gaps = 17/500 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK  L+ RH+ M                       P  ILI +   G ++Y ++  +GE+
Sbjct: 79  LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGEL 138

Query: 115 ATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+  GFT+YA+R+ D + GFA  + Y+ ++L++ P ++ AA++ + YW +  K   
Sbjct: 139 AVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 198

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F V+IV IN              S  KV+ ++  I++  V++ GGG  H  +G 
Sbjct: 199 G-FVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGA 257

Query: 234 RFYKDPGAFRPYSEAISGSKGK-FVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
           +++ +PGAF      +  + G+ F  F  VFV A F++ G+EL G+  +E + PR++VP 
Sbjct: 258 QYWYNPGAF------VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPG 311

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K   +RI +FY++ + L+GM V  + P L+            PFV+AI N GI  LP 
Sbjct: 312 AAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAAS--PFVIAIVNHGIKGLPS 369

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           + N  +L+ V S  NS +Y  SR+L  LA     P I    ++ G P   + +   F L+
Sbjct: 370 VVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLI 429

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           A++  S     VFN+ + +  +  L +W  I + +I +  AL AQG     L + AP   
Sbjct: 430 AFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGV 489

Query: 473 KGAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK 528
            G+Y+  FF C++  I  F V L   G K +  +F   Y+   +FI  +  +K + R  K
Sbjct: 490 WGSYWG-FFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNWK 548

Query: 529 -FVKPEEADLYTFKELIDLE 547
            F+  ++ D+ T +  +DL+
Sbjct: 549 LFIPLKDLDIDTGRREVDLD 568

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  244 bits (622), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 161/564 (28%), Positives = 284/564 (50%), Gaps = 33/564 (5%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVS 65
           DS +KDL      S + +K +ENLD ++Q+ +  Q++  N           K+L  RH+ 
Sbjct: 40  DSKQKDLM-----SGSETKALENLDSTSQE-VEDQDARYN-----------KDLSVRHLL 82

Query: 66  MXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFT 124
                                   P S++I +  +   ++ ++  LGE+++  P+  GF 
Sbjct: 83  TLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFN 142

Query: 125 SYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVII 184
            Y SR+ +P+ GFAV  +YL ++ ++ P +L AA+L ++YW     +N   W+ IF  II
Sbjct: 143 VYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW--NHTINSDAWVAIFYTII 200

Query: 185 VTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRP 244
           +  N             LS  K+L ++   +L  V+  GGGP    +G +++ +PGAF  
Sbjct: 201 LLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAFVG 260

Query: 245 YSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVF 304
           ++     +  +F    +VFV A F+Y GTEL  + AAE  NPR  +P+A K T + I V 
Sbjct: 261 HT-----AGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVC 315

Query: 305 YLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFS 364
           Y+V + L+G  V+ +DP LL            P V+AI+N GI  LP + NA +L+ V S
Sbjct: 316 YIVVLTLVGCLVSSDDPRLLNGSSSVDVAAS-PLVIAIENGGIKGLPSLMNAIILIAVLS 374

Query: 365 ACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQV 424
             NS +Y  SR +  +A     PK+F   ++ G P  +++  ++F LL+++  S    +V
Sbjct: 375 VANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEV 434

Query: 425 FNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCL 484
           F +   +  +  L  W AI +++I F R ++ +G     L + +     G+Y+      +
Sbjct: 435 FTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFI 494

Query: 485 IALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYT 539
           + ++  +T      G   + ++F   Y+  P+ + C+FG+K Y R  + + P +E DL +
Sbjct: 495 VLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDS 554

Query: 540 FKELIDLE--EEEGKLWDAAQKEK 561
            +  +DLE  ++E ++ + A ++K
Sbjct: 555 GRRAVDLELMKDEKRIEEQAMRQK 578

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  244 bits (622), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 168/567 (29%), Positives = 273/567 (48%), Gaps = 28/567 (4%)

Query: 17  SNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXX 76
           S  N T+ D+ +    + DD   QE   N +       L KEL  RH+            
Sbjct: 55  SGVNQTTNDITSSGRFHSDDDVQQEDINNTN-------LSKELSVRHLLTLAVGGAIGTG 107

Query: 77  XXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPAL 135
                        P S++I +  +   ++ V+  LGE++   P+  GF  Y+ R+ +P+ 
Sbjct: 108 LFVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSF 167

Query: 136 GFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXX 195
            FAV  +YL ++L++ P +L AA++ ++YW   +K+N   W+ IF   I   N       
Sbjct: 168 AFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKINSDAWVAIFYATIAMANMLDVKSF 225

Query: 196 XXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGK 255
                 LS  K+L ++   +L  V+  GGGP    +G +++ DPGAF  +      S  K
Sbjct: 226 GETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAFVGHD-----SGTK 280

Query: 256 FVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMT 315
           F    +VFV A F+Y G E+  + AAE KNPR  +P+A K T + I + Y+  + L+G  
Sbjct: 281 FKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCL 340

Query: 316 VAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASR 375
           V  NDP LL            P V+AI+N  I  LP + NA +L+ V S  NS +Y  SR
Sbjct: 341 VPSNDPRLLNGSSSVDAASS-PLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSR 399

Query: 376 SLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIF 435
            +  +A     PK   + +K G P N+++L + F LL+++  S   A+VF +   +  + 
Sbjct: 400 CMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLS 459

Query: 436 GLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAY--FALFFCCLIALIKNFTV 493
            +  W+AI +++I F +A++ Q      L + +     G+   F + F  LIA       
Sbjct: 460 TIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMF 519

Query: 494 FLGHK-FDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEADLYTFKELIDLEEEE 550
            +G    + ++F  GY+  P+ I+C+FG+K Y R  +  VK E+ DL T ++ +DL    
Sbjct: 520 PIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRR 579

Query: 551 GKLWDAAQKEKMESSPKNFKWFYEKFL 577
                  Q+ K+E      + F  +FL
Sbjct: 580 -------QEMKIEQETLAKRSFLTRFL 599

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  243 bits (620), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 163/581 (28%), Positives = 283/581 (48%), Gaps = 32/581 (5%)

Query: 10  KDLEKIVSNSNTTSKDVENLDLSNQD-------DISSQESHLNIDGKHDGIRLKKELEAR 62
           +D + I+   ++T   + +L L   D       D +S  S+ ++      + L K L  R
Sbjct: 22  EDEKSILEGKSSTQSSLLDLTLKKCDNGIEVVNDATSTVSNASVTN----VNLNKNLSIR 77

Query: 63  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-D 121
           H+                         P S++I +  +   ++ V+  LGEMA   P+  
Sbjct: 78  HLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAFPVVG 137

Query: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
           GF  Y +R+ DP++GFAV  +YL ++L++ P +L AA++ ++YW   + +N   W+ IF 
Sbjct: 138 GFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NDTINSDAWVAIFY 195

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
            +I   N             LS  K+L ++   +L  V+  GGGP    LG +++ +PG+
Sbjct: 196 AVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGS 255

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
           F  ++     S  KF    +VFV A F+Y G E+  + AAE K+PRR +P+A K T + I
Sbjct: 256 FVGHT-----SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLI 310

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
              Y+  + L+G  V Y++P LL            P V+AI+N GI  LP + NA +L+ 
Sbjct: 311 TASYITILTLIGCLVPYDEPRLLSGSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILIS 369

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
           + S  NS +Y  SR +  +A     P++    +K G P N+++  + F LL+++  S   
Sbjct: 370 IISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQ 429

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
           A+VF +   +  +  +  W+AI I++I F +A++ Q      L Y +     G+++ +  
Sbjct: 430 AEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIV 489

Query: 482 CCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK--YIRGTKFVKPEEAD 536
             L+ ++  +T      G   D ++F  GY+  P+ I C+ G+K  Y +    V  E+ D
Sbjct: 490 LFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMD 549

Query: 537 LYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFL 577
           + T +  +DL     ++     KE+ E   K+   F+ +FL
Sbjct: 550 IDTGRRQVDLTIRRQEM-----KEEQEHLAKSS--FFARFL 583

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  242 bits (618), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 165/570 (28%), Positives = 274/570 (48%), Gaps = 35/570 (6%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIR--LKKELEARH 63
           DS    L K V     ++  V+N +++  D IS   + L     HD IR  L + L  RH
Sbjct: 9   DSRDTGLLKNVVKDPKSAPVVQNYEVTPLDSISDAVTDLE---DHDKIRESLNRSLSPRH 65

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG- 122
           ++M                       P S+ I Y+ +G +VY+ M CLGEM+T++P+ G 
Sbjct: 66  INMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEMSTFMPISGS 125

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT--IF 180
           F SYA ++   +  FA+  +Y F   +   + LTA  LVL YW S +   P  W    +F
Sbjct: 126 FCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFP-YWAASLLF 184

Query: 181 LVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPG 240
            V ++ +N            WL+  KV+ ++   +L  V+ +G  P H+ +GF+++    
Sbjct: 185 WVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYIGFKYWS--- 241

Query: 241 AFRPYSEA--ISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTL 298
               Y EA  ++G KG    FV +FV + F+Y GTE   + A E +NP RN PR +K   
Sbjct: 242 ----YKEAPFVNGFKG----FVTIFVSSAFSYGGTESITLTAGEARNPIRNTPRIVKTVF 293

Query: 299 YRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 358
           +RI++FY+ T+F + M + Y+ P L             PF +  + AG        NA +
Sbjct: 294 WRILIFYVATMFFISMNIPYDYPNL-----STKSVMTSPFTIIFQMAGTKAAGSFMNAVI 348

Query: 359 LMFVFSACNSDLYVASRSLYGLAIDNKA-PKIFAKTNKWGVPYNSLILCILFCLLAYMNV 417
           L  + SA N  L+  SR LY + ++    PK+  KTN++  PY ++IL      L +   
Sbjct: 349 LTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGLCFGAS 408

Query: 418 SSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYF 477
             G+  ++ +  N+V +   ++W++I +T I F + L  QG  +  L +       G YF
Sbjct: 409 FIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQE-LQFKNWTYPYGPYF 467

Query: 478 ALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADL 537
            + F  LI L++ ++ F    +   +F + Y+ + VF  C+  +   +  +FVKPE+ D 
Sbjct: 468 LVIFVTLIILVQGWSAF--DPWSTSDFFSYYLELFVFPTCWLIWWIFKRDRFVKPEDMDF 525

Query: 538 YTFKELIDLEEEEGKLWDAAQKEKMESSPK 567
            T + +   +E E    +  + + +E  PK
Sbjct: 526 ITDRYIQSPQEIE----ENERLDNLEGYPK 551

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  244 bits (622), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 164/570 (28%), Positives = 269/570 (47%), Gaps = 28/570 (4%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVS 65
           D+   D E+ + N  TTS      +L   + + +          +D   LK+ +  RHV 
Sbjct: 87  DAAELDYEQALENGITTSVSPSAPNLRKLNQLRTPTD------ANDNKALKQTIRPRHVV 140

Query: 66  MXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA---TYIPLDG 122
           M                       P  ++I YS +G ++Y ++   GEMA   + +P  G
Sbjct: 141 MISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEMAIAYSNLP-GG 199

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182
           +  Y S   +   GFA+ + Y  ++L + P +L  A+L ++YW +   VN  +++ IF  
Sbjct: 200 YNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTT--SVNSDIFVAIFYA 257

Query: 183 IIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAF 242
           +I+ IN            + +  KVL+M+   +L   I  GG  +   LG  ++  PGAF
Sbjct: 258 LIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYLGGLYWHTPGAF 317

Query: 243 RPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302
           R  S     S   F       V A FAY GTE   + AAE  NPR  +P A K  LYRI+
Sbjct: 318 RGDS-----SIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPSAAKKVLYRII 372

Query: 303 VFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFV 362
             YL++I ++G  V ++   LL            P+V+A    G+ V+PH  NA +L+ V
Sbjct: 373 CVYLISILMIGFLVPFDSTRLLGSDGSATSAS--PYVLAASLHGVRVVPHFINAVILISV 430

Query: 363 FSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSA 422
            S  NS  Y +SR L  LA    APK F   ++ G P  ++++  LF ++A+   S    
Sbjct: 431 LSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVIAFCAASPKET 490

Query: 423 QVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFC 482
           +VF + + +  +  L +W AI +++I F  A++ QG     + Y A     G+++ALF  
Sbjct: 491 EVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSWYALFMM 550

Query: 483 CLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYK--YIRGTKFVKPEEAD 536
            LI  I  F V +      +   +NF   Y+ +P+ I+ + GYK  Y   T  +K E+ D
Sbjct: 551 FLI-YIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWTLLIKAEDID 609

Query: 537 LYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
           L + +++ D  E+  K  D   ++++++ P
Sbjct: 610 LQSHRQIFD--EDLLKEEDFEYRQRLKNGP 637

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  242 bits (617), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 165/523 (31%), Positives = 262/523 (50%), Gaps = 17/523 (3%)

Query: 22  TSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXX 81
           +SKD     +S    I S   H N      G  L K+L+ RH+                 
Sbjct: 46  SSKD-SGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIRHLLTLAIGGSIGTGLFVNS 104

Query: 82  XXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVG 140
                   P S++I +  +   ++ V+  LGE+A   P+  GF  Y +R+ DP+  FAV 
Sbjct: 105 GTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFAFAVN 164

Query: 141 YSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXX 200
            +YL  +++  P +L AA++ ++YW    ++N   W+TIF V I  +N            
Sbjct: 165 LNYLILWIVSLPLELVAASITIRYW--NREINSDAWVTIFFVFIALLNMMDVKFFSEAEF 222

Query: 201 WLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFV 260
            +S  K+L ++   +L  V+ +GGGP+   +G +++ DPGAF   S   +GS+  F    
Sbjct: 223 VMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAFHGDS---AGSR--FKGLC 277

Query: 261 AVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYND 320
           +VFV A F+Y G E+  + AAE KNPR+ +P+A K T + I   Y+  + L+G+ V YND
Sbjct: 278 SVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVPYND 337

Query: 321 PLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGL 380
             LL            P V+AI+NAGI  LP + NA +L+ + S  NS +YV SR +  +
Sbjct: 338 KRLLSGSSSVDASAS-PLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVSM 396

Query: 381 AIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSW 440
           A+ N  PK+F+K +K G P  S+   +   LL+++  S    +VF +   +  +  +  W
Sbjct: 397 ALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFCW 456

Query: 441 IAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----G 496
           I I + +I F  AL+ Q      LAY +     G+++ +    L+ LI +F V L     
Sbjct: 457 IGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLV-LIASFWVSLFPVGE 515

Query: 497 HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADL 537
              D + F  GY+  P+ I  + G+K YI+  K+V P EE D+
Sbjct: 516 SSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEIDI 558

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  242 bits (618), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 167/589 (28%), Positives = 289/589 (49%), Gaps = 31/589 (5%)

Query: 5   QDSYRKDLEKIVSNSNTTS--------KDVENLDLSNQDDISSQESHLNIDGKHDGIRLK 56
             SY     +I  +  T+S           + ++L + D   +Q   + I        L+
Sbjct: 24  HSSYETGSGEITDSKPTSSGSRWQDFVDGFKRVELGDLDPNLTQAEKVAIATARS--PLQ 81

Query: 57  KELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMAT 116
           + L+ RH+ M                       P ++LI +  +G ++Y V+  +GE+A 
Sbjct: 82  RHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGELAV 141

Query: 117 YIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGV 175
             P+  GFT+Y  R+ D + GFA+ Y Y+ ++L++ P ++ AA++ + YW +  K   G 
Sbjct: 142 TFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRDG- 200

Query: 176 WITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRF 235
           ++ +F V+IV IN              S  KV  ++  I+L  V++ GGGP    +G ++
Sbjct: 201 FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGKY 260

Query: 236 YKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIK 295
           + +PGAF         +  +F +  +VFV A F++ GTEL G+ AAE +NPR+ +PRA K
Sbjct: 261 WHNPGAFNG-----DNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRAAK 315

Query: 296 LTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFN 355
              +RI +FY++++ L+G+ V Y    L+            PFV+AIK  GI  LP + N
Sbjct: 316 QVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAAS--PFVLAIKTHGISGLPSVIN 373

Query: 356 ACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYM 415
             +L+ V S  NS +Y  SR+L  LA     P+IF+  ++ G P   ++    F LL ++
Sbjct: 374 VVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLCFI 433

Query: 416 NVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGA 475
             S     VFN+ + +  +  L +W  I I ++ F RAL AQG     LA+ + +   G+
Sbjct: 434 AQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVWGS 493

Query: 476 YFALFFCCLIALIKNFTVF---LGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVK 531
           YF +   CL+  I  F +    +G   +  +F   Y+ + V +  +  +K Y R   F K
Sbjct: 494 YFGVILICLV-FIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFAK 552

Query: 532 -PEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGW 579
             ++ D+ T +  +DL+  + ++  A +K ++ + P    W+Y  +  W
Sbjct: 553 RAKDIDIDTGRRELDLDALKQEI--AEEKLRLSTKP----WWYRVYHLW 595

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  243 bits (621), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 170/584 (29%), Positives = 293/584 (50%), Gaps = 35/584 (5%)

Query: 9   RKDLEKIVSNSNTTSKD-----VENLDLSNQDDISSQ-ESHL-NIDGKHDGIRLKKELEA 61
            K  E+ + NS+ +S+      V++    ++   +S  ES L  + G++    LK+ ++ 
Sbjct: 66  EKTQEETIHNSDGSSRSPFGKFVDSFKRVDEKQTTSDLESGLGEVPGENS--DLKQTIKK 123

Query: 62  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA---TYI 118
           RHV +                       P  ++I YS +G  +Y ++   GE+A   + +
Sbjct: 124 RHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGELAVCYSSL 183

Query: 119 PLDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
           P + F  Y +   D A GFAV + Y  ++L + P +L  A++ ++YW +   VNP ++++
Sbjct: 184 PSN-FNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVNPDIFVS 240

Query: 179 IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           IF V+I+ IN            + +S KVL+M    +L  +I  GG  +   +G +++  
Sbjct: 241 IFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYIGAKYWHS 300

Query: 239 PGAF---RPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIK 295
           PGAF   RP           F   +A F  A FA+  +E   + AAE  NPR+ +P+A K
Sbjct: 301 PGAFNGNRPIDH--------FKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAIPKAAK 352

Query: 296 LTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFN 355
           + +YRI+  +L +I L+G  V YN P LL            P+VVA+ + G+ V+PH  N
Sbjct: 353 MMIYRILFVFLSSITLIGFLVPYNSPYLL--GSGSDATKASPYVVAVASHGVRVVPHFIN 410

Query: 356 ACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYM 415
           A +L+ V S  NS  Y +SR L  LA    APK+F   +K G P  +++   LF  +A+ 
Sbjct: 411 AVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAFC 470

Query: 416 NVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGA 475
             S    QVF + + +  +  L +W+AI I+++ F RAL+ QG     + + + +   G+
Sbjct: 471 AASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGIYGS 530

Query: 476 YFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFV 530
            +A     ++ALI  F V L    G+  D +NF   Y+ +P+ ++ +FGYK   R  KF 
Sbjct: 531 LYAATM-LILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKRDWKFW 589

Query: 531 KP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFY 573
            P    DL + +++ D +  + ++ +  Q++K  S+ +  + F+
Sbjct: 590 IPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNLSTGRKIQEFF 633

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  244 bits (622), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 161/588 (27%), Positives = 279/588 (47%), Gaps = 38/588 (6%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQD-DISSQESHLNI-----------------D 47
           DS+++      S+S      VEN  +   D D+ +++S+L+I                 +
Sbjct: 83  DSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVE 142

Query: 48  GKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIV 107
            + +  +LK+ ++ RHV M                       P  ++I Y  +G  +Y +
Sbjct: 143 QQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCI 202

Query: 108 MTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYW 165
           +   GE+A  Y  ++G F ++ S   DP   FAV + Y  ++L + P +L  +++ ++YW
Sbjct: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262

Query: 166 VSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGG 225
            +  KV+P V++ IF V+I+ IN            + +  KV++M+   ++   I  G  
Sbjct: 263 TT--KVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA 320

Query: 226 PSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKN 285
            +   +G +++ DPGAFR  ++       +F   +  FV A FA+  TE   + AAE  N
Sbjct: 321 GTDGYIGAKYWNDPGAFRGQTKI-----ERFKGVMDTFVTAAFAFGATEFIALTAAEQSN 375

Query: 286 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNA 345
           PR+ +P A K   YRI++ +L +I L+G  V YN   L+            P+V+A    
Sbjct: 376 PRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSAS--PYVLAASLH 433

Query: 346 GIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLIL 405
           G+ V+ H  NA +L+ V S  NS  Y +SR L GLA    APK F   ++ G P  S++ 
Sbjct: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493

Query: 406 CILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLA 465
             +  ++A+   S     VF + + +  +  + +W AI +++I F R ++ QG     L 
Sbjct: 494 AAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553

Query: 466 YAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGY 521
           + A     G+Y+A      +AL+  F V L     H  D +NF   Y+ +P+ +  + G+
Sbjct: 554 FRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGF 612

Query: 522 KYIRGT--KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPK 567
           K  R     F++ +  DL + + + D  EE  +  D   KEK+ + PK
Sbjct: 613 KLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLRNGPK 658

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  243 bits (620), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 155/556 (27%), Positives = 274/556 (49%), Gaps = 31/556 (5%)

Query: 30  DLSNQ--DDISSQESHLNIDG--------KHDGIRLKKELEARHVSMXXXXXXXXXXXXX 79
           D S+Q  ++++ + S++ +DG        +     LKK ++ RH  M             
Sbjct: 110 DSSSQLDNELNRKSSYITVDGIKQAPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLV 169

Query: 80  XXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP--LDGFTSYASRYCDPALGF 137
                     P  ++I Y+ +G  VY ++   GE+A      + GF +Y     DPALGF
Sbjct: 170 GNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGF 229

Query: 138 AVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXX 197
           +V + +  ++L + P +L  A++ ++YW    KV+P V++ IF V+I+ IN         
Sbjct: 230 SVAWLFCLQWLCVCPLELVTASMTIKYWTV--KVDPDVFVVIFYVLIIVINVFGAKGYAE 287

Query: 198 XXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFV 257
              + +  K+L+++   +L  +I  GG  +   +G ++++DPGAFR  +        +F 
Sbjct: 288 ADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPI-----QRFK 342

Query: 258 SFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVA 317
             VA FV A FA+  +E   + A+E  NPR+ +P A K  +YRI+  +L ++ L+G  V 
Sbjct: 343 GIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVP 402

Query: 318 YNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSL 377
           Y    LL            P+V+A+ + G+ V+PH  NA +L+ V S  NS  Y +SR L
Sbjct: 403 YTSDQLL--GAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRIL 460

Query: 378 YGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 437
             LA    APK F   ++ G P  ++++  LF ++A+   S     VF + + +  +  L
Sbjct: 461 MSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQL 520

Query: 438 MSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL-- 495
            +WI I +++I F RA++ QG     + Y + +   G+ +A+    ++ALI  F V +  
Sbjct: 521 FTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLM-MMLALIAQFWVAIAP 579

Query: 496 ---GHKFDYKNFITGYIGIPVFIICFFGYKYIRG--TKFVKPEEADLYTFKELIDLEEEE 550
              G K   ++F   Y+ +P+ I  +  +K  +   + F+   + DL + + + D  EE 
Sbjct: 580 IGGGGKLSAQSFFENYLAMPILIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFD--EEL 637

Query: 551 GKLWDAAQKEKMESSP 566
            K  D   KE++ + P
Sbjct: 638 LKQEDEEYKERLRNGP 653

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  241 bits (615), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 167/574 (29%), Positives = 285/574 (49%), Gaps = 37/574 (6%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHV 64
           +DS++   E +V++           D+S+ + I+ + +H           LK  L+ RH+
Sbjct: 51  KDSFKPLDEAVVTD-----------DMSDIEKIAHRTAHAP---------LKHHLKNRHL 90

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-F 123
            M                       P  ILI +   G ++Y ++  +GE++   P+ G F
Sbjct: 91  QMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFPISGGF 150

Query: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183
           T+YA+R+ D + GFA  ++Y+ ++L + P ++ AA++ + YW +  K   G ++ +F V+
Sbjct: 151 TTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDG-FVALFWVV 209

Query: 184 IVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243
           IV IN              S  KVL ++  I++  V+  GGGP    +G +++ DPGAF 
Sbjct: 210 IVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAF- 268

Query: 244 PYSEAISGSKG-KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302
                +  + G +F    +VFV A F++ G+EL GI AAE   PR++VP+A K   +RI 
Sbjct: 269 -----VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRIT 323

Query: 303 VFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFV 362
           +FY++++ ++G+ V Y D  L+            PFV+AI + GI  LP + N  +L+ V
Sbjct: 324 LFYMLSLLMVGLLVPYTDERLIGASSVDAAAS--PFVIAITSHGIRGLPSVVNVVILIAV 381

Query: 363 FSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSA 422
            S  NS +Y  SR+L  LA  N  PKIF   ++ G P   +     F L+A++  S    
Sbjct: 382 LSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEG 441

Query: 423 QVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFC 482
           +VF + + +  +  L +W  I   +I F  AL AQG     L + AP    G+ + LF  
Sbjct: 442 EVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMI 501

Query: 483 CLIALIKNFTVFL--GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLY 538
            L+ + + +      G K   + F   Y+  PV +  +FG+K Y R  K + P  + D+ 
Sbjct: 502 VLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDID 561

Query: 539 TFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWF 572
           T +  +DL+    ++  A +K+ M + P  ++W+
Sbjct: 562 TGRREMDLDVLRQEI--AEEKQMMSTRPWWYRWY 593

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  241 bits (615), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 159/531 (29%), Positives = 272/531 (51%), Gaps = 21/531 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           L+  L+ R  +M                       P  ++I +     ++Y ++  LGE+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 115 ATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+  GFT+YA+R+ D + G+A  ++Y  ++L++ P ++ +A++ + YW +  +   
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F ++IV IN              S  KV  ++  I+L  V++ GGGP    +G 
Sbjct: 223 G-FVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGA 281

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPGAF  +     GS  +F    +VFV A F++ G+EL GI AAE  NPR+++P A
Sbjct: 282 KYWHDPGAFVGH-----GSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGA 336

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K  ++RIV+FY+ T+ ++G+ V YND  L+            PFV+AI   GI  LP +
Sbjct: 337 AKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAAS--PFVIAIVTHGIKGLPSV 394

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS ++  SR++  L+     PK+F   ++ G P   + +   F LLA
Sbjct: 395 INVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLA 454

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S    +VFN+ + +  +  L +W  I + +I F  AL+AQG D + L + +P    
Sbjct: 455 FVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVA 514

Query: 474 GAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK- 528
           G+Y+ LF   L+  I  F V L   G K D + F   Y+  P+ +  +FG+K Y R  K 
Sbjct: 515 GSYWGLFMIVLM-FIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKL 573

Query: 529 FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGW 579
           F+  E+ D+ T +   D+E  + ++ +  +K  + S P    W+   +  W
Sbjct: 574 FIPLEDMDIDTGRRETDMELLKQEIME--EKAILASKP----WYIRAYAFW 618

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  241 bits (614), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 165/579 (28%), Positives = 286/579 (49%), Gaps = 34/579 (5%)

Query: 6   DSYRKDLE-KIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHV 64
           DS+R+  + +I+ N        E++  +   +IS+ ++ +N        +LKK ++ RHV
Sbjct: 56  DSFRRAEDVRILPNEMNPILSHESVFDTAVVEISAVDNQINE-------KLKKTIQPRHV 108

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPL-DG 122
            M                       P  ++I Y+ +   +Y VM  +GEMA  Y+ L  G
Sbjct: 109 IMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGG 168

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182
           F++Y     DP L FAV + Y  ++  + P +L  A++ +QYW +  KVN  +++ IF +
Sbjct: 169 FSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTT--KVNADIFVLIFYL 226

Query: 183 IIVTINXXXXXXXXXXXXWLSSF-KVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
           +++ IN            +  +  K+L+M    +L  +++ GG  +   +G R++  PGA
Sbjct: 227 LMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGFIGARYWHSPGA 286

Query: 242 FRPYSEAISGSKG--KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLY 299
           FR       G  G  +F   V+  V A FA+ GTE   I A+E  NPR+ +P A K  +Y
Sbjct: 287 FR-------GDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRKAIPSAAKKVIY 339

Query: 300 RIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVL 359
           R ++ Y+ +I ++G  V YN   LL            P+V+A+ + GI V+PH  NA +L
Sbjct: 340 RALIIYVGSIIIVGFLVPYNSSELLGSSGPATKAS--PYVIAVASHGIRVVPHFINAVIL 397

Query: 360 MFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSS 419
           + VFS  +S  Y +SR L  LA    APKIF   +K G P    ++  +  ++++   SS
Sbjct: 398 ISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAIIAIISFCACSS 457

Query: 420 GSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFAL 479
             A VFN+ +++  +  + +W  I +++I F RA++ QG     + + +     G+ +A 
Sbjct: 458 KEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKSQAGVWGSVYA- 516

Query: 480 FFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPE 533
           F   ++ LI  F V +        D  +F   Y+ +PVFI+ +FGYK + R  + F++ +
Sbjct: 517 FVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIWNRDWRLFIRAK 576

Query: 534 EADLYTFKELID---LEEEEGKLWDAAQKEKMESSPKNF 569
             DL   + + D   L +E  ++ + A+   +     NF
Sbjct: 577 NIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYNF 615

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  240 bits (613), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 178/606 (29%), Positives = 283/606 (46%), Gaps = 59/606 (9%)

Query: 4   IQDSYRKDLEKIVSNSNTTS--------------KDVENLDLSNQDDISSQESHL----- 44
           I  S  K  + IVS S TT+              K   ++D S +  + S E +      
Sbjct: 6   IVSSEEKISDVIVSESTTTTGSNFPSNQRNDSGFKSFNDIDTSERTSVESSEVYRSGRIR 65

Query: 45  --------------NIDG-----KHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXX 85
                         +IDG       DGI LKK+++ RHV M                   
Sbjct: 66  RWIDSYKRAEHPREHIDGFEDGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGL 125

Query: 86  XXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTSYASRYCDPALGFAVGYSY 143
               P  ++I Y  V F+ Y ++   GE+A   P     F SY         GFA  +  
Sbjct: 126 HFAGPAPLVIGYGMVSFVTYFMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLA 185

Query: 144 LFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLS 203
             ++L + P +  AA+L ++YW   ++++  V++ IF V ++ I+              +
Sbjct: 186 AVQWLTVLPLEFIAASLTIKYW--NDRISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFN 243

Query: 204 SFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVF 263
             KVL+++  I+L  VI  GG  +   +G +++ DPGAF   +   +GS+ K V ++ V 
Sbjct: 244 LCKVLMIIGFIILSIVINAGGAGNDGYIGGKYWNDPGAF---AGETAGSRFKGVCYILVT 300

Query: 264 VYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLL 323
            Y  F+Y GTEL  +   E +NPR++ P+A K ++YRIV+ YL+T+ L+G  V YNDP L
Sbjct: 301 GY--FSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRL 358

Query: 324 LQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAID 383
           +            P+V+A    G+ ++PH  NA VL+ + S  NS LY A R +  LA  
Sbjct: 359 MGADDASGSHAS-PYVLAASIHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQ 417

Query: 384 NKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAI 443
             APKI A  ++ G P  SL +C LF L+ +   SS   QVF +   +  +  L +W A 
Sbjct: 418 GFAPKIMAYVDREGRPLVSLGICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAF 477

Query: 444 LITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKF 499
            I++I F  A++ QG D   + + A     G+++ LFF  L+     F V L      K 
Sbjct: 478 FISHIRFRWAMKLQGKDIKEVGFLASTGLYGSFYGLFFNILV-FAAQFWVALSPIGSKKV 536

Query: 500 DYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLEEEEGKLWDAA 557
             ++F   Y+  P+++  +FGY  + +   F+ P E  DL   + + D EE    + +  
Sbjct: 537 GAESFFESYLAFPIWLFFYFGYMVWAKDFTFLNPLESIDLDFHRRIYDPEE----MAEIN 592

Query: 558 QKEKME 563
           ++EK E
Sbjct: 593 RQEKEE 598

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  241 bits (616), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 165/589 (28%), Positives = 282/589 (47%), Gaps = 45/589 (7%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLD----LSNQDDISSQESHLNIDGKH---DGIR---- 54
           DS+R+        S+  S D  NL+    +S +D  S  ++ LN    +   DGI+    
Sbjct: 82  DSFRR-----AEGSHPNSPDSTNLNGSTPISTKDSSSRLDNELNPKSSYITVDGIKQSSQ 136

Query: 55  --------LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYI 106
                   LKK ++ RH  M                       P  ++I Y+ +G  VY 
Sbjct: 137 EQEPKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 107 VMTCLGEMATYIP--LDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQY 164
           ++   GE+A      + GF +Y S   DPA+GF+V + +  ++L + P +L  A++ ++Y
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 165 WVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGG 224
           W    KVN  V++ IF V+I+ IN            + +  K+L++    +L  +I  GG
Sbjct: 257 WTV--KVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGG 314

Query: 225 GPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECK 284
             +   +G R+++DPGAFR  +     S  +F   VA FV A FA+  +E   + A+E  
Sbjct: 315 AGTDGYIGSRYWRDPGAFRGDT-----SIQRFKGVVATFVTAAFAFGMSEQLAMTASEQS 369

Query: 285 NPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKN 344
           NPR+ +P A K  +YRI+  +L ++ L+G  V Y    LL            P+V+A+ +
Sbjct: 370 NPRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLL--GAAGSATKASPYVIAVSS 427

Query: 345 AGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLI 404
            G+ V+PH  NA +L+ V S  NS  Y +SR L  LA    APK F   ++ G P  ++I
Sbjct: 428 HGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMI 487

Query: 405 LCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTL 464
           +  +F ++A+   S     VF + + +  +  L +WI I +++I F + ++ QG     +
Sbjct: 488 VSAVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEV 547

Query: 465 AYAAPLASKGAYFALFFCCLIALIKNFTVFLG-----HKFDYKNFITGYIGIPVFIICFF 519
            Y + +   G+ +A+    L ALI  F V +       K   ++F   Y+ +P+ I  + 
Sbjct: 548 GYKSQVGVWGSAYAVVLMVL-ALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYI 606

Query: 520 GYKYIRG--TKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
            YK  +   + F+  ++ DL + + + D  EE  K  D   K+++ + P
Sbjct: 607 FYKVWKRDWSLFIPADKIDLVSHRNIFD--EELLKQEDEEYKDRLRNGP 653

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  240 bits (612), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 156/522 (29%), Positives = 268/522 (51%), Gaps = 17/522 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK +L+ RH+ M                       P S+LI +  +G ++Y ++  LGE+
Sbjct: 85  LKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGEL 144

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + GFA  ++Y+ ++L+  P ++ +A++ + YW +  K   
Sbjct: 145 AVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRD 204

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F ++IV IN              S  KV+ ++  I+L  ++  GGGP    +G 
Sbjct: 205 G-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGG 263

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPGAF     A      KF    +VFV A F++ G+EL G+ A+E  +PR++VP+A
Sbjct: 264 KYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKA 318

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K   +RI +FY++++ ++G+ V YND  L+            PFV+AI   GI  LP +
Sbjct: 319 AKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAAS--PFVIAIVTHGIKGLPSV 376

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS ++  SR+   LA     P+IFA  ++ G P   +I+     L+A
Sbjct: 377 VNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIA 436

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S+    VFN+ + +  +  L +W  I I +I F +AL +QG     L++ +P    
Sbjct: 437 FVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVW 496

Query: 474 GAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKF 529
           G+Y+ LF   +I  I  F V L         + F   Y+  P+ +  + G+K Y R  K 
Sbjct: 497 GSYWGLFM-IVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKL 555

Query: 530 VKPE-EADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFK 570
           + P  E D+ + +  +DLE  + ++  A +K  + + P  F+
Sbjct: 556 LIPAGEMDIDSGRREVDLELLKQEI--AEEKAILATKPAWFR 595

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  239 bits (611), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 165/558 (29%), Positives = 262/558 (46%), Gaps = 25/558 (4%)

Query: 24  KDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXX 83
           K  E   L    D+      +  D      +LKK +++RHV M                 
Sbjct: 49  KRAEQPPLKQDSDLEEDTDTIVTD-----TQLKKTMKSRHVVMMSLGTGIGTGLLVANAQ 103

Query: 84  XXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP-LDG-FTSYASRYCDPALGFAVGY 141
                 P  ++IAY  V F+ Y ++   GEMA   P L G F +Y S +     GFA  +
Sbjct: 104 GLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVW 163

Query: 142 SYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXW 201
            +  ++L + P +L  AA+ +QYW   + +N  V++ IF V ++ I+             
Sbjct: 164 LFFIQWLTVLPLELITAAMTVQYW--NDSINADVYVVIFYVFLLFIHFFGVKAYGETEFI 221

Query: 202 LSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVA 261
            +  K+L +   I+   V+ +GG  +   +G +++ DPGAF   + A     G+F     
Sbjct: 222 FNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAFTSDTNA-----GRFKGVCY 276

Query: 262 VFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDP 321
           V V A F+Y G EL  +   E +NPRR+ P A K ++YRIVV YL+T+ L+G  V  N  
Sbjct: 277 VLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSN 336

Query: 322 LLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLA 381
            L+            P+V+A    G+ V+PHI NA +L+ + S  NS LY A R +  LA
Sbjct: 337 ELM--GSGGSVTHASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALA 394

Query: 382 IDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWI 441
               APK     ++ G P  +LI+C +F ++ ++  SS   QVFN+   +  +  L +W 
Sbjct: 395 QQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWS 454

Query: 442 AILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG----H 497
            I+I++I F +A++ Q      + Y +P    G+YF +FF  L+  +  F V L      
Sbjct: 455 GIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLV-FVAQFWVALAPPMYT 513

Query: 498 KFDYKNFITGYIGIPVFIICFFGYKYIRG--TKFVKPEEADLYTFKELIDLEEEEGKLWD 555
           +     F   Y+  P+F   +FGY   +   T F   E  DL   + + D   E  K  D
Sbjct: 514 EMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYD--PELVKQED 571

Query: 556 AAQKEKMESSPKNFKWFY 573
             +KE +++SP   + +Y
Sbjct: 572 EEKKEMLKNSPMWKRMYY 589

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  241 bits (614), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 157/516 (30%), Positives = 261/516 (50%), Gaps = 18/516 (3%)

Query: 40  QESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSF 99
           +E  + I  K +   L+K ++ RHV M                       P  ++I Y+ 
Sbjct: 112 KEHDVAITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAI 171

Query: 100 VGFLVYIVMTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTA 157
           +G  +Y ++   GEMA +Y  L G F +Y +   D   GFAV + Y  ++L + P +L  
Sbjct: 172 MGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVT 231

Query: 158 AALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLL 217
           A++ + YW +  KVN  +++ IF V+I+ IN            + ++ KVL++    +L 
Sbjct: 232 ASMTIDYWTT--KVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILA 289

Query: 218 FVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCG 277
            +I  GG  +   +G +++ DPGAFR        S  +F   +A F  A FA+  +E   
Sbjct: 290 IIINAGGAGTSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMATFTTAAFAFGASEFIA 344

Query: 278 IVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXP 337
           I A+E  NPRR +P A K+ +YRI+  +L +I L+G  V Y+   L+            P
Sbjct: 345 IGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS--P 402

Query: 338 FVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWG 397
           +V+AI + G+ V+PH  NA +L+ V S  NS  Y + R L+ L+    AP+ F   ++ G
Sbjct: 403 YVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREG 462

Query: 398 VPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQ 457
            P  ++I+ ILF ++A+   SS   +VF + + +  +  + +W+AI +++I F RA+  Q
Sbjct: 463 RPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQ 522

Query: 458 GVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG----HKFDYKNFITGYIGIPV 513
           G   S L + + L   G+ +A      +ALI  F V +        D K+F   Y+ +P+
Sbjct: 523 GRSISELGFRSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPI 581

Query: 514 FIICFFGYK-YIRGTK-FVKPEEADLYTFKELIDLE 547
            I+ +FGYK Y R  K F++ +  DL T + + D E
Sbjct: 582 LIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAE 617

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  239 bits (610), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 158/521 (30%), Positives = 268/521 (51%), Gaps = 27/521 (5%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK+ L+ RH+ M                       P +++IA+   G +VY V+  LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A  +P+ G + SY SR+ +P+ GFA+ Y+YL   LI  P +L AA++ + YW    K   
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKY-A 207

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-LG 232
             ++ +F ++IV IN              S  KV  ++  I+L  V++ GGGPS +  +G
Sbjct: 208 DAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIG 267

Query: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
            R++ +PG F        G KG    F A+FV + F++ G+E+  + AAE +NPR+++PR
Sbjct: 268 ARYWYNPGGFA------HGFKG----FAAIFVTSAFSFAGSEMFALAAAETENPRKDLPR 317

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K   +RI +FY++++ L+G  V Y D  L             PFV+AI  AGI  LP 
Sbjct: 318 AAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASAS--PFVIAIARAGIKGLPS 375

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           + N  +L+ V S  N  +Y ASR++  LA     P+ F   ++ G P   ++LC +F LL
Sbjct: 376 VVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLL 435

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           ++++ SS   +VF++ + +  +     W +I + ++ F RAL  QG     L+Y    A 
Sbjct: 436 SFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYK---AQ 492

Query: 473 KGAYFALFFCCLIALIKNFTVF-----LGHKFDYKNFITGYIGIPVFIICFFGYK-YIRG 526
            G + +L+   LI ++  F  +     +G   +  +F + Y+ +PV I  +  +K Y R 
Sbjct: 493 TGIWGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRS 552

Query: 527 TKF-VKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
             F +K  + D+ T +  +DLE  + ++ +  +++ + S P
Sbjct: 553 WTFLIKSSDIDIDTGRREMDLELLKQEIQE--EQQYIRSKP 591

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  241 bits (615), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 167/572 (29%), Positives = 276/572 (48%), Gaps = 36/572 (6%)

Query: 6   DSYRKDLE--KIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           D Y  DLE  + V    TT +D E L    ++D +++              L++ ++ RH
Sbjct: 122 DIYIDDLENKQQVELIGTTIQDEELLPGQKKEDSNAE--------------LRQTIKPRH 167

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPLDG 122
           V M                       P  ++I Y  +G  +Y ++   GEMA  Y  L G
Sbjct: 168 VIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTG 227

Query: 123 -FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
            F ++ S   DP   FAV + Y  ++L + P +L  A++ +QYW +  KV+P V++ IF 
Sbjct: 228 SFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTT--KVDPDVFVVIFY 285

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
           V+I+ IN              ++ KVL++    +L   I  G   +   +G +++ DPGA
Sbjct: 286 VLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDPGA 345

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
           FR  ++       +F   +  FV A FA+  TE   + AAE  NPR+ +P A K  +YR+
Sbjct: 346 FRGQTKI-----ERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRV 400

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
           +V +L TI L+G  V Y+   LL            P+V+AI   G+ V  H  NA +L+ 
Sbjct: 401 LVIFLNTIILIGFLVPYDSDQLL--GSGGSATKASPYVLAISLHGVRVAQHFVNAVILIS 458

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
           V S  NS  Y +SR L  LA    APKIF   ++ G P  ++    +  ++A+   S   
Sbjct: 459 VISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKE 518

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
            +VF + + +  +  L +W AI ++++ F RA++ QG     + Y +     G+ +A   
Sbjct: 519 TEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSLYAAIM 578

Query: 482 CCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEA 535
             ++ALI  F V L     H  D  +F + Y+ +P+ I+ +FGYK + R  + F++ ++ 
Sbjct: 579 -MILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRLFIRAKDI 637

Query: 536 DLYTFKELIDLEEEEGKLWDAAQKEKMESSPK 567
           DL + + + D  EE  +  D   +EK+ + PK
Sbjct: 638 DLISHRTIYD--EELLRQEDEEYREKLRNGPK 667

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  239 bits (610), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 168/553 (30%), Positives = 273/553 (49%), Gaps = 23/553 (4%)

Query: 32  SNQDDISSQE-SHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXP 90
           S  + +S ++   L  D       LK+ ++ RHV M                       P
Sbjct: 63  STHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122

Query: 91  VSILIAYSFVGFLVYIVMTCLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYSYLFKYL 148
            S+LI Y+ V  ++Y V+    E+A  Y  L G F +Y +   D A  F+V + Y  ++L
Sbjct: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182

Query: 149 IITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVL 208
            I P +L  A++ ++YW   + +NP  ++ IF V+++ IN            + ++ KVL
Sbjct: 183 CILPLELVTASMTIKYW--NDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVL 240

Query: 209 VMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKG--KFVSFVAVFVYA 266
           +++   +L  ++  GG  +   LG  ++ DPGAFR       G+ G  +F   VAV V A
Sbjct: 241 MLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNA 293

Query: 267 LFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQX 326
            FAY G E   + AAE +NP++++  A K  +YRI+  YL+T  LLG  V YN P LL  
Sbjct: 294 AFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS 353

Query: 327 XXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKA 386
                     PFV+AI + G+ V+PHI NA +L+ V S  NS LY +SR L  L+    A
Sbjct: 354 GSAATHAS--PFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFA 411

Query: 387 PKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILIT 446
           PK+F   ++ G P   L++  +F LL ++  S     VF + + +  +  L +W +I ++
Sbjct: 412 PKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLS 471

Query: 447 YIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFDYK 502
           ++ F R++  QG     L Y +     GAY+A+    LI LI  F V +     +K D  
Sbjct: 472 HVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLI-LIGQFWVAISPVGSNKLDAN 530

Query: 503 NFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLEEEEGKLWDAAQKE 560
           NF   Y+ +P+ I  + GYK + R  + + P  E DL + +++ D E  + +  +  ++ 
Sbjct: 531 NFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQL 590

Query: 561 KMESSPKNFKWFY 573
           +  S  K    F+
Sbjct: 591 RHASWTKRAAEFW 603

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 170/585 (29%), Positives = 277/585 (47%), Gaps = 42/585 (7%)

Query: 5   QDSYRKDLEKIVSNSNTTSKD--------------VENLDLSNQDDISS-QESHLNIDGK 49
           +DS R         SN+T+ D              +++     +D+ S  +E  +    +
Sbjct: 5   KDSIRTKDINFNETSNSTAVDLGGEGRASGVFHRFIDSFKPPVEDEKSDLEEMSMESTDR 64

Query: 50  HDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMT 109
           H    LKK +++RHV M                       P +++I Y  V F+ Y ++ 
Sbjct: 65  H----LKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQ 120

Query: 110 CLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVS 167
             GEMA TY  L G F +Y S +    +GFA  + +L ++L + P +L    + +QYW  
Sbjct: 121 AAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYW-- 178

Query: 168 REKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPS 227
            + +N  VWI IF V ++ ++              ++ K+L +   I+   V+  GG  +
Sbjct: 179 NDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGT 238

Query: 228 HDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPR 287
              +G +++K+PG+F     A S S G+F     V V A F+Y GTEL  +   E  NPR
Sbjct: 239 DGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPR 293

Query: 288 RNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGI 347
           R+ P+A K ++YRI++ YL+T+ L+G  V +++  L+            P+V+A    G+
Sbjct: 294 RSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHAS--PYVLAASIHGV 351

Query: 348 PVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCI 407
            V+PHI NA +L+ V S  NS LY A R    LA    APK  A  ++ G P  +L  C 
Sbjct: 352 KVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACA 411

Query: 408 LFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYA 467
           +  ++A+   SS   QVF +   + ++  L +W  IL+++I F  A++ QG D + L Y 
Sbjct: 412 VVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYK 471

Query: 468 APLASKGAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYKYI 524
           A     G+ +   FC L+  I  F V L   G     + F   Y+  P+++  +F Y   
Sbjct: 472 ALTGVWGSMWGFGFCVLV-FIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLW 530

Query: 525 RG--TKFVKPEEADLYTFKELIDLE--EEEGKLWDAAQKEKMESS 565
           +   T   K E+ DL   + + D E   +E    D  +KEK+ +S
Sbjct: 531 KRDFTFLTKLEDIDLDAHRRIYDPEFLRQE----DEERKEKIRNS 571

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 158/500 (31%), Positives = 265/500 (53%), Gaps = 17/500 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK+ L+ RH+ M                       P  ILI ++  G ++Y ++  +GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + G+A  ++Y+ ++L++ P ++ AA++ + YW +  K   
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F V+IV+IN              S  KV+ ++  I+L  +++ GGGP    +G 
Sbjct: 197 G-FVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGG 255

Query: 234 RFYKDPGAFRPYSEAISGSKGK-FVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
             + +PGAF      +  + GK F    +VFV A F++ G+EL G+ +AE  NPR+++PR
Sbjct: 256 ANWHNPGAF------VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPR 309

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K   +RI +FY++++ L+G+ V YND  L+            PFV+AIKN GI  LP 
Sbjct: 310 AAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAAS--PFVLAIKNHGIKGLPS 367

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           + N  +L+ V S  NS ++  SR+L  LA     PKIF   ++ G P   +     F LL
Sbjct: 368 VVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLL 427

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           +++  S    +VF++ + +  +  L +W+AI I ++ F RAL AQG     L++ +P   
Sbjct: 428 SFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGV 487

Query: 473 KGAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK 528
            G+ +      LI L   F + L   G   D K+F   Y+ +PV ++ + G+K Y R  K
Sbjct: 488 WGSIYGTVLIMLI-LAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWK 546

Query: 529 -FVKPEEADLYTFKELIDLE 547
            F++ E  D+ T +  +D+E
Sbjct: 547 LFIRAENIDIDTGRREVDIE 566

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  239 bits (610), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 161/531 (30%), Positives = 273/531 (51%), Gaps = 21/531 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           L+ +L++RH+ M                       P  ILI +S  G +++ ++  LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGEL 147

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + GFA  ++Y+ ++L++ P ++ AA++ + YW +  +   
Sbjct: 148 AVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTD 207

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F +++V IN              S  KV  ++  I+L  V++ GGGP    +G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGA 266

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           R++ +PGAF       S S  KF  F +VFV A F++ G+EL G+  +E KNPR+ VP A
Sbjct: 267 RYWHNPGAF-----VGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSA 321

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K   +RI++FY++ + L+G  V YNDP L+            PFV+AI   GI  LP +
Sbjct: 322 AKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASAS--PFVIAIVTHGISGLPSV 379

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS +Y  SR+L  L+     PKI +  ++ G P   + +   F L+A
Sbjct: 380 INVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIA 439

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S+   ++FN+ + +  +    +W AI I +I F  AL+AQG     L + +P    
Sbjct: 440 FVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVI 499

Query: 474 GAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKF 529
           G+Y+ LF   L+ LI  F + L   G       F + Y+  PV +  +  +K + +  KF
Sbjct: 500 GSYWGLFLNILM-LIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKF 558

Query: 530 VKP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGW 579
           + P E+ D+ T +   D+   + ++  A +K  +   P    W+Y  ++ W
Sbjct: 559 LIPLEDVDIDTGRRDTDVNLLKQEI--AEEKAALAMRP----WWYRVYVFW 603

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 164/582 (28%), Positives = 296/582 (50%), Gaps = 30/582 (5%)

Query: 6   DSYRKDLEKIVSNSNTTSKD-----------VENLDLSNQDDISSQESHLNIDGKHDGIR 54
           +S   D++K   N N T ++            + +++   D   +++  + I   H    
Sbjct: 31  ESESIDIKKETFNYNQTGEEKGSKWRQFIDSFKRVEVPELDPNLTEQERIAIITAHT--P 88

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK  L++RH+ M                       P S++I +S  G ++Y ++  + EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + GFA  ++Y+ ++L++ P ++ +A++ + YW +  K   
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F ++IV IN              S+ KV+ ++  I+L  V++ GGGP+   +G 
Sbjct: 209 G-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGA 267

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPGAF     A +G++  F  F +VFV A F++ G+EL GI  +E +NPR+ VP A
Sbjct: 268 KYWHDPGAF---VGATAGAQ--FQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPA 322

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K   +RI++FY++++  +G+ V  ND  L+            PFV+AI   GI  LP +
Sbjct: 323 AKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAAS--PFVIAITVHGIRGLPSV 380

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS +Y  SR+L  LA     PK+ +  ++ G P   + +   F L+A
Sbjct: 381 INVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVA 440

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S     VFN+ + +  +    +W AI + +I F  AL+AQ      L + +PL   
Sbjct: 441 FVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVF 500

Query: 474 GAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK- 528
           G+Y+ LF   L+ L   F V +   G      NF + Y+ +PV ++ +  +K + +  K 
Sbjct: 501 GSYWGLFLIVLM-LAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKI 559

Query: 529 FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFK 570
           F+   + DL T ++ +DL+    ++  A ++  + + P+ F+
Sbjct: 560 FIPLGQLDLDTGRKQLDLDLLRQEV--AEERATLAARPRWFR 599

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  238 bits (608), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 158/521 (30%), Positives = 268/521 (51%), Gaps = 27/521 (5%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK+ L+ RH+ M                       P ++++A+   G +VY V+  +GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
              +P+ G + SY SR+ DP+ GFA+ Y+YL   L+  P ++ AA++ + YW    K   
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-LG 232
           G ++ +F V ++ IN              S  KVL ++  I+L  V++ GGG ++   +G
Sbjct: 204 G-FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
            +++ +PG F        G KG    F A+FV + F++ G+E+  + AAE KNPRR++P+
Sbjct: 263 TKYWHNPGGF------AHGFKG----FAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPK 312

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K   +RI +FYL+++ L+G  V Y +  L             PFV+AIK AGI  LP 
Sbjct: 313 AAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASAS--PFVIAIKEAGISGLPS 370

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           + N  +L+ V S  N+ ++ +SR+   LA     PK FA  ++ G P   LIL ++F LL
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           ++++ S     VF + + V  +    +W +I + ++ F + LRAQG     LA+    A 
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFK---AQ 487

Query: 473 KGAYFALFFCCLIALIKNFTVF-----LGHKFDYKNFITGYIGIPVFIICFFGYK-YIRG 526
            G + +++   LI+++  F  +     L       +F   Y+ +PV I+ + G+K Y R 
Sbjct: 488 TGIWGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRN 547

Query: 527 TKFVKP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
            + V P +E DL T +  +DLE  + ++ +  + E + S P
Sbjct: 548 WRLVIPAKELDLDTGRREVDLELLKQEIKE--ENESIRSRP 586

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  239 bits (610), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 151/525 (28%), Positives = 270/525 (51%), Gaps = 27/525 (5%)

Query: 54  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGE 113
           +LKK ++ RHV M                       P  ++I Y+ +   +Y ++  +GE
Sbjct: 98  KLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGE 157

Query: 114 MA-TYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKV 171
           MA  Y+ L  GF +Y     DPAL F++ + Y  ++  + P +L  A++ +QYW +  KV
Sbjct: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTT--KV 215

Query: 172 NPGVWITIFLVIIVTINXXXXXXXXXXXXWL-SSFKVLVMLCLIVLLFVIMLGGGPSHDR 230
           N  +++ IF ++++ IN            ++ +S K+L+M+   +L  VI+ GG  +   
Sbjct: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275

Query: 231 LGFRFYKDPGAFRPYSEAISGSKG--KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRR 288
           +G ++++DPGAFR       GS G  +F   V+  V A F++  TE   I A+E  NPR+
Sbjct: 276 IGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328

Query: 289 NVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIP 348
            +P A K  +YR ++ YL +I ++G+ V Y+   LL            P+V+A+   G+ 
Sbjct: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKAS--PYVLAVSTHGVR 386

Query: 349 VLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCIL 408
           V+PH  NA +L+ VFS  +S  Y +SR L  LA    APK+F   ++ G P    ++  +
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446

Query: 409 FCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAA 468
             ++A+   SS   +VFN+ + +  +  + +W  I +++I F RA++ QG     + Y +
Sbjct: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506

Query: 469 PLASKGAYFALFFCCLIALIKNFT--VFLGH-KFDYKNFITGYIGIPVFIICFFGYK-YI 524
            +   G+ +A     LI + + +   V +G    D + F   Y+ +PVFI+ + GYK + 
Sbjct: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566

Query: 525 RGTK-FVKPEEADLYTFKELIDLE--EEEGKLWDAAQKEKMESSP 566
           R  + F++ ++ DL + + + D E   +E + +    +EK+ + P
Sbjct: 567 RDWRLFIRAKDIDLISHRHIHDPEILRQEREEY----QEKLRNGP 607

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  238 bits (608), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 164/571 (28%), Positives = 282/571 (49%), Gaps = 26/571 (4%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           +Q+S   D E + +  N   +   +   +   +   +E   +   K D  +LKK +++RH
Sbjct: 49  VQNS---DFEYLENEGNLFRRFANSFKRAPGSNNPDKEDGSDAGDKGDN-KLKKTIKSRH 104

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMAT-YIPLDG 122
           V M                       P  ++I Y+ +G  +Y ++   GE+A  Y  L G
Sbjct: 105 VVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSG 164

Query: 123 -FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
            F +Y S   DPALGF+V + Y  ++L + P +L  A++ ++YW +   VNP +++ IF 
Sbjct: 165 GFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTT--SVNPDIFVAIFY 222

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
           V+ + IN            + ++ KVL++    +L  ++  GG  +   +G +++ DPG+
Sbjct: 223 VLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYIGGKYWNDPGS 282

Query: 242 FRPYSEAISGSK--GKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLY 299
           F       SG K    F   V+  V A FA+  TE   + AAE  NPR+++P A K  LY
Sbjct: 283 F-------SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKVLY 335

Query: 300 RIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVL 359
           RI+V +L +I L+G  V +N   L+            P+V+AI + G+ V+PH  NA +L
Sbjct: 336 RIIVIFLGSITLVGFLVPHNSEELMGSGGSATHAS--PYVIAIASHGVKVVPHFINAVIL 393

Query: 360 MFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSS 419
           + V S  NS  Y +SR L  LA    AP      ++ G P  ++I+  +F L++++  S 
Sbjct: 394 LSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGLISFVAASP 453

Query: 420 GSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFAL 479
               VF + + +  +  L +W AI +++I F RA++ QG     L + + +   G+Y+A 
Sbjct: 454 KEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYAT 513

Query: 480 FFCCLIALIKNFTVF--LGH-KFDYKNFITGYIGIPVFIICFFGYKYIRG--TKFVKPEE 534
               LI + + +T    +G  K D + F   Y+ +P+ I  +FGYK  +   T ++   +
Sbjct: 514 GMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASK 573

Query: 535 ADLYTFKELIDLEEEEGKLWDAAQKEKMESS 565
            DL + + + D  E+  K  DA  +EK+ +S
Sbjct: 574 IDLISNRRIFD--EDVLKQEDAEFREKLRNS 602

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  238 bits (607), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 156/522 (29%), Positives = 272/522 (52%), Gaps = 17/522 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK  L+ RH+ M                       P S+LI +   G ++Y ++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + G+A  ++Y+ ++L++ P ++ +A++ + +W +  K   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F + IV IN              S  KV+ ++  I+L  ++  GGGP+   +G 
Sbjct: 206 G-FVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGG 264

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPGAF     A      KF    +VFV A F++ G+EL G+ A+E   PR++VP+A
Sbjct: 265 KYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKA 319

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K   +RI +FY++++ ++G+ V YND  L+            PFV+AIK  GI  LP +
Sbjct: 320 AKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAAS--PFVIAIKTHGIKGLPSV 377

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS +Y  SR++  LA     P+IF+  ++ G P   + +   F L+A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIA 437

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S    +VFN+ + +  +  L +W  I I +I F +AL AQG     L++ +P    
Sbjct: 438 FVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVW 497

Query: 474 GAYFALFFCCLIALIKNFTVF---LGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK- 528
           G+Y+ LF   +I  I  F V    +G     + F   Y+  P+ ++ + G+K Y R  K 
Sbjct: 498 GSYWGLFM-VIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKL 556

Query: 529 FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFK 570
           F+  E+ D+ T +  +DL+  + ++  A +K  M + P+ ++
Sbjct: 557 FIPAEKMDIDTGRREVDLDLLKQEI--AEEKAIMATKPRWYR 596

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  239 bits (610), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 180/588 (30%), Positives = 296/588 (50%), Gaps = 39/588 (6%)

Query: 2   SFIQDSYRK---------DLEKIVSNSNTTSKDVENLDLSNQDD------ISSQESHLNI 46
           SF+ DS+R+         DLE  ++ S + +  V  +  + +DD       S++   +N 
Sbjct: 58  SFV-DSFRRGDHAKNALHDLENDITTSISHASLVHAVSKAREDDEIMQSVASAEHRKVNN 116

Query: 47  DGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYI 106
               D   L+K ++ RHV M                       P  ++I YS +G  +Y 
Sbjct: 117 TESDD---LQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYC 173

Query: 107 VMTCLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQY 164
           ++   GEMA  Y  L+G F +Y S   DPALGF+V + Y  ++L + P +L  A+L ++Y
Sbjct: 174 IIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKY 233

Query: 165 WVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGG 224
           W +  KV+P V++ IF V+I++IN            + +  KVL+M+   +L  +I  GG
Sbjct: 234 WTT--KVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGG 291

Query: 225 GPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECK 284
             +   LG +++ +PGAFR    A+     +F   +  FV A FA+  TE   + AAE  
Sbjct: 292 AGNDGYLGAKYWHEPGAFRG-EHAVD----RFKGVMDTFVAAAFAFGATEFIALTAAEQS 346

Query: 285 NPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKN 344
           NPR+ +P A K  LYRIV+ +LV+I +LG  V Y+   LL            P+V+A+  
Sbjct: 347 NPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLL--GSSGSGVKASPYVLAVSL 404

Query: 345 AGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLI 404
            G+ V+PH  NA +L+ V S  NS  Y +SR L  L+    APK F   ++ G P  +++
Sbjct: 405 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAML 464

Query: 405 LCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTL 464
           +  LF ++A+   S     VFN+ + +  +  L +W AI ++++ F  A++ QG     +
Sbjct: 465 MSALFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEV 524

Query: 465 AYAAPLASKGAYFALFFCCLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFG 520
            + +     G+ +A     ++AL+  F V +      K D +NF   Y+ +P+ I  +FG
Sbjct: 525 GFHSQTGVYGSLYAATM-MILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFG 583

Query: 521 YK-YIRGTK-FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
           YK Y R  K ++K ++ DL + +++ D  E   K  D   KEK+ + P
Sbjct: 584 YKLYYRDWKLYIKADKIDLISHRQIFD--ENILKQEDEEYKEKLRNGP 629

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  237 bits (605), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 163/575 (28%), Positives = 286/575 (49%), Gaps = 26/575 (4%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQ-DDISSQESHLNIDGKHDGI------RLKKE 58
           D+ ++DL  +     + +K+ E   +  Q   ++ ++ + +++     I      +L K+
Sbjct: 9   DTKQQDLSSLSEVGQSFAKE-ETWSVEKQLKPLAEEKDYADMNDVEKAIYNTKDSKLNKD 67

Query: 59  LEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYI 118
           L  RH+                         P S++IA++ +   ++ ++  LGE++   
Sbjct: 68  LSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATF 127

Query: 119 PL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWI 177
           P+  GF  Y +R+ +P+ GFAV ++YL ++ I+ P +L AA++ ++YW   + +NP  W+
Sbjct: 128 PVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYW--NKSINPDAWV 185

Query: 178 TIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYK 237
           +IF V I   N             LS  K+L ++   +L  V++ GGGPS   +G +++ 
Sbjct: 186 SIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWN 245

Query: 238 DPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLT 297
           DPGAF   + A      +F    AVF+ A F+Y G EL G+ AAE +NPR  +P+A K T
Sbjct: 246 DPGAFVGDTPA-----QRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRT 300

Query: 298 LYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNAC 357
            + I + YLV + L+G  V  NDPLLL            P V+AI+N GI  LP + NA 
Sbjct: 301 FWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAAS-PLVIAIQNGGIKGLPSLMNAI 359

Query: 358 VLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNV 417
           +L+ + S  NS +Y  SR +  +A     P+  A  +K G P  ++ + +L  LL+++  
Sbjct: 360 ILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAA 419

Query: 418 SSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYF 477
           S+   +VF +   +  +  L  W AI + ++ F  A++ Q      L Y +     G+++
Sbjct: 420 SNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWY 479

Query: 478 ALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVK 531
                 L+ LI +F   L    G+  D  +F   Y+ +P+FI C+ G+K + R  + ++K
Sbjct: 480 GCIVIGLV-LIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIK 538

Query: 532 PEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
             E D+ + +   D +    K    A+ E M++ P
Sbjct: 539 LSEVDVDSGR--TDTDAATLKQEKEAEAELMKTKP 571

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  238 bits (607), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 169/577 (29%), Positives = 283/577 (49%), Gaps = 33/577 (5%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVEN--------LDLSNQDDISSQESHLNIDGKHDGIRLKK 57
           D +R+      +N N+ ++D+EN          LS+        S   ++GK     LKK
Sbjct: 73  DGFRRQ-----TNHNSAAEDLENELTTCVSPATLSDYKKSGDSGSVDELEGKTKEEHLKK 127

Query: 58  ELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-T 116
            ++ RHV M                       P  + I Y+ +G  +Y ++   GEMA T
Sbjct: 128 SIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVT 187

Query: 117 YIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGV 175
           Y  L  GF +Y S    P LGFAV + Y  ++  + P +L  A++ ++YW +  KVNP V
Sbjct: 188 YSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTT--KVNPDV 245

Query: 176 WITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRF 235
           ++ IF  +I+ IN            + +  KVL++    +L  +I  GG  +   +G ++
Sbjct: 246 FVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKY 305

Query: 236 YKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIK 295
           + DPGAFR   +AI     +F    A  V A FA+ G+E   + A+E  NPR+ +P A K
Sbjct: 306 WHDPGAFRG-DKAID----RFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAK 360

Query: 296 LTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFN 355
             LYRI++ +L +I ++G  V +N   L+            P+V+AI + G+ V+PH  N
Sbjct: 361 KILYRIIIIFLGSIIMVGFLVPWNSDQLM--GSDSSKTKASPYVIAISSHGVRVVPHFVN 418

Query: 356 ACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYM 415
           A +L+ V S  NS  Y +SR L  L+    APK F   ++ G P  ++++  LF ++A+ 
Sbjct: 419 AVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFC 478

Query: 416 NVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGA 475
             SS    VF + + +  +  + +W AI +++I F RA+  QG     + + + L   G+
Sbjct: 479 AASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGS 538

Query: 476 YFALFFCCLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYKYIRG--TKF 529
           Y+A     L+ LI  F V L     +K D ++F   Y+ + + I  + GY + +   T F
Sbjct: 539 YYAAGMMFLV-LIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLF 597

Query: 530 VKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
           ++ ++ DL   +++ D  E+  +  D   KEK+ + P
Sbjct: 598 IRAKDIDLDHHRQIFD--EDVLRQEDEETKEKLRNGP 632

>KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 568

 Score =  235 bits (600), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 155/524 (29%), Positives = 261/524 (49%), Gaps = 22/524 (4%)

Query: 56  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA 115
            ++L+ RHV +                       PVS+++ +S     +  +     EM 
Sbjct: 54  SRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWCIPILCITVSTAEMV 113

Query: 116 TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174
            Y+P+   F   A R C+ +L    G+++ F   +  P ++ A   +L YW  R+  +P 
Sbjct: 114 CYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIPFEIVAVNTILHYW--RDDFSPA 171

Query: 175 VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFR 234
           + + + +++ + I+            +L+SFK+L+ + L +  F+ MLGG P HDR GFR
Sbjct: 172 IPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITMLGGNPKHDRYGFR 231

Query: 235 FYKDPG--AFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
           +  D     + P +E  S S G F  F+A  + A F   G +   ++A ECK PR+ +P 
Sbjct: 232 YITDTKFKQYFPNNEG-SSSMGYFQGFLACVIQASFTIAGPDYVAMIAGECKLPRKVLPV 290

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLP 351
           A K    R+ V +L     +G+  + NDP L              P+V+A+ N GI VLP
Sbjct: 291 AFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYVIAMNNLGIKVLP 350

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
            + NA ++   FSA N+  Y +SR+LYGL++D  APK+F    K GVP N++++ + +  
Sbjct: 351 DVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVPINAVLVSLAWAF 410

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           ++ + + S SA V N+ +N+++   L+++  + + Y+ F RA   Q    S      P  
Sbjct: 411 ISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQ--HPSGELPELPFK 468

Query: 472 SKG----AYFALFFCCLIALIKNFTVFLGHKFDYKNFITGY----IGIPVFIICFFGYKY 523
           S G    AY  LF   L+  ++ +TVFL   ++ ++F+  Y    I + +F++CFF YK 
Sbjct: 469 SWGQPYTAYCGLFAVTLMIGVQGYTVFLHGSWEVQSFLFCYLMVFIDLGIFLLCFFVYKR 528

Query: 524 IRGTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPK 567
            R   +VKPE+ADL T  +    E EE +L    +K  +  +P 
Sbjct: 529 TR-DPWVKPEDADLLTGMD----EVEEHELSLGFEKYALRPTPD 567

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  236 bits (601), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 167/583 (28%), Positives = 285/583 (48%), Gaps = 42/583 (7%)

Query: 2   SFIQDSYRKDLEK--IVSNSN----TTSKDVENL-----------DLSNQDDISSQE-SH 43
           S  +D     + K  IV+N N    + SK +ENL           D +NQ +I   E ++
Sbjct: 7   SITKDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINN 66

Query: 44  LNIDGKHDGI--RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVG 101
           +  D  +D +  +L+K ++ RHV M                       P  +LI Y  + 
Sbjct: 67  IKSDQFNDKLNNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMA 126

Query: 102 FLVYIVMTCLGEMA-TYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAA 159
             +Y ++   GEMA  Y+ L  GF +Y S   D A  FAV + Y  ++L + P +L  A+
Sbjct: 127 SCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTAS 186

Query: 160 LVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSF-KVLVMLCLIVLLF 218
           + ++YW   EKV+P V++TIF ++I+ IN            +  +  K+L++    +L  
Sbjct: 187 MTIKYW--NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGI 244

Query: 219 VIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGI 278
           +++ GG  +   +G  ++ +PGAFR ++        +F   V+  V A F++  TE   I
Sbjct: 245 ILICGGAGTSGYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAI 299

Query: 279 VAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPF 338
            A+E  NPR+ +P A K  +YR +  Y+ +I ++G  V YN P LL            P+
Sbjct: 300 TASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS--PY 357

Query: 339 VVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGV 398
           V+A+ + GI + PH  NA +L+ V S  NS  Y +SR L  LA    APKIF   ++ G 
Sbjct: 358 VIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGR 417

Query: 399 PYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQG 458
           P   +I   L   +A+   S    +VF++ + +  +  + +W  I +++I F RA++ QG
Sbjct: 418 PLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQG 477

Query: 459 VDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVF 514
              + L Y + +   G+ +A     LI LI  F V L     +  +  NF   Y+ +P+ 
Sbjct: 478 RSLNELGYKSQVGVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPIL 536

Query: 515 IICFFGYKYIRG--TKFVKPEEADLYTFKELID---LEEEEGK 552
           ++ +FGYK  +     F++ ++ DL + + + D   L++E+ +
Sbjct: 537 LLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  235 bits (600), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 166/576 (28%), Positives = 281/576 (48%), Gaps = 36/576 (6%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNID-----GKHDGI--RLKKE 58
            S +KD   +  + NT     E      +  I S     ++D        DG   ++KK 
Sbjct: 9   SSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRRGRDVDLMCKADAEDGTTAKMKKT 68

Query: 59  LEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TY 117
           ++ RH+ M                       P  +++ Y     ++Y+++   GE+   Y
Sbjct: 69  IKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGELGICY 128

Query: 118 IPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVW 176
             + G +T+Y+S   DPA+GF+V + Y  +++ + P QL  AA+++QYW     +NP ++
Sbjct: 129 SGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTD---INPDIF 185

Query: 177 ITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFY 236
           + I   +IV IN            + +  KVL+++  ++L  VI  GG  +   +G +++
Sbjct: 186 VAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIGDKYW 245

Query: 237 KDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKL 296
            +P   RP+   ++G KG       VF YA FAY G E+  + A+E +NPR+++  A K 
Sbjct: 246 HEP---RPF---MNGFKG----LCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACKK 295

Query: 297 TLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNA 356
            +YRIV+ YL+T  ++   V  + P L             P V+A+   G+ ++PHI NA
Sbjct: 296 VIYRIVLIYLLTTVIVCFLVPADHPSL-----ASEGSRASPLVIAVSFHGVKIVPHIINA 350

Query: 357 CVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMN 416
            +L+ V S  NS LY A R L  LA    APKIF   ++ G P  +  + ++F LLA++ 
Sbjct: 351 VILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLA 410

Query: 417 VSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAY 476
            S     VF + + +  +  +  W++I I++I F  A++AQG     + Y A     G++
Sbjct: 411 ASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSW 470

Query: 477 FALFFCCLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVK 531
            A+    LI LI  F V +        D ++F   Y+  P+ ++ +FGYK Y +  +   
Sbjct: 471 IAVVTAFLI-LIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICI 529

Query: 532 P-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
           P  E DL + +++ D  E+E K  D   K K++SSP
Sbjct: 530 PASEVDLISHRQVFD--EDELKQEDLEWKLKLKSSP 563

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  235 bits (600), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 166/558 (29%), Positives = 265/558 (47%), Gaps = 44/558 (7%)

Query: 22  TSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXX 81
           T+ D+E  D  N  + + Q              LK  ++ RH++M               
Sbjct: 48  TAVDLEGKDADNGLNKTQQT-------------LKHNIKTRHLTMISLGTGIGTGLLVAS 94

Query: 82  XXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAV 139
                   P  ++I Y     ++Y V+    E+   Y  L G + +Y +   D   GFAV
Sbjct: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154

Query: 140 GYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXX 199
              Y  ++  + P +L  A++ ++YW S   VNP V++ IF V ++ I+           
Sbjct: 155 ALVYGLQWATVLPLELVTASMTVKYWTS--SVNPDVFVAIFYVFLLFIHFFGSRGYAEAE 212

Query: 200 XWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKG--KFV 257
              +S KVL+M   I++  + +  G      +G +++ DPGAF        G +   +F 
Sbjct: 213 FIFNSLKVLLMAGFIIMA-ISLTAGASEQGYIGGQYWHDPGAF-------GGDRAIDRFK 264

Query: 258 SFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVA 317
              +V+V A FAY G+E   + AAE  NPR +VP+A K  LYR+VV +L+ + L+G  V 
Sbjct: 265 GICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVP 324

Query: 318 YNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSL 377
           +N   LL            PFV+A    G+ V+PHI N  +L  V S  NS +Y A R L
Sbjct: 325 HNSDQLLSAEGGSGSRAS-PFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRIL 383

Query: 378 YGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 437
             LA     PKIF   ++ G P  +LI   LF L+A++  S+    VF +   +  +  L
Sbjct: 384 LSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQL 443

Query: 438 MSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG- 496
            +W AI ++++ F RA+R QG     L Y A   + G+Y+A+FF  +I LI  F + +  
Sbjct: 444 FTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFF-NVIVLIAQFWIAIAP 502

Query: 497 ----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLE--- 547
                + D + F   Y+  PV ++ + GYK + R  + V P  E DL + +++ D E   
Sbjct: 503 IPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLL 562

Query: 548 EEEGKLWDAAQKEKMESS 565
           +EE     A +KE++ +S
Sbjct: 563 QEE-----AERKERLRNS 575

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  235 bits (600), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 154/529 (29%), Positives = 260/529 (49%), Gaps = 19/529 (3%)

Query: 26  VENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXX 85
           V +  +    D +S  SH   +   + + L K L  RH+                     
Sbjct: 49  VPHEKIQTTTDFASVISH---EDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAAL 105

Query: 86  XXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYL 144
               P S++I +  +   ++ V+  LGEMA   P+  GF  Y +R+ DP++GFAV  +YL
Sbjct: 106 ASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYL 165

Query: 145 FKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSS 204
            ++L++ P +L AA++ ++YW   E +N   W+ IF  +I   N             LS 
Sbjct: 166 AQWLVLLPLELVAASMTIKYW--NETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSM 223

Query: 205 FKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFV 264
            K+L ++   +L  V+  GGGP    +G +++  PG+F  ++     S  KF    +VFV
Sbjct: 224 IKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSFVGHN-----SGTKFKGLCSVFV 278

Query: 265 YALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLL 324
            A F+Y G E+  + AAE K+PR  +P+A K T + I   Y+  + L+G  V Y+DP LL
Sbjct: 279 TAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLL 338

Query: 325 QXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDN 384
                       P V+AI+N GI  LP + NA +L+ + S  NS +Y  SR +  +A   
Sbjct: 339 SGTSSVDAASS-PLVIAIENDGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIG 397

Query: 385 KAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAIL 444
             P+I  + +  G P N++I  + F LL+++  S   A VF +   +  +  +  W+AI 
Sbjct: 398 NVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAIN 457

Query: 445 ITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFD 500
           +++I F +++  Q      L + +     G+++      L+ L+ +F   L    G   D
Sbjct: 458 LSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLV-LVASFWTSLFPLGGTSAD 516

Query: 501 YKNFITGYIGIPVFIICFFGYK-YIRGTKF-VKPEEADLYTFKELIDLE 547
            ++F  GY+  P+ + C+FG+K Y+R  +F V   + DL T +  +DL+
Sbjct: 517 AESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGRRQVDLD 565

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  235 bits (599), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 167/584 (28%), Positives = 279/584 (47%), Gaps = 51/584 (8%)

Query: 2   SFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEA 61
           +FI    R D  ++    N  S+DVE       D I+S  S           + KK L +
Sbjct: 43  NFIDSYKRADPSQL---HNARSEDVE-------DGIASIRSD---------TQFKKSLSS 83

Query: 62  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL- 120
           RHV M                       P S++I Y  V F+ Y ++   GEMA   P  
Sbjct: 84  RHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTL 143

Query: 121 -DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITI 179
              F +Y S +   + GFA  + +  ++L + P +L  ++L ++YW   +K+N  +++ I
Sbjct: 144 PGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYW--NDKINADIFVMI 201

Query: 180 FLVIIVTINXXXXXXXXXXXXWL-SSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           F V +V I+            +L +S K+L+++  I+L  VI  GG  +   +G +++ +
Sbjct: 202 FYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKYWHE 261

Query: 239 PGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTL 298
           PG+F     A   +  +F     V V   F+Y GTEL  +   E   PR+  P A K ++
Sbjct: 262 PGSF-----AEGDATSRFKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSI 316

Query: 299 YRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 358
           YRI++ YL+T+ L+G  V +N+  L+            P+V+A    G+ ++PH  NA +
Sbjct: 317 YRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHAS--PYVLAATIHGVKIVPHFINAVI 374

Query: 359 LMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVS 418
           L+ V S  NS L+   R L  LA    APKI +  ++ G P  +L +  L  L+A+++ +
Sbjct: 375 LISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGISFLIGLIAFVSCT 434

Query: 419 SGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFA 478
           S   +VF +   +  +  + +W  I+ +++ F  A++ QG D + L Y A     G+ + 
Sbjct: 435 SHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYG 494

Query: 479 LFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP 532
            FF  L+ LI  F V L     G K D + F   Y+  P+++ C+FGY  Y +    + P
Sbjct: 495 AFFGVLV-LIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYFGYMIYNKDFTLLSP 553

Query: 533 -EEADLYTFK-----ELIDLEEEEGKLWDAAQKEKMESSPKNFK 570
            ++ DL +++     ELI  E+EE        KE ++S P  +K
Sbjct: 554 LDKIDLDSYRRIYDPELIKQEDEE-------NKENLKSRPLYYK 590

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  235 bits (599), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 157/547 (28%), Positives = 260/547 (47%), Gaps = 29/547 (5%)

Query: 30  DLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXX 89
           D     D+      +  D  H    +KK +++RHV M                       
Sbjct: 57  DKHADSDLEDGSKSITSDDDH----MKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAG 112

Query: 90  PVSILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTSYASRYCDPALGFAVGYSYLFKY 147
           P  +++ Y  V F+ Y ++   GEMA   P     F +YAS +     GFA  + +  ++
Sbjct: 113 PAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQW 172

Query: 148 LIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKV 207
           L + P +L  A++ ++YW   + +NP V+I IF V ++ I+              +S K+
Sbjct: 173 LTVLPLELITASMTIKYW--NDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKI 230

Query: 208 LVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYAL 267
           L++   I+L  VI  GG      +G +++ +PGAF   S A      +F     + V   
Sbjct: 231 LMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAFASESPA-----ARFKGVAYILVTGY 285

Query: 268 FAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXX 327
           F+Y GTEL  +   E KNPR++ P A K ++YRI++ YL+T+ L+G  V ++   L+   
Sbjct: 286 FSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAG 345

Query: 328 XXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAP 387
                    P+V+A    G+ V+PH  NA +L+ V S  NS LY + R +  LA    AP
Sbjct: 346 GSATHAS--PYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAP 403

Query: 388 KIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITY 447
           K F   ++ G P  +L +C LF ++ ++  S    Q F +   +  +  L +W +I I++
Sbjct: 404 KWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISH 463

Query: 448 IYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG-----HKFDYK 502
           I F  A++ QG     L Y A     G+ +++FF  L+  I  F V L       K+D +
Sbjct: 464 IRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLV-FIAQFWVALSPPKSNGKYDAE 522

Query: 503 NFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLE--EEEGKLWDAAQ 558
            F   Y+  P++++ +FGY  Y R   F+ P ++ DL   + + D E   +E    DA  
Sbjct: 523 GFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQE----DAET 578

Query: 559 KEKMESS 565
           KE++ +S
Sbjct: 579 KERLRNS 585

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  235 bits (599), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 161/568 (28%), Positives = 275/568 (48%), Gaps = 27/568 (4%)

Query: 13  EKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHD-GIRLKKELEARHVSMXXXXX 71
           EK   N  T   D +  +  ++ +I +  S      K D    L K+L  RH+       
Sbjct: 49  EKSSDNMTTYVTDSKTKEGGSEKNIETTPSEQFSIAKEDINENLNKDLSIRHLITLAVGG 108

Query: 72  XXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRY 130
                             P S++I +  +   ++ V+  LGE+A   P+  GF  Y +R+
Sbjct: 109 SIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRF 168

Query: 131 CDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXX 190
            DP++ FA+  +YL ++L++ P +L AA++ ++YW   + +N   W+ IF  +I   N  
Sbjct: 169 VDPSVAFAINLNYLAQWLVLLPLELVAASITIKYW--NDTINSDAWVAIFYSVIALANML 226

Query: 191 XXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAF---RPYSE 247
                      LS  K+L ++   +L  V+  GGGP    LG  ++ DPG+F   +P ++
Sbjct: 227 DVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSFVGDKPGTQ 286

Query: 248 AISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLV 307
                   F    +VFV A F+Y G EL  + AAE K+PR+ +P+A K T + +   Y+ 
Sbjct: 287 --------FKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVT 338

Query: 308 TIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACN 367
            + ++G  V ++DP LL            P V++IKNAGI  L  + NA +L+ + S  N
Sbjct: 339 ILTIIGCLVPFDDPRLLNGSSSVDAAAS-PLVISIKNAGIKGLDSLMNAIILISIVSVAN 397

Query: 368 SDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNY 427
           S +Y  SR +  +A     PK+ ++ +K G P N+++  + F LL+++  S   A+VF +
Sbjct: 398 SAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTW 457

Query: 428 FVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIAL 487
              +  +  +  W+AI  ++I F  A++ Q      L Y +     G+++ +    L+ L
Sbjct: 458 LSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLV-L 516

Query: 488 IKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEADLYTFK 541
           + +F   L        D  +F  GY+ +P+ I C+ G+K Y+R  +  VK E+ DL T +
Sbjct: 517 VASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGR 576

Query: 542 ELIDLEEEEGKLWDAAQKEKMESSPKNF 569
           + ID  E   ++      EK   S K+F
Sbjct: 577 KHIDAHEHRAEI----LAEKAALSQKSF 600

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  236 bits (603), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 162/585 (27%), Positives = 288/585 (49%), Gaps = 40/585 (6%)

Query: 6   DSYRKDLE---KIVSNSNTTSKDVENLDLSNQDDI-----SSQESHLNIDGKHDGIRLKK 57
           DS+++  +    + +N   +  D+EN+ L N+D          ++ +N + K D   LKK
Sbjct: 103 DSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQINDNSKSD--ELKK 160

Query: 58  ELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-T 116
            ++ RHV M                       P  ++I +  +G  +Y ++  +GE+A  
Sbjct: 161 TIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAVA 220

Query: 117 YIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGV 175
           Y  L  GF +Y S   D A  FAV + Y  ++L + P +L  A++ ++YW +  KV+P +
Sbjct: 221 YSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTT--KVDPDI 278

Query: 176 WITIFLVIIVTINXXXXXXXXXXXXWL-SSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFR 234
           ++ IF ++I+ IN            ++ +S K+++M+   +L   ++ GG  +   +G +
Sbjct: 279 FVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAK 338

Query: 235 FYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAI 294
           ++ DPGA R  +     S  +F   +A  V A FA+  +E  G+ A+E  NPR+ +P A 
Sbjct: 339 YWHDPGALRGDT-----SIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAA 393

Query: 295 KLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIF 354
           K  +YRI+  +L +I ++G  V YN   LL            P+V+AI   G+ V+PH  
Sbjct: 394 KKMIYRILCMFLSSITIVGFLVPYNSDQLL--GSTGSGVKASPYVLAISTHGVRVVPHFI 451

Query: 355 NACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAY 414
           NA +L+ V S  NS  Y +SR L  LA    APKI++  ++ G P   +    +F ++A+
Sbjct: 452 NAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAF 511

Query: 415 MNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKG 474
              S    +VF + + +  +  L +W+AI I++I F RA+  QG     L + + +   G
Sbjct: 512 CATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYG 571

Query: 475 AYFAL----------FFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI 524
           + +A           F+  L+ +  + T+    K D KNF   Y+ +P+ +  +FGYK  
Sbjct: 572 SAYAAIMMFMILIAQFWVALVPINADLTI----KLDAKNFFENYLAMPILLAFYFGYKIW 627

Query: 525 RG--TKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPK 567
           +     F++ +  DL + + + D  EE  K  +   +E++ + PK
Sbjct: 628 KKDWKLFIRAKNIDLISHRNIFD--EELIKQEEDEYRERLRTGPK 670

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  234 bits (598), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 162/572 (28%), Positives = 270/572 (47%), Gaps = 29/572 (5%)

Query: 11  DLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXX 70
           D  K    S T +K +      N  D+    +    D K     LKK +++RHV M    
Sbjct: 56  DSFKRAEGSTTHTKQINE----NTSDLEGDVNSFTSDSK-----LKKSMKSRHVVMMTLG 106

Query: 71  XXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTSYAS 128
                              P +++I Y  V F+ Y ++   GEMA   P     F +Y+S
Sbjct: 107 TGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSS 166

Query: 129 RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTIN 188
            +     GFA  + Y F++L + P +L  AA+ +++W   + +NP ++I IF V ++ I+
Sbjct: 167 IFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFW--NDTINPDIFILIFFVFLLFIH 224

Query: 189 XXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEA 248
                         +  K+L++   I+L  VI  GG  +   +G +++++PGAF     A
Sbjct: 225 FFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----A 279

Query: 249 ISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVT 308
              S G+F +   + V A F++ G EL  +   E  NPR+  P A K ++YRI+V YL+T
Sbjct: 280 GDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLT 339

Query: 309 IFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNS 368
           + L+G  V YND  L+            P+V+A    G+ V+PHI NA +L+ V S  NS
Sbjct: 340 MILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKVVPHIINAVILISVISVANS 397

Query: 369 DLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYF 428
            LY   R +  LA     PK     ++ G P  +LI+C +F ++ ++  SS    VF + 
Sbjct: 398 SLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWL 457

Query: 429 VNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALI 488
             +  +  L +W +I+++++ F +A++ QG     L Y A     G+ + +FF  L+  I
Sbjct: 458 AAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILV-FI 516

Query: 489 KNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFK 541
             F V L     G K   ++F   Y+  P++I  + GY  Y R   F+ P ++ DL   +
Sbjct: 517 AQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHR 576

Query: 542 ELIDLE-EEEGKLWDAAQKEKMESSPKNFKWF 572
            + D E   +  L +  +K  M    K + ++
Sbjct: 577 HIYDPELMRQEDLENEERKRDMSLMRKTYHFW 608

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  235 bits (599), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 153/512 (29%), Positives = 250/512 (48%), Gaps = 22/512 (4%)

Query: 54  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGE 113
            LKK +++RHV M                       P  +++AY  V F+ Y ++   GE
Sbjct: 100 HLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGE 159

Query: 114 MA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKV 171
           MA TY  L G F SY S +     GFA  + +L ++L + P +L  ++L ++YW   +K+
Sbjct: 160 MAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYW--NDKI 217

Query: 172 NPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRL 231
           N  V++ IF V ++ I+              +S K+L++   I+   V+  GG      +
Sbjct: 218 NSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYI 277

Query: 232 GFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVP 291
           G +++ DPGAF  ++       G+F     + V A F+Y GTEL  +   E +NPR++ P
Sbjct: 278 GGKYWHDPGAFTSHTNI-----GRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTP 332

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
           +A K ++YRIVV YL+T+ L+G  V +++  L+            P+V+A    G+ ++P
Sbjct: 333 QAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLM--GSHGSATHASPYVLAASIHGVRIVP 390

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
           H  NA +L+ V S  NS LY + R L  LA    APK     ++ G P  +L  C LF +
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           + +   S+   QVF +   +  +  L +W  I+++++ F +A++ QG D + L Y A   
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 472 SKGAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGT 527
             G+ + +FF  L+     F V L   G K    +F   Y+  P+F   +FGY  + +  
Sbjct: 511 VWGSVYGVFFNILV-FFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDF 569

Query: 528 KFVKPEEADLYTFK------ELIDLEEEEGKL 553
            F+ P E+    F       E I  E EE K+
Sbjct: 570 TFLIPLESIDLDFHRRVYDPEFIRQEREEKKI 601

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  234 bits (598), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/532 (29%), Positives = 270/532 (50%), Gaps = 28/532 (5%)

Query: 40  QESHLNIDGK-HDGI----RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSIL 94
           +E  L+++G  HD I     LKK +++RHV M                       P +++
Sbjct: 95  EEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALV 154

Query: 95  IAYSFVGFLVYIVMTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITP 152
           I Y  V F+ Y ++   GEMA TY  L G F +Y+S +   A GFA  + +  ++L + P
Sbjct: 155 IGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLP 214

Query: 153 NQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSF-KVLVML 211
            +L  A+L ++YW   +K+N  V+I IF V ++ I+            +L +  K+L+++
Sbjct: 215 LELITASLTIKYW--NDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVI 272

Query: 212 CLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYL 271
             I++  VI  GG  + + +G +F+ DPGAF   +   +GS+ K + +V V  Y  F+Y 
Sbjct: 273 GFIIMSIVINAGGAGNREYIGGKFWHDPGAF---AGKTAGSRFKGICYVLVSGY--FSYG 327

Query: 272 GTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXX 331
           GTEL  +   E  NPRR+ P+A K +LYRI++ YL+T+ L+G  V Y+   L+       
Sbjct: 328 GTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSAT 387

Query: 332 XXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFA 391
                P+V+A    G+ + PH  NA +L+ V S  NS LY A R +  LA    APK   
Sbjct: 388 HAS--PYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLD 445

Query: 392 KTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFD 451
             ++ G P  +LI C+L  ++ ++  S    +VF +   +  +  L +W +I+++++ F 
Sbjct: 446 YVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFR 505

Query: 452 RALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYK----NFITG 507
            A++ Q      L Y A     G+ + + F  L+   + +T       D K    +F   
Sbjct: 506 MAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFAN 565

Query: 508 YIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFK-----ELIDLEEEEGK 552
           Y+ +P++++ +FGY  + R  + +KP ++ DL   +     EL+  E+EE K
Sbjct: 566 YLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESK 617

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  233 bits (595), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 167/586 (28%), Positives = 283/586 (48%), Gaps = 37/586 (6%)

Query: 2   SFIQDSYRKDL-EKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELE 60
           SF+ +  R D  E+  S S+       + +  + DDI  ++ H +         + ++L 
Sbjct: 41  SFLSEKNRYDFKEETTSFSDDRFNSQHSYNPGSPDDIK-EDIHTS--------NMNQDLN 91

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
            RH+                         P S++I ++ V   ++ V+  LGE+A   P+
Sbjct: 92  VRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINSLGELAAAYPV 151

Query: 121 -DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITI 179
             GF  Y +R+ DP+  F+V  +YL ++L++ P +L AA+L ++YW   + +N   W+ I
Sbjct: 152 VGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYW--DDTINSDAWVAI 209

Query: 180 FLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDP 239
           F  +I+  N             LS  K+L ++   +L  V+  GGGP    +G +++ DP
Sbjct: 210 FYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGYIGGKYWHDP 269

Query: 240 GAFRPYSEAISGSKG-KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTL 298
           GAF      +  S G +F    +VFV A F+Y G E+  + AAE +NPR+ +P A K T 
Sbjct: 270 GAF------VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTIPTAAKRTF 323

Query: 299 YRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 358
           + I   Y+  + L+G  VAYND  LL            P V+AI+N GI  LP + NA +
Sbjct: 324 WIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAAS-PLVIAIENGGIKGLPSLMNAII 382

Query: 359 LMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVS 418
           L+ + S  NS +Y  SR +  +A+    PK  +  +K G P  ++   + F LL+++  S
Sbjct: 383 LIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGLLSFVAAS 442

Query: 419 SGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYF- 477
               +VF +   +  +  +  W+ I I +I F +A+  Q      + Y +     G+Y+ 
Sbjct: 443 DKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTGIYGSYYG 502

Query: 478 -ALFFCCLIA-LIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-E 533
            A+ F  LIA    +     G   D + F  GY+  P+ I C+ G+K Y +  + + P E
Sbjct: 503 TAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKNWRIMTPLE 562

Query: 534 EADLYTFKELIDLE--EEEGKLWDAAQKEKMESSPKNFKWFYEKFL 577
           E DL T ++ +D++  +EE K+    ++E +  S      F ++FL
Sbjct: 563 EIDLLTGRKEVDIDILKEELKI----EREALRQSS-----FMKRFL 599

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  233 bits (593), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 162/576 (28%), Positives = 273/576 (47%), Gaps = 27/576 (4%)

Query: 1   MSFIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELE 60
           M  +Q     D+E  +S SN   + V++   +   ++   +             LKK ++
Sbjct: 1   MKTLQSPRSDDVE--ISKSNLVHRFVDSFRRAESPELEENDLEDGTRSIVTKTHLKKAMK 58

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
           +RHV M                       P S++I Y  V F+ Y ++   GEMA   P 
Sbjct: 59  SRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYPT 118

Query: 121 --DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
               F SY S +     GFA  + +  ++L + P +L  A+L ++YW   +K+N  V+I 
Sbjct: 119 LPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYW--NDKINADVFII 176

Query: 179 IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           IF   ++ I+              +S KVL++   I+L  VI  GG  +   +G +++ D
Sbjct: 177 IFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHD 236

Query: 239 PGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTL 298
           PG+F   ++    ++ K V F+ V  Y  F+Y G EL  +   E +NPR++ P A K ++
Sbjct: 237 PGSF---ADGPPITRFKGVCFILVSAY--FSYGGAELFSLSVNEQENPRKSTPAAAKQSI 291

Query: 299 YRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 358
           YRI++ YL T+ L+G  V +N   L+            P+V+A     + V+PH  NA +
Sbjct: 292 YRILIIYLATMILIGFNVPHNSDELMGAGSAATHAS--PYVLAASLHSVKVVPHFINAVI 349

Query: 359 LMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVS 418
           L+ V S  NS LY A R +  LA    APK     ++ G P   LILC LF ++ +++ S
Sbjct: 350 LISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSAS 409

Query: 419 SGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFA 478
           S   +VF +   +  +  L +W  I++++I F +A++  G     + + A     G+Y+ 
Sbjct: 410 SKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYG 469

Query: 479 LFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP 532
             F  L+  I  F V L     G K D + F   Y+  P++++ +FGY  Y R    + P
Sbjct: 470 CAFNILV-FIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNP 528

Query: 533 -EEADLYTFKELIDLE--EEEGKLWDAAQKEKMESS 565
            E+ DL   + + D +  ++E    D   KE++++S
Sbjct: 529 LEKIDLDFHRRIYDPDFIKQE----DEENKERLKNS 560

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  233 bits (594), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 157/519 (30%), Positives = 268/519 (51%), Gaps = 24/519 (4%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK+ L++RH+ M                       P  ILI ++  G ++Y ++  +GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 115 ATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+  GFT+YASR+ D + GFA    Y+ ++L++ P ++ AA++ + YW + +K   
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F V+IV IN              S  KV+ ++  I+L  +++ GGGP    +G 
Sbjct: 196 G-FVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGG 254

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           R + +PGAF       +G KG      +VFV A F++ G+EL G+ AAE  NPR+++P A
Sbjct: 255 RLWHNPGAFA------NGFKG----VCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSA 304

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAY-NDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
            K   +RI +FY++ + ++G+ V Y +D L+ Q           PFV++I+NAGI  LP 
Sbjct: 305 AKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS---PFVISIQNAGIKGLPS 361

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           + N  +L+ V S  NS ++  SRS+  LA     PKIF   ++ G P   +I+  +F LL
Sbjct: 362 VINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLL 421

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           +++  S    +VF++ + +  +  L +W  I++ +I   RAL AQ    + L++ AP   
Sbjct: 422 SFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGV 481

Query: 473 KGAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYKYIRGT-- 527
            G+ +      LI L+  F + L   G K     F   Y+  P+ I  + G+K  +    
Sbjct: 482 WGSVYGFVLIILI-LMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWK 540

Query: 528 KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
            F++ +  D+ T +   D+E  + ++  A +K  + S P
Sbjct: 541 LFIRAKNIDIDTGRRETDIEALKQEI--AEEKAFIASKP 577

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  233 bits (595), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 163/582 (28%), Positives = 276/582 (47%), Gaps = 26/582 (4%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGK-----HDGIRLKKELE 60
           +SY  + E   +N     + V++   +  +  S  +S +  +G      +    LKK ++
Sbjct: 37  ESYASNAEVGATNPTMFRRFVDSFKPAEDNKHSEVDSDVERNGDAAYSVNTDTHLKKAMK 96

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
            RHV M                       P +++I Y  V  + YI++   GEMA   P 
Sbjct: 97  TRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPT 156

Query: 121 --DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT 178
               F +YAS +     GFA  + +  ++L + P +L  A+L+++YW   EKVN  V++ 
Sbjct: 157 LPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWT--EKVNADVFVV 214

Query: 179 IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKD 238
           IF V ++ I+              +  K+L++   I+   V+  GG      +G +++  
Sbjct: 215 IFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHS 274

Query: 239 PGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTL 298
           PGAF     A + +  +F     V V   F+Y GTEL  +   E +NPR++ P A K ++
Sbjct: 275 PGAF-----AGTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTPIAAKQSI 329

Query: 299 YRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 358
           YRI+V YL+T+ L+G TV +ND  L+            P+V+A    G+ V+PHI NA +
Sbjct: 330 YRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHAS--PYVLAASIHGVRVVPHIINAVI 387

Query: 359 LMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVS 418
           L+ V S  NS LY A R L  LA    APK     ++ G P  +L+ C +F ++A+   S
Sbjct: 388 LIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVIAFSACS 447

Query: 419 SGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFA 478
               QVF +   +  +  L +W +I+++++ F +A++ QG D + + Y A     G+ + 
Sbjct: 448 DQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYWGSVYG 507

Query: 479 LFFCCLIALIKNFTVFLG---HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-E 533
           + F  L+  I  F V L         ++F   Y+  P++I  +FGY  + +   F+ P +
Sbjct: 508 VVFNILV-FIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIWNKDYTFLNPLD 566

Query: 534 EADLYTFKELIDLEEEEGKLWDAAQKEKMESSP--KNFKWFY 573
           + DL   + + D   E  K  D   KE++ +       KWF+
Sbjct: 567 KIDLDHHRRIYD--PEVLKQEDMENKERVRNGNIWTKLKWFW 606

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  233 bits (593), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 157/523 (30%), Positives = 262/523 (50%), Gaps = 25/523 (4%)

Query: 54  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGE 113
           ++K+ +++RH++M                       P  ++I Y     ++Y V+    E
Sbjct: 75  KMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCE 134

Query: 114 MA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKV 171
           +  +Y  L G + SY S   D    FAV + Y  ++ I+ P +L  +++ ++YW   + +
Sbjct: 135 LGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYW--NDSI 192

Query: 172 NPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRL 231
           NP V++ IF   IV I+              +S KVL+M+  I++   +  G   S   +
Sbjct: 193 NPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKS-GYI 251

Query: 232 GFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVP 291
           G +++  PGAF    +AI   KG      +V+V + FAY G+E   + AAE  NPR++VP
Sbjct: 252 GGKYWHTPGAFVG-EKAIDHFKG----ICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVP 306

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
           +A K  LYR+++ +L  I L+G  V Y+ PLLL            PFV+A  + G+ V+P
Sbjct: 307 KATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHAS-PFVIAAASHGVKVVP 365

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
           HI NA +L+ V S  NS  Y A R L  LA     PK+F   ++ G P  +++   +F L
Sbjct: 366 HIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGL 425

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           ++++  S     VF +   +VS+  L +W AI +++I F  A++ QG     L Y A   
Sbjct: 426 ISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTG 485

Query: 472 SKGAYFALFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFGYK-YIR 525
             G+++A+ F  +I L   F V +     G K D  NF   Y+  PV +  +FGYK + R
Sbjct: 486 YWGSWYAIAF-NIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYR 544

Query: 526 GTK-FVKPEEADLYTFKELIDLE--EEEGKLWDAAQKEKMESS 565
             K F+  ++ DL + +++ D +  ++E    D   KE++ +S
Sbjct: 545 DWKLFIPADKVDLESHRKIFDADLIKQE----DFEHKERIRNS 583

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  232 bits (592), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 159/548 (29%), Positives = 265/548 (48%), Gaps = 36/548 (6%)

Query: 32  SNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPV 91
           S ++D+      L      D   LKK +++RHV M                       P 
Sbjct: 57  STENDLEDGTKPLG-----DASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPG 111

Query: 92  SILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTSYASRYCDPALGFAVGYSYLFKYLI 149
           S++I Y  V F+ Y ++   GEMA   P     F SY S +     GFA  + +  ++L 
Sbjct: 112 SLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLT 171

Query: 150 ITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLV 209
           + P +L  A+L ++YW   +K+N  V+I IF V ++ I+              +S KVL+
Sbjct: 172 VFPLELITASLTIKYW--NDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLM 229

Query: 210 MLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFA 269
           +   I+L  VI  GG      +G ++++DPG+F     A   S  KF     + V A F+
Sbjct: 230 IAGFIILSIVINCGGAGKDGYIGAKYWRDPGSF-----AEGDSVEKFKGICYILVTAYFS 284

Query: 270 YLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXX 329
           Y G EL  +   E +NPR++ P+A K ++YRI++ YL+T+ L+G  V +N+  L+     
Sbjct: 285 YGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGS 344

Query: 330 XXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKI 389
                  P+V+A    G+ V+PH  NA +L+ V S  NS LY + R +  LA    APK 
Sbjct: 345 ATHAS--PYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKF 402

Query: 390 FAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIY 449
               ++ G P  +LILC +F ++ +++ SS   +VF +   +  +  L +W  I+++++ 
Sbjct: 403 LDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVR 462

Query: 450 FDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG-----HKFDYKNF 504
           F + ++  G  +  + + A     G+ + + F  L+  I  F V L       K D ++F
Sbjct: 463 FRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLV-FIAQFWVALAPPSLHGKVDAESF 521

Query: 505 ITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFK-----ELIDLEEEEGKLWDAA 557
              Y+  P+++  +FGY  Y R   F+ P ++ DL   +     ELI  E+EE       
Sbjct: 522 FQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEE------- 574

Query: 558 QKEKMESS 565
            KEK+++S
Sbjct: 575 NKEKIKNS 582

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  233 bits (593), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 153/518 (29%), Positives = 258/518 (49%), Gaps = 27/518 (5%)

Query: 47  DGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYI 106
           + KH+   LK+ +++RH+ M                       P    I +  +G  VY 
Sbjct: 84  NAKHE--NLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYC 141

Query: 107 VMTCLGEMAT-YIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQY 164
           V+   GE+A  Y  L  GF +Y S   DPALGFA  + Y  ++L + P +L  A++ +++
Sbjct: 142 VIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKF 201

Query: 165 WVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGG 224
           W     VNP +++ IF V+I+ IN            + +S KVL+M+   ++  +I  G 
Sbjct: 202 WPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGA 261

Query: 225 GPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSF---VAVFVYALFAYLGTELCGIVAA 281
             +   +G ++++DPG+         G +  F  F   VA  V A F+   +E   + AA
Sbjct: 262 VGTSGYIGGKYWRDPGSL--------GGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAA 313

Query: 282 ECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVA 341
           E  NPR+++P A K  +Y+I V +L ++ L+G  V  +   L+            P+V+A
Sbjct: 314 EQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVS--PYVIA 371

Query: 342 IKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYN 401
           ++  G+ V+P   NA +L+ V S  NS  Y +SR L+ LA  N APKIF   ++ G P  
Sbjct: 372 VRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLM 431

Query: 402 SLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDK 461
           ++I+ ILF  + ++  S    +VF + + +  +  L +W  I +++I F RAL  QG   
Sbjct: 432 AMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYST 491

Query: 462 STLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIIC 517
             L + A     G+Y +     L ALI  F V L      + D ++F TGY+ +P+F++ 
Sbjct: 492 DELGFKAQTGIIGSYVSAIMMVL-ALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLF 550

Query: 518 FFGYKYIRG--TKFVKPEEADLYTFKELID---LEEEE 550
           +FGYK        F++ ++ DL + + + D   L++E+
Sbjct: 551 YFGYKIWNKDWRLFIRADQIDLVSHRRIFDADVLKQED 588

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  233 bits (593), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 166/585 (28%), Positives = 281/585 (48%), Gaps = 52/585 (8%)

Query: 18  NSNTTSKDVENLDLS------NQDDISSQ-----ESHLNIDGKHDG-------------- 52
            SNT S+ VE + L       ++DD  S+      +    DG  DG              
Sbjct: 25  KSNTGSESVERISLPGDDYKFHEDDSKSRFRRFARTFHRADGLGDGASGNDVEFGAEVAR 84

Query: 53  ---IRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMT 109
               +LK+ +  RHV M                       P  ++I Y+ +G  +Y ++ 
Sbjct: 85  QTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQ 144

Query: 110 CLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVS 167
             GE+A +Y  L G F +Y S   + A GF+V + Y  ++L + P +L  A++ ++YW +
Sbjct: 145 AAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTT 204

Query: 168 REKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPS 227
              VNP +++ IF V+I+ +N            + +  KVL+++   +L  ++  GG  +
Sbjct: 205 --SVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGN 262

Query: 228 HDRLGFRFYKDPGAFRPYSEAISGSK--GKFVSFVAVFVYALFAYLGTELCGIVAAECKN 285
              +G R++ +PGAF        G+K    F   ++  V A FA+  TE   + AAE  N
Sbjct: 263 DGYIGGRYWNNPGAFY-------GTKPIHHFKGIISTMVTAAFAFGATEFIALTAAEQAN 315

Query: 286 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNA 345
           PRR +P A K  +YRI++ +L  I L+G  V +N P L+            P+V+A+ + 
Sbjct: 316 PRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHAS--PYVIAVASH 373

Query: 346 GIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLIL 405
           G+ V+PH  NA +L+ V S  NS  Y +SR L  LA  + AP      ++ G P  ++++
Sbjct: 374 GVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLV 433

Query: 406 CILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLA 465
             +F L++++  S     VF + + +  +  L +WI+I +++I F +AL  QG     L 
Sbjct: 434 SCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELG 493

Query: 466 YAAPLASKGAYFALFFCCLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGY 521
           Y +     G+Y+A F    I LI  F V +      K D  +F   Y+ +P+F++ +FG+
Sbjct: 494 YKSQTGVAGSYYATFIMGCI-LIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGF 552

Query: 522 K-YIRGTKFVKP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMES 564
           K + R  +   P E+ DL + ++  D  EE  K  DA  +E + +
Sbjct: 553 KIWKRDWRLYIPLEQIDLDSHRKTFD--EELLKQEDAEYEENIRN 595

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  233 bits (593), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 157/527 (29%), Positives = 260/527 (49%), Gaps = 19/527 (3%)

Query: 28  NLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXX 87
           NLD+      S        D    G +LKK ++ RHV +                     
Sbjct: 89  NLDMELVGVTSETIEQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQ 148

Query: 88  XXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPL-DGFTSYASRYCDPALGFAVGYSYLF 145
             P  ++I Y  +G L+Y ++   GEMA  Y+ L  GF +Y +   DP   FA  + Y  
Sbjct: 149 AGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCL 208

Query: 146 KYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWL-SS 204
           ++L + P +L  A++ ++YW +  KV+P V++ IF V I+ IN            ++ +S
Sbjct: 209 QWLCVCPLELVTASMTIKYWTT--KVDPDVFVIIFYVFILGINILGGARGYAEAEFIFNS 266

Query: 205 FKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFV 264
            K+L+M+   +L  +I+ GG  +   +G R++ DPGAFR    A+     +F   VA  V
Sbjct: 267 CKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRG-ERAVD----RFKGVVATLV 321

Query: 265 YALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLL 324
            A F++  +E   + A+E  NPRR +P A K  +YR +  YL +I LLG  V YN   LL
Sbjct: 322 TAAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLL 381

Query: 325 QXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDN 384
                       P+V+A+ N G+ V+PH  NA +++ V S  NS  Y + R L  L+   
Sbjct: 382 --GAQSNGIKASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQG 439

Query: 385 KAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAIL 444
            APKIF+  ++ G P   +I+  LF ++A+   S    QVF + + V  +  + +W++I 
Sbjct: 440 FAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSIC 499

Query: 445 ITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFD 500
           ++++ F RA+  QG       + + +   G+ ++ F   LI L+  F V L      K D
Sbjct: 500 LSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALI-LVGQFWVALKPVGSKKVD 558

Query: 501 YKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEADLYTFKELID 545
             +F   Y+  P++I  + GYK Y +  + ++K ++ DL   +++ D
Sbjct: 559 ANSFFENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYD 605

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  232 bits (592), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 157/569 (27%), Positives = 273/569 (47%), Gaps = 24/569 (4%)

Query: 8   YRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMX 67
           +R+ ++            +++  L+   DI  +      +   D   LKK ++ RHV M 
Sbjct: 63  FRRFIDSFKKAEGPQPGSLDHDVLAGDSDIEGK-PRTEPEKDDDARELKKTIKPRHVVMI 121

Query: 68  XXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMAT-YIPL-DGFTS 125
                                 P  ++I Y+ +G  +Y ++   GE+A  Y  L  GF +
Sbjct: 122 SLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNA 181

Query: 126 YASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIV 185
           Y S   DPA GFAV + Y  ++L + P +L  A++ ++YW +  KV+P V++ IF  +I+
Sbjct: 182 YPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTT--KVDPDVFVVIFYCLIL 239

Query: 186 TINXXXXXXXXXXXXWL-SSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRP 244
            IN            +  +SFK+L++    +L  V++ GG  +   +G R + +PG+FR 
Sbjct: 240 CINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSFR- 298

Query: 245 YSEAISGSK--GKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302
                 G K   +F   V+  V A FA+  +E  G+ A+E  NPR+ +P A K  LYRI+
Sbjct: 299 ------GDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRII 352

Query: 303 VFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFV 362
             YL ++ ++G  V Y+   LL            P+V+AI   G+ V+PH  NA +L+ V
Sbjct: 353 CIYLGSVTIVGFLVPYDSDQLLGSSGAATKAS--PYVLAISLHGVRVVPHFINAVILLSV 410

Query: 363 FSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSA 422
            S  NS  Y +SR L  L+    AP      ++ G P  +  +  L  ++A+   S    
Sbjct: 411 LSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKED 470

Query: 423 QVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFC 482
           QVF + + +  +  L +W +I ++++ F RA+R QG     + + + +   G+ ++    
Sbjct: 471 QVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMM 530

Query: 483 CLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYKYIRGT--KFVKPEEADL 537
            LI + + +T  +     K D + F   Y+ +P+FI+ +FG+K  +     F++ E+ DL
Sbjct: 531 VLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDL 590

Query: 538 YTFKELIDLEEEEGKLWDAAQKEKMESSP 566
            + +E+ D  EE  K  D   + K+   P
Sbjct: 591 VSHREIFD--EELLKQEDEEYRRKLRDGP 617

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  232 bits (591), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 164/570 (28%), Positives = 285/570 (50%), Gaps = 30/570 (5%)

Query: 17  SNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXX 76
           SNS+T +    +     +D+  S     ++DG     ++ K+L+ RH+            
Sbjct: 61  SNSSTGAGGKGDSHSLTRDEAGSGVMKEDVDGHP---QMNKDLDVRHLLTLAVGGAIGTG 117

Query: 77  XXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPAL 135
                        P S++I +  +   ++ V+  LGE+A   P+  GF  Y +R+ DP+ 
Sbjct: 118 LFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSF 177

Query: 136 GFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXX 195
           GFAV  +YL ++L++ P +L AA++ ++YW   +K+N   W+ IF   I   N       
Sbjct: 178 GFAVNINYLAQWLVLLPLELVAASITIRYW--NDKINSDAWVAIFYAAIAFANMLDVKSF 235

Query: 196 XXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGK 255
                 LS  K+L ++   +L  V+  GGGP    +G +++ DPGAF   +     S  K
Sbjct: 236 GETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGKYWHDPGAFVGET-----SGTK 290

Query: 256 FVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMT 315
           F    +VFV A F+Y G EL  + AAE  NPR  +P+A K T + I + Y+  + L+G  
Sbjct: 291 FKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCL 350

Query: 316 VAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASR 375
           V YN+P LL            P V+AI+N GI  LP + NA +L+ + S  NS +Y  SR
Sbjct: 351 VPYNNPKLLNGSSSVDAASS-PLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSR 409

Query: 376 SLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIF 435
            +  +A     P+   + ++ G P N+ +L + F LL+++  S    +VF +   +  + 
Sbjct: 410 CMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLS 469

Query: 436 GLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL 495
            + +W+AI +++I F +A+  QG+    L Y +     G+++ +    L+ L+ +F   L
Sbjct: 470 TIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLV-LVASFWTSL 528

Query: 496 ----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKPEEADLYTFKELIDLE-- 547
               G   D  +F  GY+  P+ I+C+ G+K YIR  +  +   + DL + ++++D+E  
Sbjct: 529 FPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVDVEVC 588

Query: 548 EEEGKLWDAAQKEKMESSPKNFKWFYEKFL 577
            EE ++    +KE++       + F+ +FL
Sbjct: 589 REEMRI----EKEQLAK-----RSFFARFL 609

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  231 bits (590), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 156/555 (28%), Positives = 267/555 (48%), Gaps = 25/555 (4%)

Query: 13  EKIVSNSNTTSKDVE-NLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXX 71
           EK++     + K  E ++  + Q + ++ +    I+      +LKK +++RHV M     
Sbjct: 48  EKLIHRLANSFKRAEGSITKTRQINENTSDLEDGIESITSDSKLKKSMKSRHVVMMSLGT 107

Query: 72  XXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTSYASR 129
                             P +++I Y  V F+ Y ++   GEMA   P     F +Y+S 
Sbjct: 108 GIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSI 167

Query: 130 YCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINX 189
           +     GFA  + Y F++L + P +L  A++ +QYW   +K+NP V+I IF + ++ I+ 
Sbjct: 168 FISKPFGFATVWLYCFQWLTVLPLELITASMTIQYW--NDKLNPDVYILIFYIFLLFIHV 225

Query: 190 XXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAI 249
                        +  K+L++   I+L  VI  GG      +G  ++ +PGAF     A 
Sbjct: 226 FGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGYIGGAYWHNPGAF-----AG 280

Query: 250 SGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTI 309
             S  +F +   + V   F++ G EL  +   E  NPR++ P A K ++YRIV+ YL+T+
Sbjct: 281 DTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTM 340

Query: 310 FLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSD 369
            L+G  V YND  L+            P+V+A    G+ ++PHI NA +L+ V S  NS 
Sbjct: 341 ILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVPHIINAVILISVVSVANSS 398

Query: 370 LYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFV 429
           LY   R +  L+    APK     ++ G P  +LI+C +F ++A++  SS    VF +  
Sbjct: 399 LYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLA 458

Query: 430 NVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIK 489
            +  +  L +W +I+++++ F +A++ QG     L Y A     G+ +  FF  L+  I 
Sbjct: 459 AIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSVYGFFFNILV-FIA 517

Query: 490 NFTVFLG-----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFK- 541
            F V L       +   ++F   Y+  P+++  FFGY  Y R    + P ++ DL   + 
Sbjct: 518 QFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRR 577

Query: 542 ----ELIDLEEEEGK 552
               ELI  E++E +
Sbjct: 578 IYDPELIRQEDQENE 592

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  231 bits (590), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 157/519 (30%), Positives = 271/519 (52%), Gaps = 19/519 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK  L++RH+ M                       P  ILI ++  G ++Y ++  +GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + GFA+ ++Y+ ++LI  P ++ +A++ + YW    K   
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F V  V IN              +  KV+ ++  I++  +++ GGGP    +G 
Sbjct: 207 G-FVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGA 265

Query: 234 RFYKDPGAFRPYSEAISGSKG-KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
           +++  PGAF      +  + G KF  F  VF+ A F++ G+E+ G+  +E +NPR++VP 
Sbjct: 266 KYWHHPGAF------VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPG 319

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K   +RI +FY++ + L+GM V YND  L+            PFV+A+ N GI  LP 
Sbjct: 320 AAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAAS--PFVIAVVNQGIRGLPS 377

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           + N  +L+ V S  NS +Y+ SR+L  LA     PKI A  ++ G P  ++ +   F L+
Sbjct: 378 VINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLI 437

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           A++  SS   +VFN+ + +  +  L SW AI I +I F RAL AQG     L + + +  
Sbjct: 438 AFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGI 497

Query: 473 KGAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYKYIRGT-- 527
            G+Y+ +F C L+ LI  F V L   G   + K+F   Y+  P+ +  +  +K  +    
Sbjct: 498 AGSYWGIFICVLM-LIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWK 556

Query: 528 KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
            ++K E+ D+ T +  +D +  + ++  AA++  + + P
Sbjct: 557 LYIKAEDMDIDTGRREVDRDLLKQEV--AAERADLAARP 593

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  231 bits (588), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 166/559 (29%), Positives = 272/559 (48%), Gaps = 35/559 (6%)

Query: 8   YRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMX 67
           +R    + V +      +   +DL  +D  +S +S  N         LKK +++RHV M 
Sbjct: 41  HRTHFNRFVDSFKRAEVNHNGIDL--EDGTNSIQSDDN---------LKKAMKSRHVIMM 89

Query: 68  XXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTS 125
                                 P S++I Y  V F+ Y V+   GEMA   P    GF +
Sbjct: 90  SLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNN 149

Query: 126 YASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIV 185
           YAS +     GFA  + +  ++L + P +L  A++ ++YW   +K+N  V++ I  V ++
Sbjct: 150 YASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW--NDKINADVFVVILYVFLL 207

Query: 186 TINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPY 245
            I+              +S K+L++   ++L  V+  GG      +G ++++DPGAF   
Sbjct: 208 FIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASD 267

Query: 246 SEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFY 305
           + A   S+ K V+FV V  Y  F+Y G EL  +   E +NPRR+ P A K ++YRI++ Y
Sbjct: 268 NAA---SRFKGVAFVLVTAY--FSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIY 322

Query: 306 LVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSA 365
           L+T+ L+G  V +N   L+            P+V+A+   G+ V+PHI NA +L+ V S 
Sbjct: 323 LLTMILIGFNVPHNSDQLMGAGGSATHAS--PYVLAVSIHGVKVVPHIINAVILISVTSV 380

Query: 366 CNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVF 425
            NS LY + R L  LA    APK F   ++ G P  +LILC +F ++A+   S     +F
Sbjct: 381 ANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIF 440

Query: 426 NYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLI 485
            +   +  +  L +W +IL++++ F  A++AQG   + L Y +     G+ +  FF  L+
Sbjct: 441 TWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLV 500

Query: 486 ALIKNFTVFL---GHK--FDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLY 538
             I  F V L   G K  +  + F   Y+  PV++  + GY  Y R   F+   ++ DL 
Sbjct: 501 -FIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLD 559

Query: 539 TFK-----ELIDLEEEEGK 552
             +     EL+  E+EE K
Sbjct: 560 NHRRLYDPELLRQEDEETK 578

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  231 bits (590), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 162/545 (29%), Positives = 268/545 (49%), Gaps = 31/545 (5%)

Query: 47  DGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYI 106
           D   +  +L K L  RH+                         P SILIA++ +   ++ 
Sbjct: 101 DAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFT 160

Query: 107 VMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYW 165
           ++  LGE+A+  P+  GF  Y +R+ +P+ GFAV  SYL ++ ++ P +L AA++ ++YW
Sbjct: 161 IVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYW 220

Query: 166 VSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGG 225
               K+N   W+ IF V I   N             LS  K+L +    +L  V++ GGG
Sbjct: 221 --NNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGG 278

Query: 226 PSHDRLGFRFYKDPGAFRPYSEAISGSKG-KFVSFVAVFVYALFAYLGTELCGIVAAECK 284
           P    +G +++ DPGAF      +  + G +F    +VFV A F+Y GTEL G+ AAE  
Sbjct: 279 PVGGFIGAKYWHDPGAF------VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESI 332

Query: 285 NPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKN 344
           NPR  +PRA K + + I   YL+ + + G  V  NDP LL            P V+AI+N
Sbjct: 333 NPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAAS-PLVIAIEN 391

Query: 345 AGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLI 404
            GI  +P + NA +L+ + S  NS +Y  SR +  +A     PK+F   ++ G P  +++
Sbjct: 392 GGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAIL 451

Query: 405 LCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTL 464
             ++F LL+++  S     +F +   +  +  L  W AI I++I F RA+ AQ      L
Sbjct: 452 ATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDEL 511

Query: 465 AYAAPLASKGAYFA---LFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGY 521
            Y +     G+++    L F  +++   +           ++F  GY+  P+F+IC+  +
Sbjct: 512 PYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISH 571

Query: 522 K-YIRGTK-FVKPEEADLYTFKELIDLEE-EEGKLWDAAQKEKMESSPKNF--KWFYEKF 576
           K Y R  + F+   + D+ + +  +D+EE +E KL     +E+ E++ K F  +W     
Sbjct: 572 KLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKL-----REQAETAKKPFYVRW----- 621

Query: 577 LGWIF 581
             WIF
Sbjct: 622 --WIF 624

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  231 bits (588), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 149/502 (29%), Positives = 254/502 (50%), Gaps = 16/502 (3%)

Query: 51  DGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTC 110
           +   L K+L  RH+                         P S++I +  V   ++ V+  
Sbjct: 84  NNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINS 143

Query: 111 LGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSRE 169
           LGE+A   P+  GF  Y +R+ +P+  FA+  +YL ++L++ P +L AA++ ++YW   +
Sbjct: 144 LGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYW--ND 201

Query: 170 KVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHD 229
           K+N   W+ IF   I   N             LS  K+L ++   +L  V+  GGGP   
Sbjct: 202 KINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGG 261

Query: 230 RLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRN 289
            +G +++ +PGAF  +S   +GS+  F    +VFV A F+Y G E+  + AAE +NP+  
Sbjct: 262 YIGGKYWHNPGAFVGHS---AGSQ--FKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKET 316

Query: 290 VPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPV 349
           +P+A K T + I V Y+  + L+G  V YNDP LL            P V+AI+N GI  
Sbjct: 317 IPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAAS-PLVIAIENGGIKG 375

Query: 350 LPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILF 409
           LP + NA +L+ + S  NS +Y  SR +  +A     PK  +K +K G P N+++L + F
Sbjct: 376 LPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFF 435

Query: 410 CLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAP 469
            LL+++  S    +VF +   +  +  +  W+AI ++ I F  A++AQG     + + + 
Sbjct: 436 GLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQ 495

Query: 470 LASKGAYFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YI 524
             + GA++ +    L+ L+ +F   L          K+F  GY+ +P+ I C+ G+K + 
Sbjct: 496 SGTWGAWYGVIVLFLV-LVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWK 554

Query: 525 RGTKFVKP-EEADLYTFKELID 545
           R  + + P  E DL + + ++D
Sbjct: 555 RDWRLLVPLMEMDLDSGRRVLD 576

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  229 bits (585), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 152/527 (28%), Positives = 261/527 (49%), Gaps = 13/527 (2%)

Query: 32  SNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPV 91
            +  ++  + S     GK+      ++LE RHV +                        V
Sbjct: 32  EHSSEVGDEASSAGFAGKYHST--YRKLENRHVQLIGISGVIGTALFVSIGKALYRGGSV 89

Query: 92  SILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLII 150
           S+L+ ++     +  +     EM  Y+PL+  F   ASR  + +L    G+++ F   + 
Sbjct: 90  SLLLGFALWCVPILCITVSTAEMVCYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQ 149

Query: 151 TPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVM 210
            P ++ A   ++ YW  R+  +  + + + +++ + I+            WL+SFKVL+ 
Sbjct: 150 IPFEIVAVNSIIHYW--RDDYSAAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLA 207

Query: 211 LCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS---EAISGSKGKFVSFVAVFVYAL 267
           + L    FV M+GG P  DR GFR+  +   F+ YS   E IS S G F  F+A  + A 
Sbjct: 208 VGLFCFTFVTMVGGNPKRDRYGFRYIGE-APFKQYSPTMEPISSSAGYFQGFLACLIQAS 266

Query: 268 FAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDP-LLLQX 326
           F   G +   ++A E K PR+ +P A K    R+ V +L     +G+  + NDP L    
Sbjct: 267 FTIAGPDYVSMIAGETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAI 326

Query: 327 XXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKA 386
                     P+V+A+ + GI +LP I NA ++   FSA N+  Y +SRSLYGLA+D  A
Sbjct: 327 NASRPGAGSSPYVIAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYA 386

Query: 387 PKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILIT 446
           P IF + N++GVP  ++ + +++ +L+ + ++S SA V N+ +++++   L+++  + + 
Sbjct: 387 PAIFKRCNRFGVPIYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVV 446

Query: 447 YIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFIT 506
           Y+YF RA  AQ  +   L++ +      AY  L    LI +++ +TVF    ++ K+F+ 
Sbjct: 447 YLYFRRAYLAQQDNLPELSFKSWWQPYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLF 506

Query: 507 GYIGIPVFIICFFGYKYI--RGTKFV-KPEEADLYTFKELIDLEEEE 550
            Y+ + + I  + GY+YI  RG   V  P E DL T    I+L E  
Sbjct: 507 CYLMVFIDIAIYLGYRYIWRRGKDAVIPPTEVDLTTGLLEIELHERH 553

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  230 bits (587), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 147/542 (27%), Positives = 264/542 (48%), Gaps = 25/542 (4%)

Query: 41  ESHLNIDGKHD---GIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAY 97
           ES ++ D +         +++LE RHV +                       P S+L+A+
Sbjct: 69  ESFIDEDSRTHLLFSTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAF 128

Query: 98  SFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLT 156
           +     +  +     EM  + P+   F   A++  D +      +++ F   +  P ++ 
Sbjct: 129 ALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSFAVMASWNFWFLECVQIPFEIV 188

Query: 157 AAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVL 216
           +   ++ YW  R+  + G+ + + +V+ + I+            WL+SFK+++ L L + 
Sbjct: 189 SVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIF 246

Query: 217 LFVIMLGGGPSHDRLGFRFYKDP--GAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTE 274
            F+ MLGG P HDR GFR Y +     + P  + +  S G F  F+A  + A F   G E
Sbjct: 247 TFITMLGGNPKHDRYGFRNYGESPFKKYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGE 306

Query: 275 LCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDP-LLLQXXXXXXXX 333
              ++A E K PR+ +P+A K    R+   +L +   +G+  + NDP L           
Sbjct: 307 YISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGA 366

Query: 334 XXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKT 393
              P+V+A+ N  I +LP I N  ++   FSA N+  Y +SR+ YG+A+D  APK+F + 
Sbjct: 367 GSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRC 426

Query: 394 NKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRA 453
           N+ GVP  S+ + +++ L++ + ++S SA V N+ +N+++   L++++ + ITY++F RA
Sbjct: 427 NRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCITYLFFRRA 486

Query: 454 LRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPV 513
              Q      L + +      A   L  C  + LI+ +TVF    +  ++F+  Y+ + +
Sbjct: 487 YHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFI 546

Query: 514 FIICFFGYKYI--RGT-KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFK 570
            I  + GYK+I  RG  KF  P E D    KEL+++E  E           +ESS + F+
Sbjct: 547 NIGIYVGYKFIWKRGKDKFKNPHEIDFS--KELVEIENHE-----------IESSFEKFQ 593

Query: 571 WF 572
           ++
Sbjct: 594 YY 595

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  229 bits (585), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 157/522 (30%), Positives = 257/522 (49%), Gaps = 24/522 (4%)

Query: 54  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGE 113
           +LK+ + +RH+ M                       P  + I Y+ +G  +Y ++   GE
Sbjct: 78  KLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQAAGE 137

Query: 114 MA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKV 171
           MA +Y  L G F +Y S   DPALGF+V + Y  ++L + P +L  A + ++YW +   V
Sbjct: 138 MAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTT--AV 195

Query: 172 NPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRL 231
           NP V++ IF V+ V +N            + ++ KVL++    +L  ++  GG  +   L
Sbjct: 196 NPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYL 255

Query: 232 GFRFYKDPGAFRPYSEAISGSK--GKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRN 289
           G +++ DPGA       + G+K    F   +A  V A FA+  TE   + AAE  NPRR 
Sbjct: 256 GGKYWHDPGA-------LYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPRRA 308

Query: 290 VPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPV 349
           +P A K  +YR+++ +L  I LLG  V YN   L+            P+V+AI + G+ V
Sbjct: 309 IPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHAS--PYVIAIASHGVKV 366

Query: 350 LPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILF 409
           +PH  NA +L+ V S  NS  Y +SR L  L+  + AP      ++ G P  ++++  +F
Sbjct: 367 VPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIF 426

Query: 410 CLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAP 469
            L+A++  S     VF + + +  +  L +WI I +++I F +AL  QG     L Y + 
Sbjct: 427 GLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQ 486

Query: 470 LASKGAYFALFFCCLIALIKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYK-YI 524
               G+Y+A      + L   F V +      K D  NF   Y+ +P+ I  +FGY+ + 
Sbjct: 487 TGVVGSYYATVIMACV-LTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWK 545

Query: 525 RGTKFVKP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESS 565
           R  K   P E+ DL + +++ D  E+  K  DA  +E + +S
Sbjct: 546 RDWKLYIPLEQIDLVSHRKVFD--EDLLKQEDAEYEESIRNS 585

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  230 bits (586), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 153/527 (29%), Positives = 254/527 (48%), Gaps = 25/527 (4%)

Query: 50  HDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMT 109
             G  LK++++ RHV M                       P  + I Y+ +G  +Y ++ 
Sbjct: 97  EKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQ 156

Query: 110 CLGEMATYIP-LDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVS 167
             GE+A   P L G F +Y S   DPA+ FA    Y  ++L + P ++ +AA+ ++YW  
Sbjct: 157 AAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW-- 214

Query: 168 REKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPS 227
              +NP VW  IF V+I+ IN            + ++ K+L+     +L  +I  GG   
Sbjct: 215 NTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGD 274

Query: 228 HDRLGFRFYKDPGAFRPYSEAISGSKG--KFVSFVAVFVYALFAYLGTELCGIVAAECKN 285
              +G +++ DPGAF       +G  G  +F + V+  V A FA+  +E   + A+E  N
Sbjct: 275 SVYIGGKYWNDPGAF-------NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQAN 327

Query: 286 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNA 345
           PR+ +P A K  LYRI+  YL +I L+G  V YN P L+            P+V+A+ + 
Sbjct: 328 PRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSS--PYVIAVASH 385

Query: 346 GIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLIL 405
           G+ V+P   NA +L+ V S  N   Y +SR L  L+    APK F   ++ G P  ++I+
Sbjct: 386 GVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIV 445

Query: 406 CILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLA 465
             L   + +++ SS    VF + + V  +  L +W  I I+++ F +A++ Q      L 
Sbjct: 446 GALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELG 505

Query: 466 YAAPLASKGAYFALFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFG 520
           + + +   G+Y+ +F   L+  I  F V L         D +NF   Y+ +PVF+  +FG
Sbjct: 506 FRSQVGVWGSYYGIFMMILV-FIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFG 564

Query: 521 YKYIRGT--KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESS 565
           +K  +     ++   E DL + +++ D  EE  K  D   K KM+ +
Sbjct: 565 FKIWKKDWRLYIPASEIDLISHRKIFD--EEILKQEDEEYKIKMKHA 609

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  229 bits (584), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 153/535 (28%), Positives = 264/535 (49%), Gaps = 26/535 (4%)

Query: 20  NTTSKDV---ENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXX 76
           N  SKD    +N+D+++Q  ++ ++ + +         L K+L  RH+            
Sbjct: 49  NEKSKDSPIEDNIDITSQSSVTKEDINKS---------LNKDLSIRHLLTLAVGGAIGVG 99

Query: 77  XXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPAL 135
                        P S++I +  +   ++ V+  LGE+A   P+  GF  Y +R+ DP+ 
Sbjct: 100 LFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSF 159

Query: 136 GFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXX 195
            FAV  +YL ++L++ P +L AA++ ++YW S   +N   W+ IF  +I   N       
Sbjct: 160 AFAVNLNYLAQWLVLLPLELVAASITIKYWNS--TINSDAWVAIFYTVITLANMLDVKSF 217

Query: 196 XXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGK 255
                 LS  K+L ++   +L  V+  GGGP    LG +++ +PGAF  ++     S  K
Sbjct: 218 GETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHT-----SGTK 272

Query: 256 FVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMT 315
           F    +VFV A F+Y G E+  + AAE K+PR+ +P+A K T + I   Y+  + L+G  
Sbjct: 273 FKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCL 332

Query: 316 VAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASR 375
           V Y+DP L+            P V+AI+N GI  L  + NA +L+ + S  NS +Y  SR
Sbjct: 333 VPYDDPRLMSGTSSVDAAAS-PLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSR 391

Query: 376 SLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIF 435
            +  +A     PK   K +K G P N+ ++ + F LL+++  S    +VF +   +  + 
Sbjct: 392 CMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLS 451

Query: 436 GLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL 495
            +  W+AI I++I F +A+  Q      + Y +     G+ + +    L+ +   +T   
Sbjct: 452 TIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLF 511

Query: 496 ---GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELID 545
              G   D ++F  GY+ +P+ I+C+ G+K Y +   +V   EE DL T ++ +D
Sbjct: 512 PLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALD 566

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  228 bits (581), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 146/472 (30%), Positives = 244/472 (51%), Gaps = 13/472 (2%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK  L+ RH+ M                       P S+LI +   G ++Y ++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G FT+YA+R+ D + G+A  ++Y+ ++L++ P ++ +A++ + +W +  K   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F V+IV IN              S  KV+ ++  I+L  ++  GGGP    +G 
Sbjct: 206 G-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGG 264

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPGAF     A      KF    +VFV + F++ G+EL G+ A+E   PR++VP+A
Sbjct: 265 KYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKA 319

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K   +RI +FY++++ ++G+ V YND  L+            PFV+AIK  GI  LP +
Sbjct: 320 AKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAAS--PFVIAIKTHGIKGLPSV 377

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS +Y  SR++  LA     P+IFA  ++ G P   + +   F L+A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIA 437

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S     VFN+ + +  +  L +W  I I +I F +AL AQG D   L++ +P    
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 474 GAYFALFFCCLIALIKNFTVFL---GHKFDYKNFITGYIGIPVFIICFFGYK 522
           G+Y+ LF   +I  I  F V L   G     + F   Y+  P+ +  + G+K
Sbjct: 498 GSYWGLFM-VVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHK 548

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  229 bits (584), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 149/555 (26%), Positives = 270/555 (48%), Gaps = 29/555 (5%)

Query: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63
           +Q   RK     V         V + +LS  + ++ + +            L + L+ RH
Sbjct: 41  VQPEPRKGWNGFVDTFRRAEMPVIDPNLSEAEKLAIRTA---------AAPLSRRLKNRH 91

Query: 64  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG- 122
           + M                       P  +LI +     ++ I+   LGE+A   P+ G 
Sbjct: 92  LQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTFPVSGG 151

Query: 123 FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLV 182
           + +YA+R+ D + GFA  ++Y+ + +++ P ++ AA++ + YW +  K     ++ +F V
Sbjct: 152 YITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKLA-FVALFWV 210

Query: 183 IIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAF 242
           +IV+IN              S  KV+ ++  I++  V++ GGGP H+ +G +++ DPG F
Sbjct: 211 VIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPF 270

Query: 243 RPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIV 302
                  +    KF    +VFV A F++ G+EL G+ AAE + PR+++P+A K   +RI 
Sbjct: 271 -----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRIT 325

Query: 303 VFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFV 362
           +FY++++ ++G+ V  N+  LL            PFV+A+    I VLP I N  +L  V
Sbjct: 326 LFYILSLLIVGLLVPSNNEHLL--APQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAV 383

Query: 363 FSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSA 422
            S  NS +Y +SR++  LA     PKIF   ++ G P  ++    LF LL ++  +    
Sbjct: 384 ISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEG 443

Query: 423 QVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFC 482
           ++F++ + +  +    +W+ I + ++ F  AL+AQG   + L++ +P    G+ +A+   
Sbjct: 444 EIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLI 503

Query: 483 CLIALIKNFTVFL--------GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK-FVKP 532
           C++ L+  F V L          K     F   Y+   V I+ +  +K + R  K F+K 
Sbjct: 504 CVV-LVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKA 562

Query: 533 EEADLYTFKELIDLE 547
           +E D+ T +  +DLE
Sbjct: 563 KEMDIDTGRRELDLE 577

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  230 bits (587), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 153/532 (28%), Positives = 265/532 (49%), Gaps = 27/532 (5%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           + K+L  RH+                         P S++I +  V   ++ V+  LGE+
Sbjct: 141 MNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGEL 200

Query: 115 ATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+  GF+ Y  ++ DP+  FAV  +YL ++L++ P +L AA++ ++YW S   +N 
Sbjct: 201 AAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNS--SINS 258

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
             W++IF V I   N             LS  K+L ++   +L  V+  GGGPSH+ +G 
Sbjct: 259 DAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGG 318

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPGAF   +   SGSK  F    +VFV A F++ G E+  + AAE +NPR  +P+A
Sbjct: 319 KYWHDPGAFVGTT---SGSK--FKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKA 373

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K T + I   Y+  + L+G  V YNDP L+            P V+AI+N  I  LP +
Sbjct: 374 AKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASS-PLVIAIENGHIHGLPSL 432

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            NA +L+ + S  NS +Y  SR +  ++     PK+FAK ++ G P  ++   + F LL+
Sbjct: 433 MNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLS 492

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S   A+VF +   +  +  +  W+ I + +I F + +  Q +    L + +     
Sbjct: 493 FVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIW 552

Query: 474 GAYFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTK 528
           G+ + +    L+ L+ +F   L      K +  +F  GY+  P+ + C+  +K Y +  +
Sbjct: 553 GSIYGIVILFLV-LVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWR 611

Query: 529 FVKP-EEADLYTFKELIDLE--EEEGKLWDAAQKEKMESSPKNFKWFYEKFL 577
           +  P  + DL++ ++ +DLE   EE +L    +KE +       + F+ +FL
Sbjct: 612 WYIPASKMDLHSGRKQVDLEVVREELRL----EKEHLAQ-----RSFFYRFL 654

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  228 bits (582), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 156/549 (28%), Positives = 269/549 (48%), Gaps = 31/549 (5%)

Query: 18  NSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXX 77
            SNTT  + E +D S  + I S ++H             ++L  RHV +           
Sbjct: 44  TSNTTQIEEEEVD-STTNLIYSTKTH-------------RKLLNRHVQLIAISGVIGTAL 89

Query: 78  XXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDPALG 136
                       P  +LIA++     +  +     EM +++P+   F   AS+  D +L 
Sbjct: 90  FVAIGKALYHGGPAFLLIAFALWCIPILCITVSTAEMVSFLPVASPFLRLASKCADESLA 149

Query: 137 FAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXX 196
               +++ F   +  P ++ +   ++ YW  R+  N  + + + +V+ + I+        
Sbjct: 150 VTASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYNAAIPLVVQVVLYLFISIATVKYYG 207

Query: 197 XXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPY----SEAISGS 252
               WL+SFK+++ + L     V MLGG P HDR GFR++ +   F+ Y    +   + S
Sbjct: 208 EMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDRYGFRYWGEE-PFKKYYPDNNTNGTDS 266

Query: 253 KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLL 312
            G F  F+   + A F   G E   ++A E K PR+ +P+A K   +R+ + +L T   L
Sbjct: 267 LGYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLPRKVLPKAFKQVFWRLTIIFLGTCLCL 326

Query: 313 GMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLY 371
           G+  + NDP L              PFV+A+ N  I VLP I NA ++   FSA N+  Y
Sbjct: 327 GIVCSPNDPSLTAAINEARPGAGSSPFVIAMNNLRIRVLPDIVNAALITSAFSAGNAYTY 386

Query: 372 VASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNV 431
            +SR+LYG+A+D  APKIF + NK+GVP  ++ + +L+ L++ + ++S SA V N+ VN+
Sbjct: 387 CSSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGVSLLWALISLLQLNSNSAIVLNWLVNL 446

Query: 432 VSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNF 491
           ++   L++++ + + Y++F RA  AQ      L + +      A F L     +  I+ +
Sbjct: 447 ITASQLINFVFLCVIYLFFRRAYNAQKDKLPPLPFRSWGQPYTAIFGLVCAFSMIFIQGY 506

Query: 492 TVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI--RGT-KFVKPEEADLYTFKELIDLEE 548
           TVF+   ++ ++F+  Y+ + + +  + GYK+I  RG  KF+ P + D  T     DL+E
Sbjct: 507 TVFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIWKRGKDKFIDPHKVDFIT-----DLKE 561

Query: 549 EEGKLWDAA 557
            E    D A
Sbjct: 562 IEAHELDFA 570

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  228 bits (582), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 158/586 (26%), Positives = 287/586 (48%), Gaps = 38/586 (6%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLN-----IDGKHDGIRLKKELE 60
           DSY+    +  +  +    D+     S Q   +  +  ++     +DG      LK+ L+
Sbjct: 31  DSYKSSSFRTFTKQSKDDDDIAEGHSSYQPPRNIFQRCIDSFKPPLDGSFHTHNLKRTLK 90

Query: 61  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL 120
           ARH+ M                       P++++I +S  G  +   +  LGE+    P+
Sbjct: 91  ARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGEITVRFPV 150

Query: 121 DG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITI 179
            G F +Y++R+ DP++ F +   Y+ ++  + P ++ A+A+ +QYW   + ++P VW+ I
Sbjct: 151 VGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW--NQSIDPVVWVAI 208

Query: 180 FLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDP 239
           F  +IV+IN              SS KV+ ++  I+L  V++ GGGP HD +G R++ DP
Sbjct: 209 FYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGARYWHDP 268

Query: 240 GAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLY 299
           G           S G F   ++V V A ++  GTE+  + + E  NPR  +P AIK T +
Sbjct: 269 GCL---------SHG-FPGVLSVLVVASYSLGGTEMVCLASGE-TNPRE-LPSAIKQTFW 316

Query: 300 RIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVL 359
           RI+ F+L+++ L+G  V Y +P LL            PFV+AIK   I  LP I NA +L
Sbjct: 317 RILFFFLISLTLIGFLVPYTNPNLLGGSSVNNS----PFVIAIKLHHIKALPSIVNAVIL 372

Query: 360 MFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSS 419
           + + S  NS ++ +SR+L  +A     PK F   ++ G P   ++   LF LLA++  SS
Sbjct: 373 ISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSS 432

Query: 420 GSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFAL 479
              +VF++ + +  +   + W++I I++I F  A++AQG     L + + +   G+ ++ 
Sbjct: 433 SMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSA 492

Query: 480 FFCCLIALIKNFTVF--LGHKFDY----KNFITGYIG---IPVFIIC---FFGYKYIRGT 527
               LI + + +     +G   D     K F   Y+    +    +C   F+ YK  +  
Sbjct: 493 LINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFYRYKTGKWW 552

Query: 528 KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFY 573
             +  ++ DL T ++ ID++  + ++  A +   +++SP   +W++
Sbjct: 553 AIMDLDKIDLETDRKNIDIDVLKQEI--AERNRHLQASPWYVRWYH 596

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  228 bits (581), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 146/543 (26%), Positives = 264/543 (48%), Gaps = 19/543 (3%)

Query: 18  NSNTTSKDVENLDLSNQDDISSQESHLNIDGKHD---GIRLKKELEARHVSMXXXXXXXX 74
           N  +T  +  N+ +    + S+ E     D + +       +++LE RHV +        
Sbjct: 43  NHVSTIHEEGNMHVHEDGETSTDE-----DSRTNLLFSTETRRKLENRHVQLIAISGVIG 97

Query: 75  XXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDP 133
                          P S+L+A++     +  +     EM  + P+   F   A++  D 
Sbjct: 98  TALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDE 157

Query: 134 ALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXX 193
           +L     +++ F   +  P ++ +   ++ YW  R+  + G+ + + +V+ + I+     
Sbjct: 158 SLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVK 215

Query: 194 XXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDP--GAFRPYSEAISG 251
                  WL+SFK+++ L L +  FV MLGG P HDR GFR+Y +     + P  + +  
Sbjct: 216 YYGEMEFWLASFKIILALGLFIFTFVTMLGGNPKHDRYGFRYYGESPFKQYFPDGKDVGK 275

Query: 252 SKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFL 311
           S G F  F+A  + A F   G E   ++A E K PR+ +P+A K    R+   +L +   
Sbjct: 276 SSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLC 335

Query: 312 LGMTVAYNDP-LLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDL 370
           +G+  + NDP L              P+V+A+ N  I +LP + N  ++   FSA N+  
Sbjct: 336 VGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMKIRILPDVVNIALITAAFSAGNAYT 395

Query: 371 YVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVN 430
           Y +SR+ YG+A+D  APKIF K NK GVP  ++ + +++ L++ + ++S SA V N+ +N
Sbjct: 396 YCSSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGISLIWALVSLLQLNSNSAVVLNWLIN 455

Query: 431 VVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKN 490
           +++   L++++ + I Y++F R    Q      L + +      A   L  C  + +I+ 
Sbjct: 456 LITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPFRSWGQPYTAIIGLVSCLAMIMIQG 515

Query: 491 FTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI--RGTKFVK-PEEADLYTFKELIDLE 547
           +TVF    ++ ++F+  Y+ + + I  + GYK+I  RG   VK P + D    KELI++E
Sbjct: 516 YTVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFIWKRGKDKVKDPYKIDFS--KELIEIE 573

Query: 548 EEE 550
             E
Sbjct: 574 NHE 576

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  228 bits (581), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 157/529 (29%), Positives = 255/529 (48%), Gaps = 31/529 (5%)

Query: 45  NIDGKHDGI-------RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAY 97
           N     DGI       +LKK +++RHV M                       P +++I Y
Sbjct: 74  NTSDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGY 133

Query: 98  SFVGFLVYIVMTCLGEMATYIPL--DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQL 155
             V F+ Y ++   GEMA   P     F +Y+S +     GFA  + Y F++  + P +L
Sbjct: 134 VLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLEL 193

Query: 156 TAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIV 215
             A++ +Q+W   +K+NP ++I IF V ++ ++              +  K+L++   IV
Sbjct: 194 ITASMTIQFW--NDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIV 251

Query: 216 LLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTEL 275
           L  VI  GG  +   +G  ++  PGAF     A   S  +F +   + V A F++ G EL
Sbjct: 252 LSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMEL 306

Query: 276 CGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXX 335
             +   E  NPR++ P A K ++YRIVV YL+T+ L+G  V YND  LL           
Sbjct: 307 FVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHAS- 365

Query: 336 XPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNK 395
            P+V+A    G+ ++PHI NA +L+ V S  NS LY   R +  LA    APK     ++
Sbjct: 366 -PYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDR 424

Query: 396 WGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALR 455
            G P  +LI+C +  ++A++  SS    VF +   +  +  L +W +I+++++ F +A++
Sbjct: 425 EGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMK 484

Query: 456 AQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIG 510
            QG   + L Y A     G+ +  FF  L+  I  F V L     G K + + F   Y+ 
Sbjct: 485 VQGRSLNELGYKATTGIWGSIYGSFFNILV-FIAQFWVALAPLGNGGKCNAEAFFESYLA 543

Query: 511 IPVFIICFFGYK-YIRGTKFVKP-EEADLYTFK-----ELIDLEEEEGK 552
            P+++I + GY  Y R    + P ++ DL   +     EL+  E+EE K
Sbjct: 544 APIWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENK 592

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  232 bits (591), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 160/589 (27%), Positives = 276/589 (46%), Gaps = 70/589 (11%)

Query: 25  DVEN-LDLS-NQDDISSQESHLNID------GKHDGIRLKKELEARHVSMXXXXXXXXXX 76
           D EN  +LS ++D       HL  D      G  D   ++++L  RH+ M          
Sbjct: 224 DPENTFELSFSEDSGGKNGRHLMADLENLFFGTGDSHHIQRKLRVRHIQMIGIGACLGVG 283

Query: 77  XXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLD-GFTSYASRYCDPAL 135
                        P   L+ +S  G +V   +    E++T IPL  GF+  ASR+ + A 
Sbjct: 284 IFLTSGKAFSIAGPFGTLLGFSLSGSIVLATLLSFTELSTLIPLSSGFSGLASRFVEDAF 343

Query: 136 GFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGV---WITIFLVIIVTINXXXX 192
           GFA+G++Y F  +I  P Q+ A    L+Y+ S   +N G    + T+F++  V +N    
Sbjct: 344 GFALGWTYWFSCMITMPTQVVACTFYLKYFDSL-NLNKGAIAGFATLFMLYAVLVNLLDV 402

Query: 193 XXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGG-GPSHDRLGFRFYKDP--------GAFR 243
                   +++    +++  +++L  VI+  G G  +DR+GFRF+           G FR
Sbjct: 403 RLMGEIV-YITGLIKIIISIIMILAMVILNSGTGTKYDRVGFRFWDSSKSSSNLTYGLFR 461

Query: 244 PY----------SEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           P           ++ I GS G+F++  +  + + FAY G E+  + + E  NPR+ +P A
Sbjct: 462 PTFDLNDIGDGSTKGIEGSGGRFLALASTMLISTFAYTGVEMAFVASGEAINPRKTIPSA 521

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQ---------------------------- 325
            K T   ++V Y+ TIF + + +   DP L                              
Sbjct: 522 TKRTFCIVLVIYVFTIFSVSINIYCGDPRLQPYFTGSYSARYQAVQRGVGSQWQLSHKCH 581

Query: 326 -----XXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGL 380
                           P+V+A++N G+     +FN  ++ F   A  S L+ +SR+LY +
Sbjct: 582 TNIPYSTKDPVDHNSSPWVLALQNFGLCTFAAVFNGILIFFTSGAEISSLFSSSRTLYSM 641

Query: 381 AIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSW 440
           A+  KAP IF + NK GVPY S+I   +F ++ Y+ V SG+ + FN   N+ S    + W
Sbjct: 642 AVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVVGYLAVDSGAVENFNVLSNMSSASTSIIW 701

Query: 441 IAILITYIYFDRALRAQ----GVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG 496
           + + ++++ F  AL+ +      D+ +  Y +P     A++ LF CCL  +   FT F+ 
Sbjct: 702 MGLNVSFLRFYYALKTRRDIISRDEKSYPYRSPFQPYLAFYGLFGCCLFIIFMGFTNFIH 761

Query: 497 HKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELID 545
           H ++ K+F + Y G+ +F++C+ GYK I  +K  + ++ D+ T +  +D
Sbjct: 762 HFWNVKSFFSAYGGLILFVVCYLGYKMIGTSKIQRLDQLDMDTGRREMD 810

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  227 bits (579), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 144/524 (27%), Positives = 255/524 (48%), Gaps = 22/524 (4%)

Query: 56  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA 115
           +++LE RHV +                       P S+L+A++     +  +     EM 
Sbjct: 85  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 144

Query: 116 TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174
            + P+   F   A++  D +L     +++ F   +  P ++ +   ++ YW  R+  + G
Sbjct: 145 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 202

Query: 175 VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFR 234
           + + + +V+ + I+            WL+SFK+++ L L    F+ MLGG P HDR GFR
Sbjct: 203 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYGFR 262

Query: 235 FYKDP--GAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
            Y +     + P    +  S G F  F+A  + A F   G E   ++A E K PR+ +P+
Sbjct: 263 NYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 322

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDP-LLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
           A K    R+   +L +   +G+  + NDP L              P+V+A+ N  I +LP
Sbjct: 323 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 382

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
            I N  ++   FSA N+  Y +SR+ YG+A+D  APKIF + N+ GVP  S+ + +++ L
Sbjct: 383 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWAL 442

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           ++ + ++S SA V N+ +N+++   L++++ + I Y++F RA   Q      L + +   
Sbjct: 443 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRSWGQ 502

Query: 472 SKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI--RGT-K 528
              A   L  C  + LI+ +TVF    ++ ++F+  Y+ + + I  + GYK+I  RG   
Sbjct: 503 PYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWKRGKDH 562

Query: 529 FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWF 572
           F  P E D    KEL ++E  E           +ESS + F+++
Sbjct: 563 FKNPHEIDFS--KELTEIENHE-----------IESSFEKFQYY 593

>SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]
           {ON} similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160W SSY1 Component of the SPS plasma membrane amino
           acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
           external amino acid concentration and transmits
           intracellular signals that result in regulation of
           expression of amino acid permease genes
          Length = 850

 Score =  232 bits (591), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 163/627 (25%), Positives = 287/627 (45%), Gaps = 72/627 (11%)

Query: 14  KIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXX 73
           K+ S+SN T +    +    Q    +  S L   G +D   ++++L  RH+ M       
Sbjct: 237 KLSSSSNNTGRTTSPIMCEYQKIKKTLASKLPQPGHNDVYHVQRKLHVRHLQMIAIGASL 296

Query: 74  XXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLD-GFTSYASRYCD 132
                           P   L+ +     +V   M    E++T IP+  GF+  ASR+ +
Sbjct: 297 GVGLFLTSGKAFTVAGPFGTLLGFLLCASIVLATMLSFTEISTLIPISSGFSGLASRFVE 356

Query: 133 PALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN-----PGVWITIFLVIIVTI 187
            A GFA+G+SY F ++I  PNQ+ A+  +L Y+   E +N        ++T+FL+  + I
Sbjct: 357 DAFGFALGWSYWFSFVIALPNQIVASTFMLSYY---EHLNVPSGSTAGFVTLFLLFAIFI 413

Query: 188 NXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGP-SHDRLGFRFY---KDP---- 239
           N              + FK+L+ + +++ +  +  G G   H R+GFR++   K P    
Sbjct: 414 NLLDVRILGEILYGSTFFKILITVMMMIAMIALNAGAGAHRHSRVGFRYWDSSKSPEGLT 473

Query: 240 -GAFRPY----------SEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRR 288
            G FRP            + I GSKG+F++ + V + + FA+ G EL  + + E  NPR+
Sbjct: 474 YGLFRPTFDLGDKGSGSLDGIGGSKGRFLAVLVVMLISSFAFSGVELAFVASGEAVNPRK 533

Query: 289 NVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXX------------------- 329
            +P A K T   I++ YL +IFL+G+ +   DP LL+                       
Sbjct: 534 TLPSATKRTFIIIIILYLFSIFLVGLNIYSGDPRLLRYYASPGKDVTIDDYGTKWQIETS 593

Query: 330 -----------XXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLY 378
                             P+V+A+++ G+     + N  ++ F  SA  S LY +SR+LY
Sbjct: 594 CNKNLVVNLDGAINGSQSPWVLALQSFGLCTFSSVLNGILIFFGPSAGCSSLYASSRTLY 653

Query: 379 GLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLM 438
            ++I  KAP++F + +K G+PY S++ C  F + +Y++VS  S + F    N+ S    +
Sbjct: 654 SMSIQGKAPELFRRCSKKGIPYVSVLFCGAFGVTSYLSVSKESVENFQALANISSASICI 713

Query: 439 SWIAILITYIYFDRALRAQ----GVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVF 494
            W+ + I+++ F  AL+ +      D  +  Y +P     A++ L    ++ L   FT F
Sbjct: 714 IWMGLNISFLRFYYALKKRPDIISRDDPSFPYRSPFQPYLAFYGLLGSTILVLFMGFTTF 773

Query: 495 LGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEEGKLW 554
           L   ++ K F + Y G+  F +C+ GYK    +K  + ++ D+ + +  ID       +W
Sbjct: 774 LPGLWNTKVFFSAYGGLMFFTVCYLGYKTFGTSKIQRLDQLDMDSGRREIDR-----MIW 828

Query: 555 DAAQKEKMESSPKNFKWFYEKFLGWIF 581
           D   +       +  +W     + W+F
Sbjct: 829 DEHHEYSDTFKERAIRW-----ITWLF 850

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  226 bits (575), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 159/557 (28%), Positives = 265/557 (47%), Gaps = 30/557 (5%)

Query: 17  SNSNTTSKDVENLD--LSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXX 74
           +NS    +D++ L+  ++  +    +   LN    H G+  K+ L+ RH+S+        
Sbjct: 4   TNSIQQREDLDKLEPKIAEVELQRLETDSLNEFDPHSGV--KRALKNRHISLLALGGIIG 61

Query: 75  XXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDP 133
                          P+++L+ +  +G + + +M  +GE+ T  P  G F + A R+   
Sbjct: 62  PGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSE 121

Query: 134 ALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXX 193
            L    GY+Y+  +  +  N+    + +LQ+W  +  +    +  IF    +        
Sbjct: 122 GLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYG--YTLIFWFFFLVFQLIGVG 179

Query: 194 XXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSK 253
                  WL+ FK+L ++   +   V M GG P    +GF+++K+PGA          S 
Sbjct: 180 AFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGAL---------SH 230

Query: 254 GKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLG 313
           G F     VFV+    Y GTE   + A E +NPR+ VP A++ T +RI++ YL   F  G
Sbjct: 231 G-FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYG 289

Query: 314 MTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVA 373
           +TV YNDP L             P  +A+  AG     H+ NA +LM   SA NS LY+ 
Sbjct: 290 VTVPYNDPTL----GAQTKSLKSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIG 345

Query: 374 SRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVS 433
           SR+L  LA +  AP+I A T+K GVP  +LI+     L++ MNVS G++  +NY VN+  
Sbjct: 346 SRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSG 405

Query: 434 IFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTV 493
           +   + W AI IT++ F +A  AQG   S L Y A        F+L     +ALI+ +T 
Sbjct: 406 VGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTS 465

Query: 494 FLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEEGKL 553
            +   F  K+F+  YI +P   + + G  + +   F   +  +++     I+LEE + + 
Sbjct: 466 LV--PFVAKDFVDAYILLPAAGLLYVGINFWKNRNF---KTVNIHG----INLEEGQRRD 516

Query: 554 WDAAQKEKMESSPKNFK 570
            D    ++  ++PK+ +
Sbjct: 517 LDEDSDDETGTAPKSTR 533

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 139/502 (27%), Positives = 248/502 (49%), Gaps = 11/502 (2%)

Query: 56  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA 115
           +++LE RHV +                       P S+L+A++     +  +     EM 
Sbjct: 86  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 145

Query: 116 TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174
            + P+   F   A++  D +L     +++ F   +  P ++ +   ++ YW  R+  + G
Sbjct: 146 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 203

Query: 175 VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFR 234
           + + + +V+ + I+            WL+SFK+++ L L +  F+ MLGG P HDR GFR
Sbjct: 204 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPRHDRYGFR 263

Query: 235 FYKDP--GAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
            Y +     + P    +  S G F  F+A  + A F   G E   ++A E K PR+ +P+
Sbjct: 264 NYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 323

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDP-LLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
           A K    R+   +L +   +G+  + NDP L              P+V+A+ N  I +LP
Sbjct: 324 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 383

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
            I N  ++   FSA N+  Y +SR+ YG+A+D  APK+F + N+ GVP  S+ + +++ L
Sbjct: 384 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVGISLIWAL 443

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           ++ + ++S SA V N+ +N+++   L++++ + I Y++F RA R Q      L + +   
Sbjct: 444 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRAYRVQQDSLPRLPFRSWGQ 503

Query: 472 SKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI--RGTKF 529
              A   L  C  + LI+ +TVF    +  ++F+  Y+ + + I  + GYK+I  RG   
Sbjct: 504 PYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDS 563

Query: 530 VK-PEEADLYTFKELIDLEEEE 550
           +K P + D    KEL ++E  E
Sbjct: 564 LKNPHDIDFS--KELTEIENHE 583

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  226 bits (575), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 157/571 (27%), Positives = 276/571 (48%), Gaps = 30/571 (5%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDG--IRLKKELEAR 62
           + S R D+  + S +     D +  D ++ ++  + E+  +  G  D    R  K+L  R
Sbjct: 22  KQSSRNDMSPLTSEA----PDFKKADAASGNESWALENVESTSGTSDAEDSRYNKDLSVR 77

Query: 63  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-D 121
           H+                         P S++I +  +   ++ ++  LGE+++  P+  
Sbjct: 78  HLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVG 137

Query: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181
           GF  Y SR+ +P+ GFAV  +YL ++ ++ P +L AA+L ++YW S   +N   W+ IF 
Sbjct: 138 GFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNS--TINSDAWVAIFY 195

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
            II   N             LS  K+L ++   +L  V+  GGGP    +G +++ +PGA
Sbjct: 196 TIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGA 255

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
           F   +     S  +F    +VFV A F+Y GTEL  + AAE  NPR  +P+A K T + I
Sbjct: 256 FVGNT-----SSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLI 310

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
            V Y+V + L+G  V  +DP LL            P V+AI+N GI  LP + NA +L+ 
Sbjct: 311 TVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAAS-PLVIAIENGGIKGLPSLMNAIILIA 369

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421
           V S  NS +Y  SR +  +A     PK F+  ++ G P  +++  ++F LL+++  S+  
Sbjct: 370 VLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQ 429

Query: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481
             VF +   +  +  L  W AI +++I F   ++ +G     L + +     G+Y+    
Sbjct: 430 ETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWGSYYG--- 486

Query: 482 CCLIALIKNFTVFLGHKF-------DYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP- 532
            C+I  +     F    F         ++F   Y+  P+ ++C+ G+K Y +  + + P 
Sbjct: 487 -CVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPT 545

Query: 533 EEADLYTFKELIDLE--EEEGKLWDAAQKEK 561
            E D+ + +  +D+E  ++E ++ + A +EK
Sbjct: 546 TEIDIDSGRRAVDIEVLKDEKRMEEQAMREK 576

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  226 bits (577), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 160/542 (29%), Positives = 264/542 (48%), Gaps = 26/542 (4%)

Query: 35  DDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSIL 94
           +++++ E    +    D   LK+ ++ RHV M                       P  ++
Sbjct: 92  NEMTTAEPEAEMASVED--NLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLV 149

Query: 95  IAYSFVGFLVYIVMTCLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITP 152
             Y+ +G  VY ++   GEMA  Y  L+G F +Y +   +P          LF  +    
Sbjct: 150 TGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLS 209

Query: 153 NQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLC 212
             +       +YW +R  V+P V++ IF V+I+ IN            + +  KVL+M  
Sbjct: 210 FGIGYCFDDYKYWTTR--VDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAG 267

Query: 213 LIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKG--KFVSFVAVFVYALFAY 270
             +L  +I +GG  +   LG  ++++PGAFR       G KG   F   VA  V A FA+
Sbjct: 268 FFILGIIINVGGAGNDGYLGNIYWRNPGAFR-------GDKGIDHFKGVVATLVTAAFAF 320

Query: 271 LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXX 330
            GTE   + AAE  NPR+ +P A K  LYRIV+ YL +I L+G  V +  P LL      
Sbjct: 321 GGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAA 380

Query: 331 XXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIF 390
                 P+V+A+ + G+ V+PH  NA +L+ V S  NS  Y +SR L  L+    APK F
Sbjct: 381 TAAS--PYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWF 438

Query: 391 AKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYF 450
              ++ G P  ++I+  LF ++A+   S    +VF + + +  +  + +WI+I +++I F
Sbjct: 439 DYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRF 498

Query: 451 DRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG----HKFDYKNFIT 506
             A++AQG     + + A     G+Y+++F   ++ LI  F V +      +   +NF  
Sbjct: 499 RAAMKAQGRSMGEVGFKAQTGIWGSYYSIFL-MILTLIGQFWVAIAPIGTAELSARNFFE 557

Query: 507 GYIGIPVFIICFFGYKYIRG--TKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMES 564
            Y+ +P+ I  +FGYK  +   T ++K E+ DL + +++ D  EE  K  D   KEK+++
Sbjct: 558 NYLAMPILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFD--EELLKQEDYELKEKLKN 615

Query: 565 SP 566
            P
Sbjct: 616 GP 617

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  225 bits (573), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 157/565 (27%), Positives = 260/565 (46%), Gaps = 25/565 (4%)

Query: 14  KIVSNSNTTS--KDVENLDLSNQDDISSQESHLNIDGKHD-GIRLKKELEARHVSMXXXX 70
           ++VSN        +V  +++  +++  ++E  LN +   D    +K++L+ RH+S+    
Sbjct: 12  EVVSNRGLKDAYNEVTEMEVDPKNNEYAEEQSLNREDTFDPDSGVKRQLKDRHISLLALG 71

Query: 71  XXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASR 129
                              P+++L+ +  +G L +I+M  +GEM T  P  G FT+   R
Sbjct: 72  GIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRR 131

Query: 130 YCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINX 189
           +   AL    GY+Y   +  +  N+    + ++Q+W  +  +    +I IF         
Sbjct: 132 FHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVPLYG--YILIFWAAFQVFQL 189

Query: 190 XXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAI 249
                      WL+ FK+L +L   +   V + GG  +    GF+++ DPGA        
Sbjct: 190 LGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGALS------ 243

Query: 250 SGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTI 309
           +G KG       VFV+    Y GTE   + A E KNPRR VP AI+ T +RI++ YL   
Sbjct: 244 NGFKG----IANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGIS 299

Query: 310 FLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSD 369
              G+TV YND    +           P  +AI  AG P   H+ NA +L+   SA N  
Sbjct: 300 IFYGVTVPYND----ENLNFATKVLKSPIAIAISRAGWPAGVHLVNAFILITCISAINGS 355

Query: 370 LYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFV 429
           LY+ SR+L  LA +  APK+ A T++ GVP  ++ +     L++ MNVS  +   +NY V
Sbjct: 356 LYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIV 415

Query: 430 NVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIK 489
           N+  +   + W  I +T++ F +A + QG  +  L Y A L       ++     + L++
Sbjct: 416 NLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQ 475

Query: 490 NFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKF---VKPEEADLYTFKELIDL 546
            ++ F    FD KNF+  YI IP  II + G  Y +   F   V   E +L   + L  +
Sbjct: 476 GWSYF--KPFDAKNFVDAYILIPAGIILYLGVSYWKTKGFLTAVDLSEVNLLFGQRLPTI 533

Query: 547 EEEEGKLWDAAQKEKMESSPKNFKW 571
            ++     D+     +  +P+   W
Sbjct: 534 SQDMPSSTDSTTSVVITKTPRKINW 558

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  226 bits (575), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 155/521 (29%), Positives = 248/521 (47%), Gaps = 24/521 (4%)

Query: 56  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA 115
           KK +++RHV M                       P S++IAY  V F+ Y ++   GEMA
Sbjct: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153

Query: 116 -TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
            TY  L G F +Y S +     GFA  + +  ++L + P +L  AA+ ++YW     ++P
Sbjct: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDP 211

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
            V++ IF V ++ I+              ++ K+L++   I+   V+  GG      +G 
Sbjct: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGG 271

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPGAF     A S    +F       V A F+Y G EL  +   + KNPR++ P A
Sbjct: 272 KYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K  +YRIVV YL+T+ L+G  V +N   LL            P+V+A    GI V+PHI
Sbjct: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHAS-PYVLAASIHGIKVVPHI 385

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            NA +L+ + S  NS LY   R L  LA    AP+  +  ++ G P  +L+L  L  ++ 
Sbjct: 386 INAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIG 445

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           +   S    +VF +   +  +  L +W +I+ ++I F RA++ Q     TL Y A     
Sbjct: 446 FAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLW 505

Query: 474 GAYFALFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFGYK--YIRG 526
           G+YF + F  L+     F V L     G K D  +F   Y+ +P++++ +FGY   Y   
Sbjct: 506 GSYFGVGFNILV-FAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDF 564

Query: 527 TKFVKPEEADLYTFKELIDLE--EEEGKLWDAAQKEKMESS 565
           T      + DL   +++ D E   +E    D   KE++ +S
Sbjct: 565 TVLTDLNQVDLDNHRKVYDPEFLRQE----DLENKERLRNS 601

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  225 bits (573), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 160/520 (30%), Positives = 258/520 (49%), Gaps = 20/520 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK+ +  RHV M                       P S++I Y+ V  ++Y V+    E+
Sbjct: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140

Query: 115 AT-YIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172
           A  Y  L  GF +Y S   D A GF+V + Y  ++L + P +L  A++ ++YW   + +N
Sbjct: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW--NQTIN 198

Query: 173 PGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232
           P  ++TIF V++V IN            + +  KVL+++   +L  +I  GG  +   LG
Sbjct: 199 PDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGYLG 258

Query: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
            R++ DPGAFR      S S  +F   VAV V A FAY G E   + AAE +NP++++  
Sbjct: 259 ARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 313

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K  +YRI+  Y++T  LLG  V +N   LL            PFV+A+ + G+ V+PH
Sbjct: 314 ASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHAS--PFVIAVASHGVRVVPH 371

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
             NA +L+ V S  NS LY +SR L  L+    AP+     ++ G P   L++  +F LL
Sbjct: 372 FINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           +++  S     VF + + +  +  L +W +I ++++   RA+  QG     L Y A    
Sbjct: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491

Query: 473 KGAYFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGT 527
            GAY+A+     I L+  F V +     +K D  NF   Y+ +P+ I  + GYK + R  
Sbjct: 492 WGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550

Query: 528 KFVKP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
           + + P  E DL   +++ D E    +  +  +KE++  +P
Sbjct: 551 RLLIPSSEVDLVAHRKIFDAEVLRHEQLE--EKEQLRHAP 588

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  225 bits (573), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 155/543 (28%), Positives = 263/543 (48%), Gaps = 29/543 (5%)

Query: 24  KDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXX 83
           K  E+  L + +D+      +  +      RLKK +++RHV M                 
Sbjct: 60  KRAESQHLEDDNDLEDGTRSMKSNN-----RLKKSMKSRHVVMMSLGTGIGTGLLVANAK 114

Query: 84  XXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGY 141
                 P S++I Y  V F+ Y ++   GEM  TY  L G F +Y S +   + GFA  +
Sbjct: 115 GLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTW 174

Query: 142 SYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXW 201
            +  ++L + P +L  +++ ++YW   +K+N  V+I IF V ++ I+             
Sbjct: 175 IFCIQWLTVLPLELITSSMTIKYW--NDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFI 232

Query: 202 LSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVA 261
            SS K+L++   I+L  VI  GG      +G ++++DPG+F   +E    ++ K + F+ 
Sbjct: 233 FSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSF---AEGNGATRFKGICFIL 289

Query: 262 VFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDP 321
           V  Y  F++ G EL  +   E  NPR++ P A K ++YRI++ YL+T+ L+G  V +N+ 
Sbjct: 290 VTAY--FSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNND 347

Query: 322 LLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLA 381
            L+            P+V+A     + V+PHI NA +L+ V S  NS LY A R +  LA
Sbjct: 348 QLMGSGSAATHAS--PYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLA 405

Query: 382 IDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWI 441
               APK     ++ G P  +L +C L  ++ ++  S    Q F +   +  +  L +W 
Sbjct: 406 QQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWS 465

Query: 442 AILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL-----G 496
            I++++I F +A++ QG     + Y A     G+Y+ +FF  L+  +  F V L     G
Sbjct: 466 GIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILV-FMAQFWVALSPIGNG 524

Query: 497 HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFK-----ELIDLEEE 549
            K + + F   Y+  P+++  + GY  Y R   F+ P ++ DL   +     E+I  E E
Sbjct: 525 GKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENE 584

Query: 550 EGK 552
           E K
Sbjct: 585 ENK 587

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  224 bits (570), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 153/542 (28%), Positives = 267/542 (49%), Gaps = 35/542 (6%)

Query: 46  IDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVY 105
           +DG  D   LK+ L+ARH+ M                       P++++I ++  G  + 
Sbjct: 76  LDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQII 135

Query: 106 IVMTCLGEMATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQY 164
             +  LGE+    P+ G F +Y++R+ DP+L F +   Y+ ++  + P ++ ++A+ +QY
Sbjct: 136 GTIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQY 195

Query: 165 WVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGG 224
           W   + ++P VW+ IF   IV+IN              SS KVL +   I+L  V++ GG
Sbjct: 196 W--NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGG 253

Query: 225 GPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECK 284
           GP HD +G +++ DPG               F   ++V V A ++  GTE+  + + E  
Sbjct: 254 GPDHDFVGAKYWHDPGCL----------AHGFPGVLSVLVVASYSLGGTEMVCLASGE-T 302

Query: 285 NPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKN 344
           +P+  +P AIK T +RI+ F+LV++ L+G  V Y +  LL            PFV+AIK 
Sbjct: 303 DPKE-LPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNS----PFVIAIKL 357

Query: 345 AGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLI 404
             I VLP I NA +L+ + S  NS ++ +SR+L  +A     P+ F   ++ G P   +I
Sbjct: 358 HQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGII 417

Query: 405 LCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTL 464
              LF LLA++  SS  ++VF++ + +  +   + W++I I++I F  A++AQG     L
Sbjct: 418 TNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDEL 477

Query: 465 AYAAPLASKGAYFALFFCCLIALIKNFTVFL-------GHKFDYKNFITGYIGIPVFIIC 517
            + + +   G+ ++     LI L+  F   L             K F   Y+   + I+ 
Sbjct: 478 EFVSAVGIWGSAYSAVINSLI-LVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVL 536

Query: 518 FFG----YKYIRGT--KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKW 571
           F G    Y+Y  G     +   + DL T ++ ID+E  + ++  A +   + +SP   +W
Sbjct: 537 FVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEI--AERNRHLRASPWYVRW 594

Query: 572 FY 573
           ++
Sbjct: 595 YH 596

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  223 bits (569), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 150/571 (26%), Positives = 273/571 (47%), Gaps = 52/571 (9%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVS 65
           +S+R+  E         S+DV+ L   N++  ++              ++KK +++RH+ 
Sbjct: 43  NSFRRKGE---------SEDVKELKGENEECGAAT-------------KMKKSIKSRHLL 80

Query: 66  MXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPLDG-F 123
           M                       P  ++I Y+    ++Y ++   GE+   Y  + G +
Sbjct: 81  MISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNY 140

Query: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183
           T+Y+S   DPALGF+V + Y  +++ + P QL  AA+ ++YW +    NP +++ +F V+
Sbjct: 141 TAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTN---ANPDIFVAVFFVV 197

Query: 184 IVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243
           I+ IN              +  KVL++   ++L   I  GG  +   +G +++  PG+F 
Sbjct: 198 IMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIGAKYWHSPGSFA 257

Query: 244 PYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVV 303
                 +G KG       VF YA F+Y G E+  + A+E +NPR+++P A K  +YRI++
Sbjct: 258 ------AGFKG----VCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPNACKKVIYRILM 307

Query: 304 FYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVF 363
            Y++T  ++   V YN   L+            P V+A+ + G+ ++PHI NA +L+ V 
Sbjct: 308 IYMLTTIIVCFLVPYNSSELMGSSGESASHAS-PLVIAVASHGVKIVPHIINAVILISVI 366

Query: 364 SACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQ 423
           S  NS +Y A R L  L+    APK     ++ G P     + +L  L+A++  S     
Sbjct: 367 SVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIAFVAASDAEED 426

Query: 424 VFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCC 483
           +F + + +  +  +  W +I ++++ F  A+ AQG+    + Y +     G++FA+    
Sbjct: 427 IFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYWGSWFAIVISV 486

Query: 484 LIALIKNFTVFLG-----HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEAD 536
           L+ LI  F V +       + + + F   Y+  P+ +  +FGYK Y +  +   P  E D
Sbjct: 487 LV-LIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKDWRLCIPASEVD 545

Query: 537 LYTFKELIDLE--EEEGKLWDAAQKEKMESS 565
           L + + + D E   +E   W+    EKM +S
Sbjct: 546 LSSHRNISDEEILRQEDYEWN----EKMSNS 572

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  223 bits (569), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 161/570 (28%), Positives = 261/570 (45%), Gaps = 35/570 (6%)

Query: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQD-------DISSQESHL---NIDGKHDGIR 54
            DS +  L  + S S +  ++    D  N++            E H    N D +H    
Sbjct: 16  DDSAQPVLSSVKSESGSIGQEWNAWDNENRNAWGRFVNSFKRAEKHSTPSNGDLEHATTH 75

Query: 55  -------LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIV 107
                  LK+ ++ RHV+M                       P  ++I Y+ V  + YI+
Sbjct: 76  SVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIM 135

Query: 108 MTCLGEMATYIP-LDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYW 165
           M   GEMA   P L G F +Y+S+      GFA  + Y  ++L + P +L  A+L ++YW
Sbjct: 136 MQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYW 195

Query: 166 VSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGG 225
              + +N  V+I IF V I+ I+                 KVL+++  ++L  VI  GG 
Sbjct: 196 --NDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGA 253

Query: 226 PSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKN 285
                +G +++ DPGAF     A+     KF     V V   F+Y GTEL  +   E  N
Sbjct: 254 GDRKYIGAKYWYDPGAF-----AVGSGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSN 308

Query: 286 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNA 345
           PRR +    K  +YRI++ Y++T+ L+G  V +    L+            P+V+A+   
Sbjct: 309 PRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHAS-PYVLAVSLH 367

Query: 346 GIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLIL 405
           G+ ++PHI NA +L+ V S  NS +Y   R L  LA    AP+  A  ++ G P  +LI 
Sbjct: 368 GVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIA 427

Query: 406 CILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLA 465
           C +F LLA++  S     VF +   +  +  L +W AI+++++ F +A+R      S L 
Sbjct: 428 CSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELG 487

Query: 466 YAAPLASKGAYFALFFCCLIALIKNFTVFLG-----HKFDYKNFITGYIGIPVFIICFFG 520
           Y A     G+   L F  L+  I  F V +       K D  +F   Y+  P++++ FFG
Sbjct: 488 YKANTGVLGSVLGLSFNILV-FIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFG 546

Query: 521 YKYI-RGTKFVKP-EEADLYTFKELIDLEE 548
           Y  + R  + +KP ++ DL  ++ + D + 
Sbjct: 547 YMIVFRNWEIIKPLKDIDLDHYRSIYDQDR 576

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  222 bits (566), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 162/549 (29%), Positives = 265/549 (48%), Gaps = 33/549 (6%)

Query: 30  DLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXX 89
           D S   D+   E +       D  +L++ +  RHV M                       
Sbjct: 43  DTSRSGDLEDGEIN-----STDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGG 97

Query: 90  PVSILIAYSFVGFLVYIVMTCLGEMATYIP-LDG-FTSYASRYCDPALGFAVGYSYLFKY 147
           P  +LI Y  V  + YI+M   GEMA   P L G F +Y+S +     GFA  + +  ++
Sbjct: 98  PAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQW 157

Query: 148 LIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKV 207
           L + P +L  A +V++YW  +  VN  V++ IF + I+ I+              +  KV
Sbjct: 158 LTVFPLELITATIVIKYW--KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKV 215

Query: 208 LVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSK-GKFVSFVAVFVYA 266
           L+++  +++  +I +G       +G R++++PG+F      +SG+   K      V V A
Sbjct: 216 LMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSF------VSGTPLDKLKGTAYVLVTA 269

Query: 267 LFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQX 326
            F++ G EL  +   E  NP+  +P A K  +YRI++ YL+T+ ++G  V ++   L+  
Sbjct: 270 YFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329

Query: 327 XXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKA 386
                     P+V+AI+  G+ VLPHI NA +L+ V S  NS +Y A R L  LA    A
Sbjct: 330 GSNDVHPS--PYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYA 387

Query: 387 PKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILIT 446
           PK     ++ G P  SLILC +F L+A+   S    ++F +   +  +  L +W +I ++
Sbjct: 388 PKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447

Query: 447 YIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFDYK 502
           +  F +A++ QG    TL Y A     G+ +A+FF  L+  I  F V L      K D  
Sbjct: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLV-FIAQFWVALVPIAKKKVDVL 506

Query: 503 NFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLE---EEEGKLWDAA 557
           +F   Y+  P+++I F GY  Y R    + P ++ DL T + + D+E   +EE +     
Sbjct: 507 SFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEF---- 562

Query: 558 QKEKMESSP 566
            KE+M +SP
Sbjct: 563 -KERMRNSP 570

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  223 bits (567), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 164/566 (28%), Positives = 285/566 (50%), Gaps = 33/566 (5%)

Query: 18  NSNTTSK--DVENLDLSNQDDISSQESHLNIDGKHDGI-----RLKKELEARHVSMXXXX 70
              TT++  D+EN DL+    +S Q S+ +     D +      LK+++  RH+      
Sbjct: 76  RGETTARIADLEN-DLTTA--VSPQLSNYHGSIPSDEVVIKKEELKRDINQRHMVFMAIG 132

Query: 71  XXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPL-DGFTSYAS 128
                              P  +LI Y+ +G  VY V+   GE+  TY  L  GF +Y +
Sbjct: 133 SGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYANLIGGFNAYPA 192

Query: 129 RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTIN 188
               P+  F+VG+ Y  ++L +TP +L  A+L ++YW +  KV+P V++ IF ++I+ IN
Sbjct: 193 ILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTT--KVDPDVFVVIFYLLILLIN 250

Query: 189 XXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDR-LGFRFYKDPGAFRPYSE 247
                       + +  K L M+    +L +++  GG  HD  LG +++ +PGAFR   +
Sbjct: 251 FFGSKGYAEADFFFNCMK-LAMISGFFILGIVVACGGAGHDGYLGGKYWHNPGAFRG-EK 308

Query: 248 AISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLV 307
           AI   KG      +VFV + FA+ G+E   + A+E  NPR+++P A KL LYRI+  YL 
Sbjct: 309 AIDHFKG----VSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRIIWVYLT 364

Query: 308 TIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACN 367
           +I +LG  V ++ P   Q           P+VVAI   G+ V+PH+ NA +LM V S  N
Sbjct: 365 SITILGFLVPWDSP---QLQPSSDGKKTSPYVVAIAMHGVKVVPHLINAVILMAVLSVSN 421

Query: 368 SDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNY 427
           S  + +SR L  L+    APK F   ++ G P  ++++  LF ++ +   S     VF++
Sbjct: 422 SAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETDVFSW 481

Query: 428 FVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIAL 487
            + +  +  + ++ +I +++I    A++ QG     L + + + + G+++A     L +L
Sbjct: 482 LLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVL-SL 540

Query: 488 IKNFTVFLG----HKFDYKNFITGYIGIPVFIICFFGYKYIRGT--KFVKPEEADLYTFK 541
           +  F V L      K D ++F   Y+  P+ I+ +FGY   +     F++ ++ DL   +
Sbjct: 541 MAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFKR 600

Query: 542 ELIDLEEEEGKLWDAAQKEKMESSPK 567
           ++ D  E+  K  D    E+M ++P+
Sbjct: 601 QVFD--EDLIKQEDEEYAEQMRNAPR 624

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  222 bits (565), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 165/576 (28%), Positives = 262/576 (45%), Gaps = 43/576 (7%)

Query: 8   YRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMX 67
           +R   ++    S     D+E   +  Q D++            DG RL++ +  RHV+M 
Sbjct: 47  FRDSFKRAQKRSVPQGGDLETASV--QTDLT------------DG-RLRRSIRPRHVAMM 91

Query: 68  XXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTS 125
                                 P  ++I Y+ V  + YI+M   GEMA   P     F +
Sbjct: 92  SVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNA 151

Query: 126 YASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIV 185
           Y+S +     GFA  + Y  ++L + P +L  A+L ++YW   + VN  V+I IF V I+
Sbjct: 152 YSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWT--DSVNADVFIAIFYVFIL 209

Query: 186 TINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPY 245
            I+                 KVL++   ++L  VI  GG  +   +G R++ DPGAF   
Sbjct: 210 FIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYIGARYWHDPGAF--- 266

Query: 246 SEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFY 305
             A+     KF  F  V V   F+Y GTEL  +   E  +PRR +  A K  +YRI+V Y
Sbjct: 267 --AVGDPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRAIHSATKQCIYRILVIY 324

Query: 306 LVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSA 365
           ++T+ L+G  V +    L+            P+V+A+   G+ V+PHI NA +L+ V S 
Sbjct: 325 MLTMVLIGFLVPHTSDELMGSGGKSATHAS-PYVLAVSLHGVKVVPHIVNAVILIAVVSV 383

Query: 366 CNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVF 425
            NS +Y   R L  LA    APK  A  ++ G P  +LI C +  LLA++  S     VF
Sbjct: 384 GNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIGLLAFVAASDHEEDVF 443

Query: 426 NYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLI 485
            +   +  +  L +W AIL+++I F +A++  G   S L Y +     G+ + + F  L+
Sbjct: 444 TWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILV 503

Query: 486 ALIKNFTVFLG-----HKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KP-EEADLY 538
             +  F V L       K D  +F   Y+  P++ + F GY    G   + +P ++ D+ 
Sbjct: 504 -FVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVYSGEWMILRPLKDIDIN 562

Query: 539 TFKELIDLEEEEGKLWDAAQKEKMESSP--KNFKWF 572
            F+ + D E  E        +EK+E     +N  W 
Sbjct: 563 HFRCVYDEERIE--------QEKLEHKTMLQNSNWL 590

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  222 bits (565), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 153/551 (27%), Positives = 263/551 (47%), Gaps = 26/551 (4%)

Query: 24  KDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXX 83
           +  E+  L   +D+      +  +       LKK +++RHV M                 
Sbjct: 60  RRAESQRLEEDNDLEDGTKSMKSNN-----HLKKSMKSRHVVMMSLGTGIGTGLLVANAK 114

Query: 84  XXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGY 141
                 P S++I Y  V F+ Y ++   GEM  TY  L G F +Y S +   + GFA  +
Sbjct: 115 GLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTW 174

Query: 142 SYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXW 201
            +  ++L + P +L  +++ ++YW   + +N  V+I IF V ++ I+             
Sbjct: 175 LFCIQWLTVLPLELITSSMTVKYW--NDTINADVFIVIFYVFLLFIHFFGVKAYGETEFI 232

Query: 202 LSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVA 261
            +S K+L++   I+L  VI  GG      +G ++++DPG+F   S A      +F     
Sbjct: 233 FNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGAT-----RFKGICY 287

Query: 262 VFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDP 321
           + V A F++ G EL  +   E  NPR++ P A K ++YRI++ YL+T+ L+G  V +N+ 
Sbjct: 288 ILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNND 347

Query: 322 LLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLA 381
            L+            P+V+A     + V+PHI NA +L+ V S  NS LY A R +  LA
Sbjct: 348 QLMGSGGSATHAS--PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLA 405

Query: 382 IDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWI 441
               APK     ++ G P  +L++C L  ++ ++  S    Q F +   +  +  L +W 
Sbjct: 406 QQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWS 465

Query: 442 AILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL-----G 496
            I++++I F +A++ QG     + Y A     G+Y+ +FF  L+  +  F V L     G
Sbjct: 466 GIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLV-FMAQFWVALSPIGNG 524

Query: 497 HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLEEEEGKLW 554
            K D + F   Y+  P++I  + GY  Y R   F+ P ++ DL   + + D E    +  
Sbjct: 525 GKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQE-- 582

Query: 555 DAAQKEKMESS 565
           D   KE++++S
Sbjct: 583 DEENKERLKNS 593

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  220 bits (560), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 154/553 (27%), Positives = 265/553 (47%), Gaps = 22/553 (3%)

Query: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVS 65
           DS R     IV +S   +K  + L     D+ SS +   +        +  + L+ RHV 
Sbjct: 23  DSVR---TTIVESSVKPAKKTDWLGCVTDDEDSSSDLLYST-------QTFRRLKNRHVQ 72

Query: 66  MXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FT 124
           +                       P  +LIA++     +  +     EM  ++P+   F 
Sbjct: 73  LIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITVSTAEMVCFLPVSSPFL 132

Query: 125 SYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVII 184
             A+R  D +L     +++ F   +  P ++ +   ++ YW  R+  +  + + + +V+ 
Sbjct: 133 RLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYW--RDDYSAAIPLVVQIVLY 190

Query: 185 VTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDP--GAF 242
             I+            WL+SFK+++ L L +  F+ MLGG P HDR GFR+Y +     +
Sbjct: 191 FLISICAVKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHDRYGFRYYGETPFKKY 250

Query: 243 RPYSEAISG-SKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
            P  +  +G S G F  F+A  + A F   G E   ++A E K PR+ +PRA K   YR+
Sbjct: 251 YPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVLPRAFKQVFYRL 310

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLM 360
              +L +   +G+  + NDP L              P+V+A+ N GI VLP I NA ++ 
Sbjct: 311 TFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNNLGIKVLPDIVNAALIT 370

Query: 361 FVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSG 420
             FSA N+  Y +SR+LYG+A+D  AP+IF + NK GVP  S+++ +L+ L++ + ++  
Sbjct: 371 AAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVLISLLWGLISLLQLNDN 430

Query: 421 SAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALF 480
           SA V N+ +N+++   L+++  + I Y++F RA          L + +      A   L 
Sbjct: 431 SAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDILPKLPFKSWGQPYTAIVGLV 490

Query: 481 FCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI--RG-TKFVKPEEADL 537
               + LI+ +TVF    +  ++F+  Y+ + + I  + GYK+I  RG  KF  P+  D 
Sbjct: 491 SATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGRDKFKDPKTVDF 550

Query: 538 YTFKELIDLEEEE 550
              K+L ++E  E
Sbjct: 551 S--KDLKEIESHE 561

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  219 bits (558), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/504 (28%), Positives = 242/504 (48%), Gaps = 27/504 (5%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           L++ L+ RH++M                       P S+ + Y+ +G +VY+ + CLGEM
Sbjct: 54  LQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEM 113

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           +TY+P+ G F SYA ++   +   A+ ++Y F   +   + +TA  LV+ YW +     P
Sbjct: 114 STYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASGFP 173

Query: 174 GVWIT--IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRL 231
             W    +F  ++V +N            WL+  KV+ ++   +L  V+ +G  P H+ +
Sbjct: 174 -YWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYI 232

Query: 232 GFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVP 291
           GF+ +    A  P+ +   G       F ++FV A FAY GTE   +   E  NP RN P
Sbjct: 233 GFKNWNHGEA--PFVDGFKG-------FASLFVSASFAYGGTESITLTNGEAANPLRNTP 283

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
           + +K   +RI+VFY+ + F + M + Y+ P L             PF +  + AG     
Sbjct: 284 KIVKTVFWRILVFYVGSTFFIAMNIPYDYPGL-----DTKSVVTSPFTLVFQMAGTKAAG 338

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAP-KIFAKTNKWGVPYNSLILCILFC 410
              NA ++  V SACN  L+  SR +Y + ++   P KI ++TN++ VPY S+++     
Sbjct: 339 SFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIG 398

Query: 411 LLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPL 470
           LL +     G+  V+ +  N+V +   ++W+ I IT I F + L  QG     L Y    
Sbjct: 399 LLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQG-KTHELRYKNWT 457

Query: 471 ASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV 530
              G YF + F   I L++ ++ F    +D  NF + Y+ + VF  CF  +   +  +FV
Sbjct: 458 YPYGPYFLVIFVTFIILVQGWSAF--DPWDVTNFFSYYLDLFVFPFCFIIWWLYKRDRFV 515

Query: 531 KPEEADLYT-----FKELIDLEEE 549
           K E+ D  T      KE+I+L E 
Sbjct: 516 KLEDMDFVTDRYIPTKEIIELNEN 539

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  219 bits (558), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 162/605 (26%), Positives = 296/605 (48%), Gaps = 59/605 (9%)

Query: 8   YRKDLEKI---VSNSNTTSKDVENLDLSNQDDISSQESHLN---------------IDGK 49
           ++KD+EK    +SN++   + ++      ++    +ES  N               +DG 
Sbjct: 3   HQKDVEKAASELSNTSAVQRVLKKRSSVLEESRLLEESRTNKRGLVRRCIDSFKPPVDGS 62

Query: 50  HDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMT 109
            D   LK+ L++RH+ M                       P+++LI ++  G  +   + 
Sbjct: 63  FDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIH 122

Query: 110 CLGEMATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSR 168
            LGE+    P+ G F +Y++R+ DP++ F V   Y+ ++  + P ++ A+A+ +++W + 
Sbjct: 123 GLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTT- 181

Query: 169 EKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSH 228
             V+P VW+ +F  +I++IN              S  K++ +   I+L  V++LGGGP+H
Sbjct: 182 -SVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTH 240

Query: 229 DRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRR 288
           + +G R++ DPGA        +G KG      AV V A ++  G+E+  + + E  +P+ 
Sbjct: 241 EFIGARYWHDPGALA------NGFKG----VAAVMVTASYSLGGSEMTCLASGET-DPK- 288

Query: 289 NVPRAIKLTLYRIVVFYLVTIFLLGMTVAY-NDPLLLQXXXXXXXXXXXPFVVAIKNAGI 347
            +P AIK   +RI+ F+LV++ L+G  V Y ND LL             PFV+AIK   I
Sbjct: 289 EIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLL-----GGSNVNNSPFVIAIKMHNI 343

Query: 348 PVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCI 407
            VLPHI N  +L+ + S  NS ++ +SR+L  +A     P+IF   ++ G P   ++   
Sbjct: 344 RVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNS 403

Query: 408 LFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYA 467
           LF LLA++  SS +  VF + + V  +   + W++I +++I F  A++AQG     L + 
Sbjct: 404 LFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFV 463

Query: 468 APLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKN-------FITGYIGIPVFIICFFG 520
           + +   G+ ++     ++ L+  F V L     +K+       F   Y+   + +  F  
Sbjct: 464 SAVGMWGSVYSGVMNVVV-LVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVA 522

Query: 521 YK-YIRGT-----KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYE 574
           +K Y R T     K +   E DL + ++ ID+E  + ++  AA+K+ +       +W+  
Sbjct: 523 HKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEV--AARKKYISEQ----RWYIR 576

Query: 575 KFLGW 579
            +  W
Sbjct: 577 YYHYW 581

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  219 bits (557), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 162/575 (28%), Positives = 284/575 (49%), Gaps = 40/575 (6%)

Query: 11  DLEKIVSNSNTTS-------------KDVENLDLSNQDDISSQESHLNIDGKHDGIRLKK 57
           +L   VS S+T+              ++ E +DL      + + + L  +       LK+
Sbjct: 24  ELNSYVSQSDTSRVGGTRWERFKDSFREAETVDLDPSLTPAEKMAILTANAP-----LKR 78

Query: 58  ELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATY 117
            L++RH+ M                       P  ILI ++  G ++Y ++  +GE+A  
Sbjct: 79  TLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVT 138

Query: 118 IPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVW 176
            P+  G+T+YASR+ D + GFA    Y   +LI  P ++ AA++ + YW +  K     +
Sbjct: 139 FPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDA-F 197

Query: 177 ITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFY 236
           + +F V+IV IN              S  KV+ ++  I+L  +++ GGGP    +G R +
Sbjct: 198 VALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLW 257

Query: 237 KDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKL 296
            +PGAF       +G KG      +VFV A F++ G+EL G+ AAE  NPR+++P A K 
Sbjct: 258 HNPGAFA------NGFKG----VCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQ 307

Query: 297 TLYRIVVFYLVTIFLLGMTVAY-NDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFN 355
             +RI +FY++ + ++G+ V Y +D L+ Q           PFV++I+NAGI  LP + N
Sbjct: 308 VFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS---PFVISIQNAGIKGLPSVIN 364

Query: 356 ACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYM 415
             +L+ V S  N  ++  SRS+  LA     PKIF   ++ G P   +++  +F LL+++
Sbjct: 365 VVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFI 424

Query: 416 NVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGA 475
             S    +VF++ + +  +  L +W  IL+ +I   RAL AQ    + L++ AP    G+
Sbjct: 425 AASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGS 484

Query: 476 YFALFFCCLIALIKNFTVF--LGHKFDYKNFITGYIGIPVFIICFFGYKYIRGT--KFVK 531
            ++L    LI + + +     +G K     F   Y+  P++I+ + G+K  +     F+K
Sbjct: 485 VYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIK 544

Query: 532 PEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
             + D+ + +   D+E  + ++  A +K  + S P
Sbjct: 545 ASDIDIDSGRRETDIEALKQEI--AEEKAFIASKP 577

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  218 bits (556), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 156/523 (29%), Positives = 256/523 (48%), Gaps = 31/523 (5%)

Query: 56  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA 115
           KK L+ RH++M                       P S+LI +  VG  +  V+ C  E++
Sbjct: 70  KKVLDQRHLTMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELS 128

Query: 116 TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174
              P+ G +  +ASR+ DP++GF++G +YL  +LI  P++L   +L + YW     VNP 
Sbjct: 129 CQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWA--PSVNPA 186

Query: 175 VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGP-SHDRLGF 233
            W+ I  V+ + +N            ++S FK++ +   I++  V++ GGGP S   +G 
Sbjct: 187 AWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGT 246

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPG+F         +   F +    FV A +++ GTE+  + + E ++   +V RA
Sbjct: 247 KYWHDPGSF---------AVPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARSVS-SVSRA 296

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGI--PVLP 351
            K T +RI++FY+VT+ ++G  V YNDP L+            PFV+A+ N G     + 
Sbjct: 297 AKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITAS-PFVIALSNTGAMGTRVS 355

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
           H  NA +L+ VFS CNS +Y +SR + GLA   + PKI A  ++ G P   + +C  F L
Sbjct: 356 HFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGL 415

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           L ++ VS     VF +   + SI    +W  I    + F  A++AQG  K  + Y + L 
Sbjct: 416 LGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTL- 474

Query: 472 SKGAYFALFFCCLIALIKNFTVF-----LGHKFDYKNFITGYIGIPVFIICFFGYK-YIR 525
             G Y  +F C L  L+    ++     +G      NF    + IP+ I  + G++ Y R
Sbjct: 475 --GIYGGIFGCILNVLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHRIYRR 532

Query: 526 GTK--FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
             +  ++K  + DL +   L D E    KL     K+ + S P
Sbjct: 533 DWRHWYIKRMDIDLDSGHSLEDFEAT--KLERDEDKKYVSSKP 573

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  216 bits (551), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 148/494 (29%), Positives = 243/494 (49%), Gaps = 40/494 (8%)

Query: 90  PVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYL 148
           P ++LI Y  VG  ++ V+    E+A   P+ G + S+ SR+ D +LGF V  +Y   +L
Sbjct: 104 PAALLIGYLLVGTSMFCVIQSAAELACQFPVSGSYASHVSRFVDESLGFTVATNYTLAWL 163

Query: 149 IITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVL 208
           ++ P++L   +L + YW S   +NP VW++IFLV ++ IN             LS  KVL
Sbjct: 164 VLFPSELIGCSLTISYWNS--SINPAVWVSIFLVFVLWINLFGVRIFAETEFILSIIKVL 221

Query: 209 VMLCLIVLLFVIMLGGGPSHDR-LGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYAL 267
            ++  I++  V++ GGGP     +G +++ DPG F         +K  F +    FV A 
Sbjct: 222 AIIIFIIIGIVLIAGGGPDPGGYIGTKYWHDPGPF---------AKPVFKNLCQTFVAAA 272

Query: 268 FAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXX 327
           F++ GTE+  +   E KN   ++ RA K T YRI +FY+ T+ ++G  V YNDP LL   
Sbjct: 273 FSFGGTEMVLLTGTESKNVS-SIARAAKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSAS 331

Query: 328 XXXXXXXXXPFVVAIKNAGI--PVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNK 385
                    PFV+A+ N G     + H  NA +L+ V S CNS +Y +SR +  L    +
Sbjct: 332 SSEDISAS-PFVIALSNTGSMGAKVSHFMNAVILVAVVSVCNSTVYASSRLIQALGTAGQ 390

Query: 386 APKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILI 445
            PKIF   ++ G P   + +   F LL ++  +   ++VF +   + S+   ++W +I +
Sbjct: 391 LPKIFGYMDRKGRPLVGIAVSATFGLLGFLVATKKQSEVFTWLFALCSVAAFVTWFSICL 450

Query: 446 TYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGH-------- 497
             + +  A+RA+     ++AY + L   G         ++  I NF +  G         
Sbjct: 451 AQVRYRMAMRARKRSLDSIAYKSILGIWGG--------VVGCIVNFLLVAGEVYVSAFPA 502

Query: 498 --KFDYKNFITGYIGIPVFIICFFGYKYIR---GTKFVKPEEADLYTFKELIDLEEEEGK 552
             K   + F    + IP+ I+ F G+K  R   G  +VK ++ DL T   + D E  + +
Sbjct: 503 NAKSSAEGFFKYTLSIPIMIVVFLGHKIHRNDWGNWYVKRKDMDLDTGCSIEDFELFQAQ 562

Query: 553 LWDAAQKEKMESSP 566
               A+K  + S P
Sbjct: 563 --KEAEKRALASRP 574

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  217 bits (552), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 149/489 (30%), Positives = 242/489 (49%), Gaps = 30/489 (6%)

Query: 90  PVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYL 148
           P S+LI +  VG +++ V+    E+A   P+ G +  + SR+ +P++GF V  +Y   +L
Sbjct: 119 PGSLLIGFLIVGLMMFCVVQSAAELACQYPVSGSYAVHVSRFMEPSIGFTVATNYALAWL 178

Query: 149 IITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVL 208
           I  P++L   A+ LQYW   + VNP VW+ IF V I+++N            W+S FKV+
Sbjct: 179 ISFPSELIGCAMTLQYW--NKSVNPAVWVAIFYVFIMSLNMFGVRSYGEAEFWMSLFKVV 236

Query: 209 VMLCLIVLLFVIMLGGGP-SHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYAL 267
            ++  I++  V++ GGGP S   +G +++ DPG+F         +K  F      FV A 
Sbjct: 237 AIVIFIIIGIVLICGGGPNSTGYIGTKYWHDPGSF---------AKPVFKGLCNTFVSAA 287

Query: 268 FAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXX 327
           F++ G EL  + A+E +    +V RA K T +RI +FY+ T+ ++G  V Y +  LL   
Sbjct: 288 FSFGGAELVVLTASESRKVE-SVSRAAKGTFWRIAIFYITTVIVIGCLVPYTNEQLL-GG 345

Query: 328 XXXXXXXXXPFVVAIKNAGI--PVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNK 385
                    PFV+A+   G       H  N  +L+ V S CNS +Y +SR +  L +  +
Sbjct: 346 DNDEDITASPFVIALSGQGSMGTKASHFMNTVILIAVLSVCNSAVYASSRIIQALGVCGQ 405

Query: 386 APKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILI 445
            PKI    ++ G P   + +C +F LL ++  S     VF +   + SI    +W  I  
Sbjct: 406 LPKICGYVDQKGRPLVGIAICGVFGLLGFLVASDNEGDVFTWLFALCSISSFFTWFCICA 465

Query: 446 TYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVF-----LGHKFD 500
           + + F  ALRAQG     +A+ + L   G Y     C L AL+    ++     LG    
Sbjct: 466 SQVRFRFALRAQGRSSDEIAHKSML---GIYGGFLGCLLNALLIAGEIYVSIFPLGGDPS 522

Query: 501 YKNFITGYIGIPVFIICFFGYKYIRGTK---FVKPEEADLYTFKELIDLEEEEGKLWDAA 557
            K F    + IP+ I  + G+K          +  +E DL T +++ DLE+ + ++ +  
Sbjct: 523 AKQFFQYCLSIPIMIAVYIGHKLFANKSKRVLIPAQEIDLETGRKIKDLEQFKHEVLE-- 580

Query: 558 QKEKMESSP 566
            KEK+ S P
Sbjct: 581 DKEKLASKP 589

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  216 bits (550), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 146/490 (29%), Positives = 233/490 (47%), Gaps = 21/490 (4%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           LK++L  RH++M                       P S+ + YS  G +VY+ M CLGEM
Sbjct: 68  LKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGEM 127

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           +TY+P+ G F SYA ++   +   A+ ++Y F   +   + LTA  LVL YW +++   P
Sbjct: 128 STYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWKTKDHHFP 187

Query: 174 GVWIT--IFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRL 231
             W    +F V ++ +N            WL+  KV+ ++   +L  V+ +G  P H  +
Sbjct: 188 -YWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVNVGHNPEHKYI 246

Query: 232 GFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVP 291
           GF  +    A  P+   ++G KG    F ++FV A FAY GTE   +   E  NP RN P
Sbjct: 247 GFHNWNHGDA--PF---VNGFKG----FASLFVSASFAYGGTESITLTNGEATNPVRNTP 297

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
           + IK   +RI++FY+ + F + M V Y+ P L             PF +  + AG     
Sbjct: 298 KVIKTVFWRILIFYVFSAFFIAMNVPYDYPGL-----ATKSVMTSPFTIVFQMAGSKGAG 352

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
              NA ++  V SACN  L+  SR +Y +++D   PK   KTN++  PY ++ +      
Sbjct: 353 SFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAVGG 412

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           L +     G+  V+ +  N+V +   ++W+ I IT I F R L  QG     L +     
Sbjct: 413 LCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQG-KTHELKFKNWTY 471

Query: 472 SKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVK 531
             G YF + F   + LI+ ++ F    +   NF + Y+ + VF  C+  +   +  KF+K
Sbjct: 472 PWGPYFLVVFVSFVILIQGWSAF--DPWSTSNFFSVYLELFVFPACYLIWWLYKRDKFIK 529

Query: 532 PEEADLYTFK 541
            E+ D  T K
Sbjct: 530 YEDMDFVTDK 539

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  216 bits (550), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 161/523 (30%), Positives = 257/523 (49%), Gaps = 31/523 (5%)

Query: 56  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA 115
           KK L+ RH++M                       P S+LI +  VG  +  V+ C  E++
Sbjct: 70  KKVLDQRHLTMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELS 128

Query: 116 TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174
              P+ G +  +ASR+ DP+ GF+VG +YL  +LI  P++L   +L + YW     VNP 
Sbjct: 129 CQYPVSGSYALHASRFIDPSAGFSVGINYLLMWLISFPSELVGCSLTMTYWA--PSVNPA 186

Query: 175 VWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGP-SHDRLGF 233
           VW+ I   + + +N            ++S FK++ +   I++  +++ GGGP S   +G 
Sbjct: 187 VWVAIAFTLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGT 246

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           +++ DPG+F P +         F +F   FV A +++ GTE+  + +AE ++   +V RA
Sbjct: 247 KYWYDPGSFAPPA---------FKNFCNTFVSAAYSFSGTEMVVLTSAEARD-VSSVSRA 296

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGI--PVLP 351
            K T +RI VFY+VT+ ++G  V YNDP L+            PFV+A+ N G     + 
Sbjct: 297 AKGTFWRIAVFYIVTVIIIGCLVPYNDPRLINGSSSEDITAS-PFVIALSNTGAMGTRVS 355

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
              NA +L+ VFS CNS +Y +SR + GLA   + PKI    ++ G P   + +C  F L
Sbjct: 356 QFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICGYMDRNGRPLVGMAICGAFGL 415

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471
           L ++ VS     VF +   + SI    +W  I    I F  A++AQG     + Y +PL 
Sbjct: 416 LGFLVVSKDQGTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPL- 474

Query: 472 SKGAYFALFFCCLIALIKNFTVF-----LGHKFDYKNFITGYIGIPVFIICFFGYK-YIR 525
             G Y  +  C L  L+    ++     +G      NF    + IP+ I  + G++ Y R
Sbjct: 475 --GIYGGVVGCTLNVLLVIGEIYVSAAPVGMPSSAANFFEYCMSIPIMIAVYIGHRIYRR 532

Query: 526 GTK--FVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566
             +  ++K E+ DL +   L DLE    KL    +KE + S P
Sbjct: 533 DWRHWYIKREDIDLDSGHSLEDLEAT--KLRRDQEKEYVASRP 573

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  216 bits (550), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 151/539 (28%), Positives = 256/539 (47%), Gaps = 28/539 (5%)

Query: 50  HDGIR-------LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGF 102
            DG R       LKK +++RHV M                       P S++I Y  V F
Sbjct: 74  EDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSF 133

Query: 103 LVYIVMTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAAL 160
           + Y ++   GEM   Y  L G F +Y S +   + GFA  + +  ++L + P +L  +++
Sbjct: 134 ITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSM 193

Query: 161 VLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVI 220
            ++YW   + +N  V+I IF V ++ I+              +S K+L++   I+L  VI
Sbjct: 194 TIKYW--NDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVI 251

Query: 221 MLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVA 280
             GG      +G ++++DPG+F   S A      +F     + V A F++ G EL  +  
Sbjct: 252 NCGGAGVDGYIGGKYWRDPGSFADGSNAT-----RFKGICFILVTAYFSFGGIELFVLSI 306

Query: 281 AECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVV 340
            E  N R++ P A K ++YRI++ YL+T+ L+G  V +N+  L+            P+V+
Sbjct: 307 NEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHAS--PYVL 364

Query: 341 AIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPY 400
           A     + V+PHI NA +L+ V S  NS LY A R +  LA    AP+     ++ G P 
Sbjct: 365 AASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPL 424

Query: 401 NSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVD 460
            +L +C L  ++ ++  S    Q F +   +  +  + +W  I++++I F +A++ QG  
Sbjct: 425 RALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRS 484

Query: 461 KSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIGIPVFI 515
              L Y A     G+Y+ +FF  L+  +  F V L     G K D + F  GY+  P++I
Sbjct: 485 LGELGYKANTGIWGSYYGVFFNILV-FMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWI 543

Query: 516 ICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWF 572
             + GY  Y +    + P ++ DL   + + D E    +  D   KEK+ +S   F+ +
Sbjct: 544 FMYLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQE--DEENKEKLRNSSIFFRMY 600

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  215 bits (547), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 151/530 (28%), Positives = 273/530 (51%), Gaps = 19/530 (3%)

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           L+ +L++RH+ M                       P  ILI +   G +++ ++  LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGEL 147

Query: 115 ATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNP 173
           A   P+ G F +YA+R+ D + GFA  ++Y+F++L+  P ++ AA++ + YW +  +   
Sbjct: 148 AVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTD 207

Query: 174 GVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGF 233
           G ++ +F +++V IN              S  KV+ ++  I+L  +++ GGGP    +G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGG 266

Query: 234 RFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRA 293
           R++ DPGAF  +S        +F  F +VFV A F++ G+EL GI +AE KNPR++VP+A
Sbjct: 267 RYWHDPGAFAGHSPG-----RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQA 321

Query: 294 IKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
            K   +RI++FY++ + L+G+ V Y DP LL            PFV+AI   GI  LP +
Sbjct: 322 AKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASAS--PFVIAIVTHGISGLPSV 379

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            N  +L+ V S  NS +Y  SR+L  L+     PK  A  ++ G P   + +C  F L+A
Sbjct: 380 VNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIA 439

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
           ++  S+   Q+FN+ + +  I   ++W +I   +I F  AL+  G     L + +P+   
Sbjct: 440 FVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGII 499

Query: 474 GAYFALFFCCLIALIKNFTVF--LGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFV 530
           G+Y+ +    L+ + + +     +G   +  +F + Y+  P+ +  +  +K + R  K +
Sbjct: 500 GSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLL 559

Query: 531 KP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGW 579
            P ++ D+ T +   D+   + ++  A +K  +   P    W+Y  ++ W
Sbjct: 560 IPLKDIDIDTGRRETDINLLKQEI--AEEKAALAMRP----WWYRVYVFW 603

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  214 bits (546), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 163/583 (27%), Positives = 265/583 (45%), Gaps = 38/583 (6%)

Query: 7   SYRKDLEKIVSNSNTTSKDVENLDL-SNQDDISSQESHLNIDGK----HDGIR------- 54
           S   D   I S+ N +    +N     N  D   +  H N++ K     DG         
Sbjct: 30  STNDDDISIASSQNRSLSHRKNTSYYRNFIDSFKRAEHGNLNEKSADLEDGTASIQSKSY 89

Query: 55  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEM 114
           +KK L+ARHV M                       P S++I Y  V F+VY ++   GEM
Sbjct: 90  MKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEM 149

Query: 115 A-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172
           A TY  L G F +Y S +   + GFA  + +  +++ + P +L  ++L +QYW     +N
Sbjct: 150 AVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWT---DLN 206

Query: 173 PGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232
             +++ IF V ++ I+              +  K+L++   I+   V+  GG  +   +G
Sbjct: 207 GDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIG 266

Query: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292
            +++  PG+F     A  G   +F     V V   F+Y GTEL  +   E   PR+  P 
Sbjct: 267 GKYWHTPGSF-----AEGGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPA 321

Query: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPH 352
           A K ++YRI+V YL+T+ L+G  V +N   L+            P+V+A    G+ V+PH
Sbjct: 322 AAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHAS--PYVLAASIHGVKVVPH 379

Query: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412
           I NA +L+ V S  NS LY + R L  LA    APK     ++ G P  +L+LC +F  +
Sbjct: 380 IINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCI 439

Query: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472
           A++  S    QVF +   +  +  + +W  I+ +++ F  A++ Q  D   + Y A    
Sbjct: 440 AFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGI 499

Query: 473 KGAYFALFFCCLIALIKNFTVFL-----GHKFDYKNFITGYIGIPVFIICFFGYKYIRG- 526
            G++F   F  L+ LI  F V L     G     ++F   Y+ +P+++  +  Y      
Sbjct: 500 YGSWFGSIFGVLV-LIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKE 558

Query: 527 -TKFVKPEEADLYTFKELI--DLEEEEGKLWDAAQKEKMESSP 566
            T      + DL   + +   DL  +E    DA  KEK+++SP
Sbjct: 559 WTILTDLSKIDLDAHRRIYDPDLIRQE----DAENKEKLKNSP 597

>KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {ON}
           Anc_3.397 YBR132C
          Length = 582

 Score =  214 bits (545), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 154/560 (27%), Positives = 268/560 (47%), Gaps = 16/560 (2%)

Query: 3   FIQDSYRKDLEKIVSNSNTTSKDVE-NLDLSNQDDISSQESHLNIDGKHDGIRLKKELEA 61
           F   S    +++ V+  N  S  ++ N  LS  D  S ++S  N+ G       +K L  
Sbjct: 13  FETKSLNFQVKRTVTEQNDWSDQIDTNETLSTSDLSSGKDSSTNLLGSRSTSTHRKLLN- 71

Query: 62  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLD 121
           RHV                         P  +LIA++     +  +     EM ++ P+D
Sbjct: 72  RHVQFIAISGVIGTALFVAIGKPLYRGGPAFLLIAFALWCIPILCITVSTAEMVSFFPVD 131

Query: 122 G-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIF 180
             F   + + CD +L     +++ F   +  P ++ +   V+ YW  R+  +P + + I 
Sbjct: 132 SPFLRLSKKCCDESLAVMASWNFWFLECVQIPFEIVSVNTVINYW--RDDYSPAIPLVIQ 189

Query: 181 LVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPG 240
           + +   I+            W+SSFK+L+ L L    F+ M+GG P H   GF+ Y+   
Sbjct: 190 VALYALISVCAVKYYGEMEFWMSSFKILLALGLFCFTFITMVGGNPKHKAYGFQNYRK-N 248

Query: 241 AFRPY----SEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKL 296
            F+ Y    +E I  + G F  F+A  + A F   G E   ++A E K PR+ +PRA K 
Sbjct: 249 TFKKYFPDGNENIGSAAGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVMPRAFKQ 308

Query: 297 TLYRIVVFYLVTIFLLGMTVAYNDP-LLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFN 355
             +R+ V +L +   +G+  + NDP L              P+V+A+ N GI +LP + N
Sbjct: 309 VFWRLTVLFLGSCLCVGIVCSANDPNLTAAISESRPGAGSSPYVIAMNNLGIKILPDVVN 368

Query: 356 ACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYM 415
           A ++   FSA N+  Y +SR+L+G+A+D  APK  A  NK GVP  S+ + +++ LL+ +
Sbjct: 369 AALITAAFSAGNAYTYCSSRTLHGMALDGYAPKFLAVCNKQGVPIYSVAISLIWALLSLL 428

Query: 416 NVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGA 475
            ++S SA V N+ +N+++   L+++  I ITY++F RA   Q      L + +      A
Sbjct: 429 QLNSNSAVVLNWLINIITASQLINFACICITYLFFRRAYLLQRDTLPDLPFKSWGQPYTA 488

Query: 476 YFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI--RGT-KFVKP 532
            F L    ++ +++ +TVF    ++ ++F+  Y+ + +    +  YK+I  RG+  F  P
Sbjct: 489 IFGLVCVLMMIIVQGYTVFFPKLWNVQDFLFYYLMVFIDAAIYLSYKFIWTRGSDSFKDP 548

Query: 533 EEADLYTFKELIDLEEEEGK 552
            + +     EL ++E  E K
Sbjct: 549 LKINFE--PELKEIEMHELK 566

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  215 bits (547), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/478 (28%), Positives = 232/478 (48%), Gaps = 21/478 (4%)

Query: 54  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGE 113
           +L K ++ RH+ M                       P  ++I Y     ++Y V+   GE
Sbjct: 105 QLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAGE 164

Query: 114 MA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKV 171
           +   Y  L G +T+Y +   DPA+GFAV   Y  ++L + P QL  AA+ ++YW +   V
Sbjct: 165 LGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTT--NV 222

Query: 172 NPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRL 231
           NP +++   LV+++ IN            + +  K+L+M   ++L  VI  GG    + +
Sbjct: 223 NPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYI 282

Query: 232 GFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVP 291
           G ++++ PGAF       +G KG      AVF YA F+Y G E+  + A E  NPR+ +P
Sbjct: 283 GVKYWQTPGAFA------NGFKG----VAAVFCYAAFSYGGIEVLVLTANEQANPRKAIP 332

Query: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLP 351
            A +  +YR++  Y++T  ++   V YN P LL            PFV+A+ + G+ V+P
Sbjct: 333 DACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVP 392

Query: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411
           HI NA +L+ V S  NS LY   R L  L+    APK F   ++ G P   +++ +   L
Sbjct: 393 HIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGL 452

Query: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQ--GVD-KSTLAYAA 468
           +A++       +VF + + V  +  +  W++I I+++ F  A+R+Q  G+  +  + Y A
Sbjct: 453 IAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTA 512

Query: 469 PLASKGAYFALFFCCLIALIKNFTVF--LGH--KFDYKNFITGYIGIPVFIICFFGYK 522
                G+  AL     I + + +     LGH  + D + F   Y+  PV +  +  YK
Sbjct: 513 QTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYK 570

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  214 bits (546), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 147/558 (26%), Positives = 264/558 (47%), Gaps = 26/558 (4%)

Query: 24  KDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXX 83
           +  E+  L + +D+      +  +       LKK +++RHV M                 
Sbjct: 60  RRAESQRLEDDNDLEDGTRSMRSNN-----HLKKSMKSRHVVMMSLGTGIGTGLLVANAK 114

Query: 84  XXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGY 141
                 P S++I Y  V F+ Y ++   GEM  TY  L G F +Y S +   + GFA  +
Sbjct: 115 GLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTW 174

Query: 142 SYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXW 201
            +  ++L + P +L  +++ ++YW   + +N  V+I IF V ++ I+             
Sbjct: 175 LFCIQWLTVLPLELITSSMTIKYW--NDTINADVFIAIFYVFLLFIHFFGVKAYGETEFI 232

Query: 202 LSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVA 261
            +S K+L++   I+L  +I  GG      +G  ++++PG+F   S A      +F     
Sbjct: 233 FNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADGSSAT-----RFKGICF 287

Query: 262 VFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDP 321
           + V A F++ G EL  +   E  NPR++ P A K ++YRI++ YL+T+ L+G  V +++ 
Sbjct: 288 ILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDND 347

Query: 322 LLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLA 381
            L+            P+V+A    G+ V+PHI NA +L+ V S  NS LY A R +  LA
Sbjct: 348 QLMGSGSSATHAS--PYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLA 405

Query: 382 IDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWI 441
               APK     ++ G P  +L++C    L+ ++  SS   Q F +   +  +  + +W 
Sbjct: 406 QQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWS 465

Query: 442 AILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG----- 496
            I++++I F +A++ QG     + Y +     G+Y+ + F  L+  +  F V L      
Sbjct: 466 GIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILV-FMAQFWVALSPPGSD 524

Query: 497 HKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLEEEEGKLW 554
            K D ++F   Y+  P++I  + GY  Y +    + P ++ DL   + + D E    +  
Sbjct: 525 GKCDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQE-- 582

Query: 555 DAAQKEKMESSPKNFKWF 572
           D   KE++ +S   F+ +
Sbjct: 583 DEENKERLRNSSVFFRMY 600

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  213 bits (542), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 153/553 (27%), Positives = 258/553 (46%), Gaps = 36/553 (6%)

Query: 18  NSNTTSKDVENLDLSNQDDISSQESHLNID------GKHDGIR--LKKELEARHVSMXXX 69
           +S+ + ++   +D S + +I    S L+ID           IR  L + L  RH++M   
Sbjct: 2   SSSISDREAVKVD-SGKQEIYEVSSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISI 60

Query: 70  XXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYAS 128
                               P S+ + Y+ +G +VY+ M CLGEM+T++P+ G F SYA 
Sbjct: 61  AGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYAR 120

Query: 129 RYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT--IFLVIIVT 186
           ++   +   A+ ++Y F   +   + LTA  LVL YW + +   P  W    IF   ++ 
Sbjct: 121 KFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFP-YWGASLIFWFFVLF 179

Query: 187 INXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS 246
           +N            WL+  KV+ ++   ++  ++ +G  P H+ +GF+ +    A  P+ 
Sbjct: 180 LNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEA--PF- 236

Query: 247 EAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYL 306
             ++G KG    F ++FV A FAY GTE   +   E  NP RN P+ +K   +RI++FY+
Sbjct: 237 --VNGFKG----FASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYV 290

Query: 307 VTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366
           ++ F +GM + Y+ P L             PF +  + AG        NA +L  V SAC
Sbjct: 291 LSTFFIGMNIPYDYPGL-----STKSVMTSPFTLVFQMAGTRGAGSFMNAVILTSVISAC 345

Query: 367 NSDLYVASRSLYGLAIDNKAP-KIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVF 425
           N  L+  SR +Y +A+D   P KI  +TN++  PY ++++      L       G+  ++
Sbjct: 346 NHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLW 405

Query: 426 NYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLI 485
            +  N+V +   ++W+ I IT I F + L  QG     L +       G YF + F   I
Sbjct: 406 TWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFI 464

Query: 486 ALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYT-----F 540
            LI+ +  F    +   +F + Y+ + VF   +  +   +   FVK E+ D  T      
Sbjct: 465 ILIQGWQAF--DPWSVTDFFSVYLELFVFPFVYIIWWLWKRDWFVKYEDMDFVTDRYIPT 522

Query: 541 KELIDLEEEEGKL 553
           KE+++L E    L
Sbjct: 523 KEIVELNERLDNL 535

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  213 bits (542), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 151/537 (28%), Positives = 255/537 (47%), Gaps = 40/537 (7%)

Query: 34  QDDISSQESHL--------NIDGKHD---GIR--LKKELEARHVSMXXXXXXXXXXXXXX 80
           + D+S +E+H+          D  +D    IR  L + L+ R V+M              
Sbjct: 16  KTDLSPKENHVVCELDPSFTTDENYDPEANIREDLTRALKPRVVNMISIAGIIGTGLYLS 75

Query: 81  XXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDPALGFAV 139
                    P S+ + Y+ +G +VY+ +  LGEM+TY+P+ G F  YA ++   +   A+
Sbjct: 76  TSKSLHTGGPASLFMNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACAL 135

Query: 140 GYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT--IFLVIIVTINXXXXXXXXX 197
            ++Y F   +   + LTA  LV+ YW + E   P  W    IF  ++V +N         
Sbjct: 136 MWNYWFNDAVSVASDLTALQLVMDYWKTSEHGFP-YWAASLIFWFVVVCLNVIHVRFYGE 194

Query: 198 XXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFV 257
              WL+  K++ ++   +L  V+ +G  P H+ +GF+ +    A  P+ + I G      
Sbjct: 195 AEYWLAMLKIIAIIIFFILSIVVNVGKNPQHEYIGFKNWTRGEA--PFVDGIKG------ 246

Query: 258 SFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVA 317
            F ++FV A FAY GTE   +   E +NP RN P+ +K   +RI++FY+ + F + M + 
Sbjct: 247 -FASLFVSASFAYGGTESITLTNGEAENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIP 305

Query: 318 YNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSL 377
           Y+ P L             PF +  + AG        NA ++  V SACN  L+  SR +
Sbjct: 306 YDYPGL-----DSKSIVTSPFTLVFQMAGTKGAGSFMNAVIMTSVISACNHALFAGSRIM 360

Query: 378 YGLAIDNKAP-KIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFG 436
           Y + ++   P +I ++TN+  VPY S+++      L +     G+  ++ +  N+V +  
Sbjct: 361 YNMGLEGFLPARIVSRTNRNKVPYVSVLITAAVGALCFGASFIGAGTLWTWLQNIVGVSN 420

Query: 437 LMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG 496
            ++W+ I IT I F + L  QG     L Y       G YF + F   I LI+ ++ F  
Sbjct: 421 QIAWLCIGITSIRFRKGLEKQG-KTHELIYKNWTYPYGPYFVIIFVSFIILIQGWSAFA- 478

Query: 497 HKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYT-----FKELIDLEE 548
             ++  NF + Y+ + VF +CF  +  ++  +FVK E+ D  T      KE+I+L E
Sbjct: 479 -PWNVSNFFSYYLELFVFPVCFIIWWLVKRDRFVKYEDMDFTTDRYIPTKEIIELNE 534

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  214 bits (544), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 142/515 (27%), Positives = 244/515 (47%), Gaps = 27/515 (5%)

Query: 38  SSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAY 97
           S Q S L    K++   L+K +++RH+ M                       P  +++ Y
Sbjct: 76  SDQNSELESQEKNN---LRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGY 132

Query: 98  SFVGFLVYIVMTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQL 155
                ++Y ++   GE+   Y  L G +T Y+S   DP+LGFAV   Y  ++L + P QL
Sbjct: 133 GIASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQL 192

Query: 156 TAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIV 215
             AA+ ++YW +   VN  +++ +  + ++ IN              +  K+L++   ++
Sbjct: 193 VTAAMTVKYWTN---VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVI 249

Query: 216 LLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTEL 275
           L  VI  GG      +G  ++ +PG   P++    G          VF YA F+Y G E+
Sbjct: 250 LAIVINCGGAGDRRYIGTEYWHNPG---PFAHGFKG-------VCTVFCYAAFSYGGIEV 299

Query: 276 CGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXX 335
             + AAE +NP  ++P A K  +YRI++ Y++T  L+G  V YN   LL           
Sbjct: 300 LLLSAAEQENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHAS 359

Query: 336 XPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNK 395
            PFV+A+ + G+ V+PH  NA +L+ V S  NS LY   R L  LA     PK  A  ++
Sbjct: 360 -PFVIAVSSHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDR 418

Query: 396 WGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALR 455
            G P    ++ + F  + ++  S+   QVF + + + S+  L  W+++ +++I F  A+ 
Sbjct: 419 NGRPLLCFLVSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMA 478

Query: 456 AQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLG-----HKFDYKNFITGYIG 510
            QG     + Y A     G++ A+       L+  F V +       K D K F   Y+ 
Sbjct: 479 KQGRSMDEVGYKAQTGYWGSWIAVLIAVFF-LVCQFWVAIAPVSEHGKLDVKVFFQNYLA 537

Query: 511 IPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKEL 543
           +P+ ++ +FG+K Y +  +F  P E+ DL + + +
Sbjct: 538 MPIVLLAYFGHKMYFKSWRFWIPAEKIDLDSHRNV 572

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  212 bits (539), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 150/530 (28%), Positives = 245/530 (46%), Gaps = 33/530 (6%)

Query: 23  SKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXX 82
           S D+E   L      ++   HLN           + L  RHV+M                
Sbjct: 26  SSDLEQPSLEGLTTDNNVREHLN-----------RSLSPRHVNMIAIAGVIGTGLYLGTG 74

Query: 83  XXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDPALGFAVGY 141
                  P S+LI YS +G +VY  +  LGEM+TY+P+ G F S+A ++   +  FA+  
Sbjct: 75  RALHLGGPASLLINYSIIGLIVYATLLSLGEMSTYMPISGSFCSFAKKFGSESFAFALMC 134

Query: 142 SYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT--IFLVIIVTINXXXXXXXXXXX 199
           +Y F   +   + LTA  LVL YW + E   P  WI   IF V ++ +N           
Sbjct: 135 NYWFNDAVSVASDLTALQLVLDYWKTSESGFP-YWIASLIFWVFLLFLNVIHVKIYGEAE 193

Query: 200 XWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSF 259
            WL+  KV+ ++   +L  V  +G    H+ +GFR +    A  P+   ++G +G    F
Sbjct: 194 YWLAMLKVIAIIIFFILSIVANVGHNEQHEYIGFRNWTRGDA--PF---VNGFRG----F 244

Query: 260 VAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYN 319
             +FV A FAY GTE   + + E KNP RN P+ IK   +RI++FY+ T+F +GM V Y+
Sbjct: 245 ATLFVSASFAYGGTESITLTSGETKNPVRNTPKVIKTVFWRILIFYIFTVFFIGMNVPYD 304

Query: 320 DPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYG 379
            P L +           PF +  +  G        NA +L  V SACN  L+  SR L+ 
Sbjct: 305 YPNLSE-----KSVMTSPFTIVFQMVGSKAAGSFMNAVILTSVVSACNHALFAGSRILFN 359

Query: 380 LAIDNK-APKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLM 438
           L ++    PK+  +TN + VPY ++++      L + +   G+  ++ +  N+V +   +
Sbjct: 360 LGLEGYFFPKLVTRTNWYQVPYVAVLVTWAVGGLCFGSSFIGAGTLWIWLQNLVGVSNQI 419

Query: 439 SWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHK 498
           +W++I +  I F R L  QG     L +       G YF +     I L++ ++      
Sbjct: 420 AWLSIGVISIRFRRGLSRQG-KTHELKFVNWTYPYGPYFVIISVSFIILVQGWSS--SSP 476

Query: 499 FDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEE 548
            D  +F + Y+ + +F+ C+  +   +   FV+ ++ D  T K +    E
Sbjct: 477 MDVTSFFSYYVELFIFLACWLVWWAFKRDGFVREKDMDFVTDKYIPSERE 526

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  212 bits (540), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 144/516 (27%), Positives = 256/516 (49%), Gaps = 36/516 (6%)

Query: 47  DGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYI 106
           DG  D   LKK L+ARH+ M                       P++++I ++  G  +  
Sbjct: 78  DGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIG 137

Query: 107 VMTCLGEMATYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYW 165
            +  LGE+    P+ G F +Y++R+ DP++ F V   Y+ ++  + P ++ ++A+ +QYW
Sbjct: 138 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYW 197

Query: 166 VSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGG 225
              E ++P VW+ IF V IV+IN              S+ KV+ +   I+L  +++ GGG
Sbjct: 198 --NESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGG 255

Query: 226 PSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKN 285
           P H  +G R++ +PG               F   ++V V A ++  GTE+  + + E  +
Sbjct: 256 PDHVYVGSRYWHNPGCL----------ANGFPGVLSVMVVASYSLGGTEMTCLASGET-D 304

Query: 286 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNA 345
           P+  +P AIK   +RI+ F+LV++ L+G  V Y +  LL            PFV+AIK  
Sbjct: 305 PKE-LPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS----PFVIAIKIH 359

Query: 346 GIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLIL 405
            I VLP I NA +L+ + S  NS ++ +SR+L  +A  +  P  F   ++ G P   +I 
Sbjct: 360 HIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIIT 419

Query: 406 CILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLA 465
             LF LLA++  S   ++VF++ + +  +   + W++I +++I F  A++AQG   + L 
Sbjct: 420 NSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELE 479

Query: 466 YAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKN-------FITGYIGIPVFIICF 518
           + + +   G+ ++    CLI L+  F + L     +KN       F   Y+   + +  +
Sbjct: 480 FVSAVGIWGSVYSAIINCLI-LVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIW 538

Query: 519 FGYK--YIRGTKFVKPEEADLYTFKELIDLEEEEGK 552
            G+K  Y R T         ++ F  L +++ +EG+
Sbjct: 539 IGHKIYYWRQT-------GKIWAFTPLAEIDLDEGR 567

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  211 bits (538), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 151/559 (27%), Positives = 262/559 (46%), Gaps = 35/559 (6%)

Query: 24  KDVENLDLSNQDDISSQ-ESHLNIDGKHDGIRLKKELEARHVSMXXXXXXXXXXXXXXXX 82
           KD    +  + + ++   E+   + GK +   L++ +  RHV M                
Sbjct: 11  KDASGAEADSVESVAEDVEAGAGVQGKKE--VLRQSIRPRHVFMISMATGIGTGLLVGNG 68

Query: 83  XXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPL--DGFTSYASRYCDPALGFAVG 140
                      LI Y  +G ++   M  +GE+    P    GF SY  R+ DP+LGF+V 
Sbjct: 69  KSIACAGIGGTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVS 128

Query: 141 YSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXXXXX 200
           + +  +++I+ P +L   ++ ++YW     ++P +++++F  +I  +N            
Sbjct: 129 WLFCLQWMIVLPLELVTGSMTIKYW--NASLSPSLFVSVFYALICVVNSFGSGGYAEAEF 186

Query: 201 WLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFV 260
             +S KV+V++  I+L  +I  G   +   +GFR+  DPG F      I  + G  V+  
Sbjct: 187 IFNSLKVVVIIGFIILGVLIDTGCVGTSGTIGFRYLIDPGMFNKNYNIIKATAGTLVN-- 244

Query: 261 AVFVYALFAYLGTELCGIVAAECKNPRRNVP----RAIKLTLYRIVVFYLVTIFLLGMTV 316
                A F+  G E   + AAE    R N+P    RA      RI VFYL++I ++G+ V
Sbjct: 245 -----AAFSCGGVEFLALSAAE--QNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLV 297

Query: 317 AYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRS 376
            +N P+L+            P+V A+   GI V+PHI NA +L+ V S  NS +Y +SR+
Sbjct: 298 PHNSPILMGSGSNMIHSS--PYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRT 355

Query: 377 LYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFG 436
           L+ LA  N APK F K NK G P   L +  LF L++++        +F + +++  +  
Sbjct: 356 LHSLAEQNFAPKYFTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLST 415

Query: 437 LMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL- 495
           + +W  I I +I F  A++++G    TL Y +     G+Y A     L+ L+  F V L 
Sbjct: 416 IFTWTTICIAHIRFRDAIKSRGQSLETLGYKSITGVAGSYIATVI-NLVILVVQFWVSLF 474

Query: 496 ----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRG-TKFVKPEEADLYTFKELIDLEEE 549
                 K +   F   Y+ +PV ++ + G+K Y +  +  ++    D+ T +++     E
Sbjct: 475 PLESNGKPNIVQFFQNYMAVPVALLFYIGHKVYTKNWSLLIRASNVDITTDRDIYCPTIE 534

Query: 550 EGKLWDAAQKEKMESSPKN 568
           + K+     K  M++SP  
Sbjct: 535 DPKI-----KVLMQNSPSQ 548

>ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]
           {ON} similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 578

 Score =  210 bits (535), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 144/558 (25%), Positives = 256/558 (45%), Gaps = 31/558 (5%)

Query: 5   QDSYRKDLE-------KIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKK 57
           Q S+ +DL        + V+   + S +VEN  + N +  +                +++
Sbjct: 5   QKSFEQDLVPKKSSWVETVNTEASESSEVENGGVVNFERSTRH--------------VQR 50

Query: 58  ELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATY 117
           +L+ RHV +                         ++L+ ++     +  +  C  EM  +
Sbjct: 51  KLKNRHVQLISISGVIGTALFVSIGKALYHGGAANLLLGFAIWCIPIMCITVCTAEMVCF 110

Query: 118 IPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVW 176
           +P+   F   A    D +LG    +++ F   +  P ++ +   ++ YW  R+  N  + 
Sbjct: 111 LPVSSPFLRLAHMCVDDSLGVMASWNFWFLECVQIPYEIVSVNTIIHYW--RDDYNAAIP 168

Query: 177 ITIFLVIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFY 236
           + + LV+   I+            WL+SFK+++ + L    FV MLGG P HDR GFR+Y
Sbjct: 169 LVVQLVLYGFISLCTVRYYGEAEFWLASFKIVLAIGLYFFTFVTMLGGNPRHDRYGFRYY 228

Query: 237 KDPGAFRPYSEAISGSK--GKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAI 294
            +   F+ Y     GS   G F  F+A  + A F   G E   ++A E   PR+ +PRA 
Sbjct: 229 GE-APFKKYWPNGHGSNASGHFQGFLACVIQAAFTVAGGEYVSMLAGEVVLPRKVMPRAF 287

Query: 295 KLTLYRIVVFYLVTIFLLGMTVAYNDP-LLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHI 353
           K    R+ V +L +   +G+  + NDP L              P+V+A+K+  I VLP I
Sbjct: 288 KQVFIRLTVLFLGSCLCVGILCSPNDPDLTAAINESRPGAGSSPYVIAMKHLHIHVLPDI 347

Query: 354 FNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLA 413
            NA ++   FS+ N+  Y +SR+LYG+A+D  APKIFA+    G P  ++ + + +  L+
Sbjct: 348 VNAALITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFARCTPQGTPIFAMAVSMCWGFLS 407

Query: 414 YMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASK 473
            + +   SA V N+ +N+++   L++++ + +TY++F R  +    +   L + +     
Sbjct: 408 LLQLGDNSAVVLNWLINLITTSQLINFVILCVTYLFFRRVYKVNEHNLPRLPFKSWWQPW 467

Query: 474 GAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI--RGT-KFV 530
            AY  +     +  I+ + VF    +  K F+  Y+ + + I  + GYK+I  RG  K  
Sbjct: 468 PAYIGIICAGSMTFIQGYAVFFSSLWSTKQFLFSYLMLFIDIGLYLGYKFIWRRGKDKLR 527

Query: 531 KPEEADLYTFKELIDLEE 548
            P E + +     ID  E
Sbjct: 528 NPTEVNFFPLLAEIDAHE 545

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  210 bits (534), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 150/558 (26%), Positives = 261/558 (46%), Gaps = 35/558 (6%)

Query: 12  LEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNID-----GKHDGIR--LKKELEARHV 64
           + K +S++  +S+++ ++    QD +  + +   ++          IR  L + L+ RH+
Sbjct: 1   MSKSISSATNSSEEI-SISKKQQDHLIYETTSYGVNEVYTIDPEANIREDLTRALKPRHI 59

Query: 65  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-F 123
           +M                       P S+ I YS +G +VY+ + CL EM+TY+P+ G F
Sbjct: 60  NMISIAGIIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAEMSTYMPISGSF 119

Query: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWIT--IFL 181
            +YA ++   +   A+ ++Y F   +   + LTA  LV+ YW +     P  W    IF 
Sbjct: 120 CTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHFP-YWAASLIFW 178

Query: 182 VIIVTINXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241
             ++++N            WL+  KV+ ++   ++  ++ +G  P H+ +GF+ +    A
Sbjct: 179 FFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYIGFKNWTVGEA 238

Query: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301
             P+ +   G       F ++FV A FAY GTE   + + E  NP RN P+ +K   +RI
Sbjct: 239 --PFVDGFKG-------FASLFVSASFAYGGTESITLTSGESDNPLRNTPKIVKTVFWRI 289

Query: 302 VVFYLVTIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMF 361
           + FY+ T F + M V YN P L             PF +  K AG        NA ++  
Sbjct: 290 LFFYIGTTFFIAMNVPYNYPGL-----SSGSVVTSPFTIVFKMAGTAGAGSFMNAVIMTS 344

Query: 362 VFSACNSDLYVASRSLYGLAIDNKAPK-IFAKTNKWGVPYNSLILCILFCLLAYMNVSSG 420
           V SACN  L+  SR +Y + ++   PK I ++TN++ VPY ++++      L +     G
Sbjct: 345 VISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVGGLCFGASFIG 404

Query: 421 SAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALF 480
           +  ++ +  N+V +   ++W+ I IT I F + L AQ      L +       G YF + 
Sbjct: 405 AGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQN-KTHELKFKNWTYPFGPYFLVV 463

Query: 481 FCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTF 540
               I L++ ++ F    ++  NF + YI + VF  CF  +   +   FVK ++ D  T 
Sbjct: 464 AVTFIILVQGWSSFA--PWNVSNFFSVYIELFVFPFCFIIWWLYKRDPFVKCKDMDFVTD 521

Query: 541 K-----ELIDLEEEEGKL 553
           K     E+I+L E+   L
Sbjct: 522 KYVPSQEIIELNEKLDNL 539

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  211 bits (536), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 160/549 (29%), Positives = 266/549 (48%), Gaps = 33/549 (6%)

Query: 10  KDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMXXX 69
           K+ +  V++  T S + E+L    +DD    E+    +      +L + +++RH+ M   
Sbjct: 56  KNGDTQVTSGITNSFESESL----RDDSKPLENEEKTEN-----QLNRSIKSRHLLMISL 106

Query: 70  XXXXXXXXXXXXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMA-TYIPLDG-FTSYA 127
                               P  ++I Y     +VY ++   GE+   Y  L G +  Y 
Sbjct: 107 GTGIGTGLLVGNGQVLAKSGPAGLVIGYGVASIMVYFIVQAAGELGICYSGLTGNYIRYP 166

Query: 128 SRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTI 187
           S   DPALGFA+   Y  ++L + P QL  AA+ + YW +   +NP +++ I LVI+V  
Sbjct: 167 SILVDPALGFAISIIYTLQWLTVMPLQLVTAAMTIGYWTN---INPNIFVAIVLVIVVLT 223

Query: 188 NXXXXXXXXXXXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSE 247
           N              + FKVL+M+  ++L  +I  G   +   +G  ++K+PGAF     
Sbjct: 224 NCFGAKGYVEAEFLCNIFKVLMMVGFVLLAILINTGAIGTDGYIGTIYWKNPGAFA---- 279

Query: 248 AISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLV 307
             +G KG      +VF YA F+Y G E+  + AAE +NP + +P A K T+YRI+  Y++
Sbjct: 280 --NGFKG----VCSVFCYAAFSYGGIEVLALTAAEQENPIKAIPSACKKTVYRILFLYML 333

Query: 308 TIFLLGMTVAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACN 367
           T  L+G  V Y+ P L+            PFV+AI + G+ V+PH+ NA +L+ + S  N
Sbjct: 334 TTILIGFLVPYDSPQLMGSTSGGGSHSS-PFVIAIASHGVKVVPHLINAVILISIVSVAN 392

Query: 368 SDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNY 427
           S  Y ++R L  L+   K PKIF   +K G P+  ++   LF  + ++  S    +VF +
Sbjct: 393 SAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCILFASLFGSIGFVASSPYKEEVFTW 452

Query: 428 FVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIAL 487
            + +  +  +  W++I +++I F RA+  QG     + Y AP    G++ AL    L +L
Sbjct: 453 LLAISGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEIGYKAPTGCWGSWIALSI-ALFSL 511

Query: 488 IKNFTVFLG-----HKFDYKNFITGYIGIPVFIICFFGYK--YIRGTKFVKPEEADLYTF 540
           I  F V +       K D   F   Y+  P+ +I + GYK  Y     ++  ++ DL   
Sbjct: 512 ISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYLGYKTYYKDWRLYIPSDKIDLSYG 571

Query: 541 KELIDLEEE 549
           +E+   EE+
Sbjct: 572 REIYVPEEQ 580

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  210 bits (535), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 149/566 (26%), Positives = 267/566 (47%), Gaps = 32/566 (5%)

Query: 23  SKDVENLDLSNQDDISSQESHLNIDGKHDGI---RLKKELEARHVSMXXXXXXXXXXXXX 79
           SKD    D S  +DI++  +    +  H G    +LK+ ++  HV M             
Sbjct: 37  SKDTLISDSS--EDITNDSTTGKTEKGHTGSENEKLKQSIKPYHVFMITMATGIGTGLLV 94

Query: 80  XXXXXXXXXXPVSILIAYSFVGFLVYIVMTCLGEMATYIP--LDGFTSYASRYCDPALGF 137
                         L+ Y  +G ++   M  +GE+    P    GF SY  R+ DP+ GF
Sbjct: 95  GNGKSISDAGVGGTLVGYFIIGSMLVCCMQSVGELVVAFPSLAGGFNSYGKRFVDPSFGF 154

Query: 138 AVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINXXXXXXXXX 197
            V + +  ++ I+ P +L  A++ ++YW     +NP +++ IF  +I+ I+         
Sbjct: 155 TVAWLFCLQWQIVLPLELVTASMTIKYW--NNSLNPSIFVAIFYSLILGISFFGARGYAD 212

Query: 198 XXXWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFV 257
                +  KVL++   I+L  +I  G   +   +G ++ K PGAF         ++  F 
Sbjct: 213 AEFLFNLSKVLMITGFIILGIIISFGAAGTSGYIGIKYLKTPGAFN--------TRNTFK 264

Query: 258 SFVAVFVYALFAYLGTELCGIVAAECK--NPRRNVPRAIKLTLYRIVVFYLVTIFLLGMT 315
           S  +  V A F+  G E   + AAE    N  +++ RA    L R+ VFY+++IF++G+ 
Sbjct: 265 SICSTLVNACFSCGGVEFLALSAAEQARGNISKSIKRACGQVLVRMCVFYILSIFVIGLL 324

Query: 316 VAYNDPLLLQXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASR 375
           V YN P L+            P+V+A+ + G+ V+PH+ NA +L+ V S  NS +Y +SR
Sbjct: 325 VPYNSPELMGSSSEIIHSS--PYVIAVASHGVKVVPHLINAVILIAVVSVANSAMYSSSR 382

Query: 376 SLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIF 435
           +L+ LA    AP  FAK +  G P+  L++  +F LL+++        VF + +++  + 
Sbjct: 383 TLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSFIAEYKDQESVFVWLLSISGLS 442

Query: 436 GLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFL 495
            + +W  I + ++ F  A++ Q      L + A     G+Y+ +    L  L+  F V L
Sbjct: 443 TIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWSGIYGSYYVIAINSL-TLVVQFWVSL 501

Query: 496 -----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKP-EEADLYTFKELIDLEE 548
                  + D+ NF   Y+ +P  +  + G+K Y R  +F+ P ++ D+ T +++  +E 
Sbjct: 502 FPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTRSWQFIIPADKIDVDTSRDIYGVEN 561

Query: 549 EEGKLWDAAQKEKMESSPKNFKWFYE 574
             G ++ A       ++P  FK  Y+
Sbjct: 562 RTGHIFMAHCD---ANNPNGFKETYK 584

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.143    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,641,143
Number of extensions: 2222589
Number of successful extensions: 11553
Number of sequences better than 10.0: 398
Number of HSP's gapped: 10119
Number of HSP's successfully gapped: 419
Length of query: 581
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 466
Effective length of database: 40,294,809
Effective search space: 18777380994
Effective search space used: 18777380994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)