Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G08998gsingletonON22422411941e-168
KLTH0D10912g8.662ON2872257299e-97
Kwal_26.87368.662ON2872257254e-96
SAKL0H06886g8.662ON2872257072e-93
NCAS0B015408.662ON2872256881e-90
KNAG0J016308.662ON2882256837e-90
TBLA0B039108.662ON2902256533e-85
NDAI0E012308.662ON2872256463e-84
ZYRO0F07040g8.662ON2822226453e-84
Kpol_1072.238.662ON2882256402e-83
KAFR0H024708.662ON2912286318e-82
TDEL0A060808.662ON2882256238e-81
KLLA0F11462g8.662ON2872224441e-53
Suva_8.213singletonON102972514e-27
Suva_8.214singletonON143601841e-16
NDAI0G038003.21ON293168950.001
TBLA0A077003.21ON28575830.030
KNAG0K025303.21ON28473780.12
KNAG0D006006.298ON68477780.17
KAFR0A085303.21ON27950760.23
NCAS0G009806.298ON65056770.24
YNL187W (SWT21)2.66ON35766760.28
Ecym_20233.21ON28573750.28
ZYRO0C03212g3.21ON28568740.39
KLTH0F19360g3.21ON28171740.44
ADL187W3.21ON28575740.45
TDEL0A071206.298ON66862740.56
Kpol_483.74.233ON63882730.67
CAGL0D03256g5.200ON54158720.82
KNAG0A012203.21ON30868691.8
Smik_14.123.21ON28475691.9
Kwal_55.220853.21ON29368692.0
KLLA0F06380g6.298ON65659692.1
KAFR0F009106.298ON65659692.1
Ecym_21206.298ON64062692.2
ZYRO0C05478g6.298ON64865683.0
TPHA0A003703.21ON29170673.1
NCAS0E013403.21ON28470673.4
CAGL0I05786g6.298ON68059683.4
TBLA0A077403.34ON48862674.4
Kpol_1036.638.312ON22061654.9
Kpol_1038.193.21ON28770655.7
NDAI0A079803.372ON68439665.8
Suva_14.3616.298ON65865665.9
YNR008W (LRO1)6.298ON66162665.9
Smik_14.3386.298ON66165666.0
TPHA0N006605.200ON52060656.7
NCAS0D026506.18ON95070656.9
YNL320W3.21ON28475647.5
Skud_14.3396.298ON66162657.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G08998g
         (224 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G08998g Chr7 complement(778100..778774) [675 bp, 224 aa] {O...   464   e-168
KLTH0D10912g Chr4 (894176..895039) [864 bp, 287 aa] {ON} conserv...   285   9e-97
Kwal_26.8736 s26 (921586..922449) [864 bp, 287 aa] {ON} [contig ...   283   4e-96
SAKL0H06886g Chr8 complement(604406..605269) [864 bp, 287 aa] {O...   276   2e-93
NCAS0B01540 Chr2 (252693..253556) [864 bp, 287 aa] {ON} Anc_8.662     269   1e-90
KNAG0J01630 Chr10 (299901..300767) [867 bp, 288 aa] {ON} Anc_8.662    267   7e-90
TBLA0B03910 Chr2 complement(896056..896928) [873 bp, 290 aa] {ON...   256   3e-85
NDAI0E01230 Chr5 complement(243135..243998) [864 bp, 287 aa] {ON...   253   3e-84
ZYRO0F07040g Chr6 (574536..575384) [849 bp, 282 aa] {ON} conserv...   253   3e-84
Kpol_1072.23 s1072 complement(51607..52473) [867 bp, 288 aa] {ON...   251   2e-83
KAFR0H02470 Chr8 (472142..473017) [876 bp, 291 aa] {ON} Anc_8.662     247   8e-82
TDEL0A06080 Chr1 (1067208..1068074) [867 bp, 288 aa] {ON} Anc_8....   244   8e-81
KLLA0F11462g Chr6 complement(1051409..1052272) [864 bp, 287 aa] ...   175   1e-53
Suva_8.213 Chr8 complement(388221..388529) [309 bp, 102 aa] {ON}...   101   4e-27
Suva_8.214 Chr8 complement(388652..389083) [432 bp, 143 aa] {ON}...    75   1e-16
NDAI0G03800 Chr7 (910625..911506) [882 bp, 293 aa] {ON} Anc_3.21...    41   0.001
TBLA0A07700 Chr1 (1903808..1904665) [858 bp, 285 aa] {ON} Anc_3....    37   0.030
KNAG0K02530 Chr11 complement(502906..503760) [855 bp, 284 aa] {O...    35   0.12 
KNAG0D00600 Chr4 complement(86399..88453) [2055 bp, 684 aa] {ON}...    35   0.17 
KAFR0A08530 Chr1 complement(1710000..1710839) [840 bp, 279 aa] {...    34   0.23 
NCAS0G00980 Chr7 complement(168524..170476) [1953 bp, 650 aa] {O...    34   0.24 
YNL187W Chr14 (287994..289067) [1074 bp, 357 aa] {ON}  SWT21Prot...    34   0.28 
Ecym_2023 Chr2 (34955..35812) [858 bp, 285 aa] {ON} similar to A...    33   0.28 
ZYRO0C03212g Chr3 complement(249377..250234) [858 bp, 285 aa] {O...    33   0.39 
KLTH0F19360g Chr6 complement(1568441..1569286) [846 bp, 281 aa] ...    33   0.44 
ADL187W Chr4 (368411..369268) [858 bp, 285 aa] {ON} Syntenic hom...    33   0.45 
TDEL0A07120 Chr1 (1243318..1245324) [2007 bp, 668 aa] {ON} Anc_6...    33   0.56 
Kpol_483.7 s483 complement(13693..15609) [1917 bp, 638 aa] {ON} ...    33   0.67 
CAGL0D03256g Chr4 complement(336625..338250) [1626 bp, 541 aa] {...    32   0.82 
KNAG0A01220 Chr1 (16327..17253) [927 bp, 308 aa] {ON} Anc_3.21 Y...    31   1.8  
Smik_14.12 Chr14 (22192..23046) [855 bp, 284 aa] {ON} YNL320W (R...    31   1.9  
Kwal_55.22085 s55 complement(1102729..1103610) [882 bp, 293 aa] ...    31   2.0  
KLLA0F06380g Chr6 complement(618296..620266) [1971 bp, 656 aa] {...    31   2.1  
KAFR0F00910 Chr6 complement(170172..172142) [1971 bp, 656 aa] {O...    31   2.1  
Ecym_2120 Chr2 complement(223032..224954) [1923 bp, 640 aa] {ON}...    31   2.2  
ZYRO0C05478g Chr3 complement(419816..421762) [1947 bp, 648 aa] {...    31   3.0  
TPHA0A00370 Chr1 (54913..55788) [876 bp, 291 aa] {ON} Anc_3.21 Y...    30   3.1  
NCAS0E01340 Chr5 (260112..260966) [855 bp, 284 aa] {ON} Anc_3.21...    30   3.4  
CAGL0I05786g Chr9 complement(547982..550024) [2043 bp, 680 aa] {...    31   3.4  
TBLA0A07740 Chr1 complement(1910240..1911706) [1467 bp, 488 aa] ...    30   4.4  
Kpol_1036.63 s1036 (174305..174967) [663 bp, 220 aa] {ON} (17430...    30   4.9  
Kpol_1038.19 s1038 (42740..43603) [864 bp, 287 aa] {ON} (42740.....    30   5.7  
NDAI0A07980 Chr1 complement(1833996..1836050) [2055 bp, 684 aa] ...    30   5.8  
Suva_14.361 Chr14 (621887..623863) [1977 bp, 658 aa] {ON} YNR008...    30   5.9  
YNR008W Chr14 (640396..642381) [1986 bp, 661 aa] {ON}  LRO1Acylt...    30   5.9  
Smik_14.338 Chr14 (598485..600470) [1986 bp, 661 aa] {ON} YNR008...    30   6.0  
TPHA0N00660 Chr14 (145600..147162) [1563 bp, 520 aa] {ON} Anc_5....    30   6.7  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    30   6.9  
YNL320W Chr14 (37700..38554) [855 bp, 284 aa] {ON} Putative prot...    29   7.5  
Skud_14.339 Chr14 (608465..610450) [1986 bp, 661 aa] {ON} YNR008...    30   7.7  

>SAKL0G08998g Chr7 complement(778100..778774) [675 bp, 224 aa] {ON}
           conserved hypothetical protein
          Length = 224

 Score =  464 bits (1194), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 224/224 (100%), Positives = 224/224 (100%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET
Sbjct: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60

Query: 61  VDGGILQASASDREAYTMTIGKDKERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISAY 120
           VDGGILQASASDREAYTMTIGKDKERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISAY
Sbjct: 61  VDGGILQASASDREAYTMTIGKDKERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISAY 120

Query: 121 RWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGWK 180
           RWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGWK
Sbjct: 121 RWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGWK 180

Query: 181 ECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           ECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL
Sbjct: 181 ECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224

>KLTH0D10912g Chr4 (894176..895039) [864 bp, 287 aa] {ON} conserved
           hypothetical protein
          Length = 287

 Score =  285 bits (729), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 173/225 (76%), Gaps = 1/225 (0%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
            TSSFKGWGL+SLDQD+ EI+ LV+YL+S +GGSR+++VLFGHSTGSQ+T+HYLL +G+T
Sbjct: 63  FTSSFKGWGLTSLDQDVSEIKELVDYLKSTEGGSRERIVLFGHSTGSQDTMHYLLKFGDT 122

Query: 61  VDGGILQASASDREAYTMTIGKDK-ERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           +D G+LQAS SDRE +   + K+   RL+  A+++V KG+  +ILPLEY+K +   P++A
Sbjct: 123 IDAGVLQASVSDREFFGQAVDKETWNRLNSKAKELVDKGQKDEILPLEYAKVMSETPVTA 182

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCSL LPGGDDDYFSSD   E L+ TFG++ KPFL+A+SE DQ VP  +DK KLL  W
Sbjct: 183 YRWCSLALPGGDDDYFSSDIPDETLKTTFGRVKKPFLVAYSEQDQIVPAYVDKKKLLDRW 242

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           + CSN  +WSKNSGL+ GA+H+++  +SQ  L  MV  FL EF L
Sbjct: 243 QACSNTDFWSKNSGLVNGANHQIEQVQSQDQLLSMVREFLTEFQL 287

>Kwal_26.8736 s26 (921586..922449) [864 bp, 287 aa] {ON} [contig 67]
           FULL
          Length = 287

 Score =  283 bits (725), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 134/225 (59%), Positives = 177/225 (78%), Gaps = 1/225 (0%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           MTSSFKGWG+SSLDQD+RE+R LV+YLRSE+GG+R+++VLFGHSTGSQ+TIHYLL+ GET
Sbjct: 63  MTSSFKGWGISSLDQDVREMRALVDYLRSEQGGARERIVLFGHSTGSQDTIHYLLSQGET 122

Query: 61  VDGGILQASASDREAYT-MTIGKDKERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           VD GILQAS SDRE ++  T  K  + L+  A+++V +GE  +ILPL+++K +   PISA
Sbjct: 123 VDAGILQASVSDREGFSQFTDRKVWDALNAEAKELVDEGEKDEILPLKFAKVMAGTPISA 182

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCSL +PGGDDDYFSSD   E+L+ TFG+I KPFLIA+S  DQ+VP  +DK+K+L+ W
Sbjct: 183 YRWCSLAIPGGDDDYFSSDLHDEILKGTFGRIQKPFLIAYSGADQFVPPSVDKSKVLQRW 242

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           +  S+  +WSK+SGLI  A H+V S+  +  LC MV  F++EF L
Sbjct: 243 QASSDARFWSKHSGLITNADHQVKSESCRDQLCAMVRGFIEEFDL 287

>SAKL0H06886g Chr8 complement(604406..605269) [864 bp, 287 aa] {ON}
           conserved hypothetical protein
          Length = 287

 Score =  276 bits (707), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 128/225 (56%), Positives = 169/225 (75%), Gaps = 1/225 (0%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           + SSFKGWG SSL  DI  IR LV+YL+SE+GGSR+K+VL GHSTGSQ+TIHYLLN+G+T
Sbjct: 63  LDSSFKGWGTSSLTDDIEGIRALVDYLKSEQGGSREKIVLMGHSTGSQDTIHYLLNHGDT 122

Query: 61  VDGGILQASASDREAYTMTI-GKDKERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           +D GILQ S SDRE++   I  + +ERL+  A++++  G   ++LP E+++     PI+A
Sbjct: 123 IDAGILQGSVSDRESFASEIDPQAQERLNSEAQQLLSDGRGDELLPAEFARRADKTPITA 182

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCS+M+PGGDDDYFSSD   E +  TFGK++KPFL+A+SE D++VP+ +DK  LL  W
Sbjct: 183 YRWCSIMVPGGDDDYFSSDLAEETISSTFGKLNKPFLVAYSEADEFVPQSVDKHALLGKW 242

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           +  SNP  WSKNSGLI GASH V   E Q++LC MV+ F+ EF L
Sbjct: 243 ENHSNPKCWSKNSGLIPGASHNVKQKEPQEYLCNMVSEFIKEFDL 287

>NCAS0B01540 Chr2 (252693..253556) [864 bp, 287 aa] {ON} Anc_8.662
          Length = 287

 Score =  269 bits (688), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 173/225 (76%), Gaps = 1/225 (0%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           MTSSFKG+G+SSLDQDI EI+ L++YLRSE+GG+R+K+++ GHSTG+Q+ IH+LL+Y + 
Sbjct: 63  MTSSFKGFGISSLDQDIHEIKALIKYLRSEQGGAREKIIIMGHSTGAQDVIHFLLHYSDL 122

Query: 61  VDGGILQASASDREAYTMTI-GKDKERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           VDG ILQ S SDRE++  ++  K  ++++  A ++V  G+  Q+L  EYSKH+ + PI+A
Sbjct: 123 VDGAILQGSCSDRESFDPSVDPKVFQKMNEDAWELVQNGKKDQLLSSEYSKHIIDTPITA 182

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCSLM+ GGDDDYFSSD + E  + TFGKISKPFLIA+S  D++VPK IDK KLL+ W
Sbjct: 183 YRWCSLMIKGGDDDYFSSDLSDETFKTTFGKISKPFLIAYSGADEFVPKTIDKQKLLQRW 242

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           +  SN  YWSKNSGL++GASH V+  + QQ L   + +F+ EF L
Sbjct: 243 ECVSNAKYWSKNSGLVEGASHFVEKPKPQQILFKKIQSFIREFSL 287

>KNAG0J01630 Chr10 (299901..300767) [867 bp, 288 aa] {ON} Anc_8.662
          Length = 288

 Score =  267 bits (683), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 128/225 (56%), Positives = 165/225 (73%), Gaps = 1/225 (0%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           +TSSF GWG++SL  D+ E++ LV+YLRSE+GGSR K+V+ GHSTGSQ+ IHYLL YG++
Sbjct: 64  LTSSFNGWGVASLRTDVEEMKELVDYLRSEEGGSRKKIVIMGHSTGSQDVIHYLLTYGDS 123

Query: 61  VDGGILQASASDREAYTMTIGKDKER-LDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           V GGILQAS SDREA+   + K   + L   A+K+   G + Q+LP EYSK+VF  PI+A
Sbjct: 124 VQGGILQASVSDREAFGTEVPKKTLKDLTARAKKLCEAGSSSQLLPAEYSKYVFGTPITA 183

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCSL   GGDDDYFSSD + E +++TFG+I KPFLIA+SE D++VP  +DKA L+R  
Sbjct: 184 YRWCSLFALGGDDDYFSSDLSIEQIKQTFGRIDKPFLIAYSELDEFVPAPVDKAGLIRTR 243

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           +  SNP  WSK SGLIKGA H V    SQ +L  M++ F  EF+L
Sbjct: 244 QSQSNPQVWSKASGLIKGAGHNVAQHSSQLYLFDMISQFFHEFNL 288

>TBLA0B03910 Chr2 complement(896056..896928) [873 bp, 290 aa] {ON}
           Anc_8.662
          Length = 290

 Score =  256 bits (653), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 168/225 (74%), Gaps = 1/225 (0%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           +TSSFKG+G+SSLD+DI+E++ L +YL+SE+GGSR+K+++ GHSTG+Q+ +HYLL+  + 
Sbjct: 64  LTSSFKGFGISSLDRDIQELKELTKYLKSEEGGSREKIIIMGHSTGAQDVMHYLLHNPKH 123

Query: 61  VDGGILQASASDREAYTMTIGKDK-ERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           +D GILQ S SDRE    T  KD  E+L+  A  MV  G+   +LP EYSK + N P++A
Sbjct: 124 IDAGILQGSCSDREGLYETFDKDMLEKLNKKAIDMVQNGQKNDLLPSEYSKLMINTPLTA 183

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCSL+L GGDDDYFSSD   E L+ +FGK++KPFLIA+SE D++VP+ ++K  LL+ W
Sbjct: 184 YRWCSLVLKGGDDDYFSSDLPIETLKNSFGKVNKPFLIAYSEEDEFVPESVNKLNLLKKW 243

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           +  S+  YWSKNSGL++GASH V+  +SQ  L  MV  F+ EF L
Sbjct: 244 ESISDSKYWSKNSGLVRGASHFVEKPDSQAHLFEMVIGFITEFSL 288

>NDAI0E01230 Chr5 complement(243135..243998) [864 bp, 287 aa] {ON}
           Anc_8.662
          Length = 287

 Score =  253 bits (646), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 119/225 (52%), Positives = 168/225 (74%), Gaps = 1/225 (0%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           M+SSFKG+G+SSLD+DI+EI+ LV+YL+SEKGGSR+K+++ GHSTG+Q+ +H+LL+Y + 
Sbjct: 63  MSSSFKGFGISSLDKDIKEIKELVKYLKSEKGGSREKIIIMGHSTGAQDVMHFLLHYPDL 122

Query: 61  VDGGILQASASDREAYTMTIG-KDKERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           VD GILQ S SDRE++  ++  K  + L+  A  MV +G+  ++L  ++SKH+ + PI+A
Sbjct: 123 VDAGILQGSCSDRESFDPSVDPKILKELNQFALNMVKQGKGDELLGSQFSKHIIDTPITA 182

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCSL   GGDDDYFSSD   E  + TFGKI KPFL+A+S  DQ+VP+ +DK  LL+ W
Sbjct: 183 YRWCSLFTRGGDDDYFSSDLDDETFKGTFGKIRKPFLVAYSGKDQFVPESVDKLALLKRW 242

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           +  S+P YWSKN+G+++GASH V+  E Q  L  M+ +F  EF L
Sbjct: 243 ENVSDPKYWSKNTGIVEGASHFVEDHEPQLQLFQMITSFAKEFSL 287

>ZYRO0F07040g Chr6 (574536..575384) [849 bp, 282 aa] {ON} conserved
           hypothetical protein
          Length = 282

 Score =  253 bits (645), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 160/222 (72%), Gaps = 3/222 (1%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           M SS+ GWG  SLD D+ +I+ LVEYLRS +GGSR+ +++ G STGSQ+ +HYLL + ++
Sbjct: 62  MRSSYIGWGTGSLDADVEDIKKLVEYLRSPEGGSRETIIIMGFSTGSQDVMHYLLRHSDS 121

Query: 61  VDGGILQASASDREAYTMTIGKDKERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISAY 120
           ++G I  A  SDRE       KD ERL+  A+++V  G+  +ILP EY+ +VFN PI+AY
Sbjct: 122 IEGCIFSAPVSDREGQDP---KDLERLNPKAQELVANGQGNEILPREYANYVFNTPITAY 178

Query: 121 RWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGWK 180
           RWCSL + GGDDDYFS+D + EV   TFGK+ KPFL+AF+E D+YVPK ++K + ++ W+
Sbjct: 179 RWCSLHVKGGDDDYFSTDLSQEVFASTFGKLDKPFLVAFNELDEYVPKNVNKPEHIKRWQ 238

Query: 181 ECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEF 222
             SNP YWSKNSG++KG++H V   E+QQ L   V  FL+EF
Sbjct: 239 SVSNPKYWSKNSGIVKGSTHTVAQPEAQQDLFQRVLGFLEEF 280

>Kpol_1072.23 s1072 complement(51607..52473) [867 bp, 288 aa] {ON}
           complement(51607..52473) [867 nt, 289 aa]
          Length = 288

 Score =  251 bits (640), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 163/225 (72%), Gaps = 1/225 (0%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           M SSFKG+G+SSL +DI++I+ LV+YLRSE+GG R+KV+L GHSTGSQ+ + YLL YG T
Sbjct: 63  MKSSFKGFGISSLSEDIQQIKELVDYLRSEQGGKREKVLLLGHSTGSQDAMSYLLKYGAT 122

Query: 61  VDGGILQASASDREAYTMTIGKDKE-RLDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           VD GILQAS SDREA+   +  D+  R++  A  +V   +  +IL   Y+  +   P++A
Sbjct: 123 VDAGILQASVSDREAFGNEMSTDELLRMNEKAYSLVCDNKPNEILDSSYANCLGEVPVTA 182

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCSLM+ GGDDDYFSSD + E L +TFG +  PFLIA+SE D++VP  ++K +L+  W
Sbjct: 183 YRWCSLMIKGGDDDYFSSDLSMESLRETFGSLRTPFLIAYSEEDEFVPDHVNKQELILKW 242

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           K CSN  YWS+ SGLIKGASH V  +ESQ+ L   +  F+DEF+L
Sbjct: 243 KNCSNSEYWSQYSGLIKGASHTVRQEESQKLLYSNIIRFIDEFNL 287

>KAFR0H02470 Chr8 (472142..473017) [876 bp, 291 aa] {ON} Anc_8.662
          Length = 291

 Score =  247 bits (631), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 156/228 (68%), Gaps = 5/228 (2%)

Query: 2   TSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGETV 61
           TSSFKGWG SSL QDI+EI  L+ +L+SEKGG RDK++L GHSTGSQ+ + YLLN  +  
Sbjct: 64  TSSFKGWGTSSLQQDIKEIAQLIRFLKSEKGGKRDKIMLIGHSTGSQDVMTYLLNEDKYK 123

Query: 62  D----GGILQASASDREAYTMTIGKDK-ERLDIGARKMVLKGEAGQILPLEYSKHVFNAP 116
           D      ILQ SASDREA  M    +    L+    K++ +G+  ++LP E+S +VF  P
Sbjct: 124 DCEIVAAILQGSASDREAMRMEYDDETLSNLNKRVEKLIAEGKKDELLPTEFSNYVFGVP 183

Query: 117 ISAYRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLL 176
           I+AYRW S+M PGGDDDYFSSD     L  TFGKI KPFLIA+S  D +VP  +DKA ++
Sbjct: 184 ITAYRWWSIMCPGGDDDYFSSDLDENTLRSTFGKIKKPFLIAYSGKDNFVPDYVDKAAVI 243

Query: 177 RGWKECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
             W+  +NP +WSKNSGL++GA H V   +SQQFL  M+  F++EF L
Sbjct: 244 EKWRSIANPQFWSKNSGLVEGADHFVTQSDSQQFLYSMIKAFMEEFDL 291

>TDEL0A06080 Chr1 (1067208..1068074) [867 bp, 288 aa] {ON} Anc_8.662
          Length = 288

 Score =  244 bits (623), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 161/225 (71%), Gaps = 1/225 (0%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           +TSS+KGWG +SLD D++EI+ L+ +L+S KGG+R+K+++ G STGSQ+ IHYLL + +T
Sbjct: 64  LTSSYKGWGTASLDTDVKEIKKLINFLKSPKGGNREKIIIMGRSTGSQDVIHYLLRHPDT 123

Query: 61  VDGGILQASASDREAYTMTIGKDK-ERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           VD GIL A+ SDRE     +      RL+  A K++  G   Q+L  EY K+VFN PI+A
Sbjct: 124 VDAGILDAAVSDREGLQEDVDPQIINRLNGHALKLIQDGHPNQLLGNEYGKYVFNTPITA 183

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCSLM+PGGDDDYFSSD + + +++TFG ISKPFL+  +E D++VP+ IDK  LL+ W
Sbjct: 184 YRWCSLMVPGGDDDYFSSDLSDDHVKRTFGSISKPFLVIENEKDEFVPERIDKQALLQRW 243

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEFHL 224
           +  S+P YWSKNSG++K ASH V    +Q  L  +V  F+ EF L
Sbjct: 244 ESFSHPKYWSKNSGVLKEASHLVTEPAAQLRLRELVKMFIREFSL 288

>KLLA0F11462g Chr6 complement(1051409..1052272) [864 bp, 287 aa]
           {ON} conserved hypothetical protein
          Length = 287

 Score =  175 bits (444), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 148/222 (66%), Gaps = 4/222 (1%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           +TSS+ G+G  SL +D  EI +LV+YL+ +    R+ V+L GHSTGSQNTIHYLL++   
Sbjct: 66  ITSSYIGFGTGSLKRDDEEIDSLVDYLKKD---GREMVLLMGHSTGSQNTIHYLLHHPGK 122

Query: 61  VDGGILQASASDREAYTMTIGKDK-ERLDIGARKMVLKGEAGQILPLEYSKHVFNAPISA 119
           + GGILQA+ SDRE  +  I +    +L+  A+ +V  G+  ++L  ++++ + + PI+A
Sbjct: 123 ISGGILQAAVSDREFGSTVIPQPLLSKLNAEAKALVDAGKPEELLSSKHAECMLDTPITA 182

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           YRWCSL+LP GDDD+FSSD + E LE TFG I  PFLIA SE D+  P      +LL+ W
Sbjct: 183 YRWCSLLLPDGDDDFFSSDLSDEKLEITFGYIKDPFLIALSEKDECYPNNGKPLELLQRW 242

Query: 180 KECSNPSYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDE 221
           +   +   WSKNSGLIKGA+H V  ++SQ+ L  MV  F+ E
Sbjct: 243 QCFVDKKLWSKNSGLIKGATHAVPEEDSQKELFKMVTGFIKE 284

>Suva_8.213 Chr8 complement(388221..388529) [309 bp, 102 aa] {ON}
           YBL015W (REAL)
          Length = 102

 Score =  101 bits (251), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (64%)

Query: 126 MLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGWKECSNP 185
           M PGGDDDYFSSD     L  +FG++  P L+A+SE DQ+VP  +DK  LL  W+  + P
Sbjct: 1   MEPGGDDDYFSSDLPPAALAASFGRLKTPLLVAYSENDQFVPSWVDKHALLARWRAATPP 60

Query: 186 SYWSKNSGLIKGASHKVDSDESQQFLCLMVNNFLDEF 222
           + WS++S LIKGA+H V    +Q+ L  M+  FL +F
Sbjct: 61  AVWSEHSDLIKGATHAVPEPAAQRRLFEMLVRFLTDF 97

>Suva_8.214 Chr8 complement(388652..389083) [432 bp, 143 aa] {ON}
           (REAL)
          Length = 143

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 48/60 (80%)

Query: 1   MTSSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGET 60
           +TSSF G+G +SLD+D+ E++ LV++L+  +GG R+ +VL GHSTGSQ+ +HYLL +G +
Sbjct: 64  LTSSFLGFGTASLDKDVEELKLLVDFLKGAQGGRRETIVLMGHSTGSQDVMHYLLRHGHS 123

>NDAI0G03800 Chr7 (910625..911506) [882 bp, 293 aa] {ON} Anc_3.21
           YNL320W
          Length = 293

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 72/168 (42%), Gaps = 21/168 (12%)

Query: 4   SFKGWGLSS---LDQDIR-EIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGE 59
           S++G+G+S     ++ ++ +   ++EYL+++      K++L+G S G  N I+    Y  
Sbjct: 109 SYRGYGISQGQPTEEGLKKDADCVIEYLKNDPFYKTKKLILYGRSLGGANAIYIASKYHN 168

Query: 60  TVDGGILQ---ASASDREAYTMTIGK--------------DKERLDIGARKMVLKGEAGQ 102
            V G IL+    +      Y + + K              D  ++D     + L G   +
Sbjct: 169 FVKGIILENTFLTVRKIIPYILPVSKYFSFFCKDIWNSERDIVQIDQDVPFLFLSGLKDK 228

Query: 103 ILPLEYSKHVFNAPISAYRWCSLMLPGGDDDYFSSDSTSEVLEKTFGK 150
           I+P    K +++   S YR       GG +D    D   E++E+   K
Sbjct: 229 IVPPSQMKRLYDLCPSRYRELFEFNEGGHNDTIIQDGYWEIIEEFLKK 276

>TBLA0A07700 Chr1 (1903808..1904665) [858 bp, 285 aa] {ON} Anc_3.21
           YNL320W
          Length = 285

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 14/75 (18%)

Query: 4   SFKGWGLSS---------LDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           S++G+G S          LD D      ++ YL ++    + K+VLFG S G  N I+  
Sbjct: 114 SYRGYGHSEGSPSETGLKLDAD-----RVISYLSTDSFHKQKKIVLFGRSLGGANAIYIA 168

Query: 55  LNYGETVDGGILQAS 69
             Y + +DG IL+ +
Sbjct: 169 SKYPQLIDGVILENT 183

>KNAG0K02530 Chr11 complement(502906..503760) [855 bp, 284 aa] {ON}
           Anc_3.21 YNL320W
          Length = 284

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 14/73 (19%)

Query: 4   SFKGWGLS---------SLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           S++G+GLS          +D D       + YL + +   + K+VL+G S G  N I+  
Sbjct: 113 SYRGYGLSEGSPSEAGLKMDAD-----RAISYLATNEFHKKRKLVLYGRSLGGANAIYIA 167

Query: 55  LNYGETVDGGILQ 67
             Y   +DG IL+
Sbjct: 168 SKYPSLIDGVILE 180

>KNAG0D00600 Chr4 complement(86399..88453) [2055 bp, 684 aa] {ON}
           Anc_6.298 YNR008W
          Length = 684

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 11/77 (14%)

Query: 1   MTSSFKGWGLSSLDQDIRE-----IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLL 55
           M ++   W L+ LD ++R+     +++ +E L    G   +KVVL GHS GSQ  I Y L
Sbjct: 301 MVTAAYDWRLAYLDLEVRDRYFTKLKSQIEVLYDLSG---EKVVLVGHSMGSQ-VIFYFL 356

Query: 56  NYGETVDGGILQASASD 72
            + E    G L  +A+D
Sbjct: 357 QWVEA--KGKLYGNAND 371

>KAFR0A08530 Chr1 complement(1710000..1710839) [840 bp, 279 aa] {ON}
           Anc_3.21 YNL320W
          Length = 279

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 18  REIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGETVDGGILQ 67
           R+   ++ YL +     + K+VL+G S G  N I+    +G  VDG IL+
Sbjct: 126 RDADRVLSYLSTNDFHKKRKLVLYGRSLGGANAIYIASKFGNLVDGVILE 175

>NCAS0G00980 Chr7 complement(168524..170476) [1953 bp, 650 aa] {ON}
           Anc_6.298 YNR008W
          Length = 650

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MTSSFKGWGLSSLDQDIRE--IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           MT++   W L+ LD ++R+     L E +      +++KVVL GHS GSQ   ++L
Sbjct: 269 MTTASYDWRLAYLDLELRDRYFSKLKEQIEMFHELTKEKVVLVGHSMGSQIVFYFL 324

>YNL187W Chr14 (287994..289067) [1074 bp, 357 aa] {ON}  SWT21Protein
           involved in mRNA splicing; contains a consensus nuclear
           export signal (NES) sequence similar to the consensus
           sequence recognized by Crm1p; interacts genetically with
           Prp40p and Tgs1p; contains WD40 repeats
          Length = 357

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 55  LNYGETVDGGILQASASDREAYTMTIGKDKERLDIGARKMVLKGEAGQILPLEYSKHVFN 114
           LNY  TV GGI+Q   SD   Y   + ++ + + I  R+  L+ E   +L L +  H  +
Sbjct: 207 LNYTRTVAGGIVQILTSDNGRYVYVVRRNSDAISIYDRRN-LQHEL-NVLRLPFRIHHNS 264

Query: 115 APISAY 120
           A + AY
Sbjct: 265 AKLKAY 270

>Ecym_2023 Chr2 (34955..35812) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii ADL187W
          Length = 285

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 14/73 (19%)

Query: 4   SFKGWGLSS---------LDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           S++G+G S          LD D      ++E++  +   S  K+VL+G S G  N I+  
Sbjct: 114 SYRGYGYSQGSPSEQGLKLDAD-----CVMEFMSHDDFYSAQKIVLYGRSLGGANAIYIA 168

Query: 55  LNYGETVDGGILQ 67
             YG   D  IL+
Sbjct: 169 RKYGSLCDAMILE 181

>ZYRO0C03212g Chr3 complement(249377..250234) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P42840 Saccharomyces
           cerevisiae YNL320W Hypothetical ORF
          Length = 285

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 4   SFKGWGLSSLDQDIREIR----TLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGE 59
           S++G+G S    + + ++    +++E+L S K     ++VL+G S G  N I+    Y +
Sbjct: 114 SYRGYGHSEGSPNEKGLKLDADSVMEFLSSSKFHKSKRLVLYGRSLGGANAIYIASKYSQ 173

Query: 60  TVDGGILQ 67
             D  IL+
Sbjct: 174 LCDAVILE 181

>KLTH0F19360g Chr6 complement(1568441..1569286) [846 bp, 281 aa]
           {ON} similar to uniprot|P42840 Saccharomyces cerevisiae
           YNL320W Hypothetical ORF
          Length = 281

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 10/71 (14%)

Query: 4   SFKGWGLSS-------LDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLN 56
           S++G+G S        L QD   +   + +L+ +      K++L+G S G  N I+   N
Sbjct: 112 SYRGYGFSQGSPSEKGLKQDADAV---MAFLQQDSFYKTQKLLLYGRSLGGANAIYIAGN 168

Query: 57  YGETVDGGILQ 67
           Y    DG IL+
Sbjct: 169 YSHACDGVILE 179

>ADL187W Chr4 (368411..369268) [858 bp, 285 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL320W
          Length = 285

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 14/75 (18%)

Query: 4   SFKGWGLSS---------LDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           S++G+G S          LD D      ++EY+R ++     ++VL+G S G  N ++  
Sbjct: 114 SYRGYGYSEGEPSEQGLKLDAD-----RVMEYMRKDEFYRTQRLVLYGRSLGGANALYIA 168

Query: 55  LNYGETVDGGILQAS 69
             YG   D  IL+ +
Sbjct: 169 RKYGAQCDALILENT 183

>TDEL0A07120 Chr1 (1243318..1245324) [2007 bp, 668 aa] {ON}
           Anc_6.298 YNR008W
          Length = 668

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 1   MTSSFKGWGLSSLDQDIRE--IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYG 58
           M ++   W L+ LD +IR+     L + +    G S +KV L GHS GSQ  I Y L + 
Sbjct: 285 MFTAAYDWRLAYLDLEIRDRYFTKLKQQVELTYGLSGEKVCLVGHSMGSQ-IIFYFLKWA 343

Query: 59  ET 60
           E 
Sbjct: 344 EA 345

>Kpol_483.7 s483 complement(13693..15609) [1917 bp, 638 aa] {ON}
           complement(13693..15609) [1917 nt, 639 aa]
          Length = 638

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 54  LLNYGETVDGGILQASASDREAYTMTIGKDKERLDIGARKMVLKGEAGQILPLEYSKHVF 113
           LL YGE V+  I      +  ++  T  K+ ++++     +   G   QI+PLE + H  
Sbjct: 220 LLRYGEIVNSWI---PLDEMLSFINTDSKEFDKINNNCWVLSCYGSKEQIIPLESASHFA 276

Query: 114 NAPISAYRWCSLMLPGGDDDYF 135
           N  I   R C  ++ G D +++
Sbjct: 277 NTFIG--RHCLQIIDGADHNFY 296

>CAGL0D03256g Chr4 complement(336625..338250) [1626 bp, 541 aa] {ON}
           similar to uniprot|Q07950 Saccharomyces cerevisiae
           YLR020c or uniprot|Q07804 Saccharomyces cerevisiae
           YLL012w
          Length = 541

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 5   FKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGETVD 62
           F  W     D    +IR LVE ++S  G S  K+ L GHS G+  ++  L+N  E  D
Sbjct: 245 FNKWDWDIKDFVKYDIRALVEQVKSRTGFS--KITLIGHSQGTTQSLLGLINGPELYD 300

>KNAG0A01220 Chr1 (16327..17253) [927 bp, 308 aa] {ON} Anc_3.21
           YNL320W
          Length = 308

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 4   SFKGWGLSS---LDQDI-REIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGE 59
           S++G+G SS    ++ I R+   +++Y+  +   S+  +VL+G S G    I+    Y E
Sbjct: 134 SYRGYGKSSGSPTEEGIKRDSDCVIDYITKDPFHSKKNLVLYGRSLGGAVAIYIAAKYPE 193

Query: 60  TVDGGILQ 67
            V   IL+
Sbjct: 194 LVSAVILE 201

>Smik_14.12 Chr14 (22192..23046) [855 bp, 284 aa] {ON} YNL320W
           (REAL)
          Length = 284

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 14/75 (18%)

Query: 4   SFKGWGLSS---------LDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           S++G+G S          LD D     +++ YL ++   ++ K+VL+G S G  N ++  
Sbjct: 113 SYRGYGNSEGSPSEDGLKLDAD-----SVISYLSTDPFHAKRKLVLYGRSLGGANALYIA 167

Query: 55  LNYGETVDGGILQAS 69
             + +  DG IL+ +
Sbjct: 168 SKFRDLCDGVILENT 182

>Kwal_55.22085 s55 complement(1102729..1103610) [882 bp, 293 aa]
           {ON} YNL320W - Hypothetical ORF [contig 124] FULL
          Length = 293

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 4   SFKGWGLSSLDQDIREIRT----LVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGE 59
           S++G+GLS      + +++    ++ +L+ +      K++L+G S G  N I+    Y  
Sbjct: 124 SYRGYGLSQGSPSEKGLKSDADAVMTFLQHDSFFKSQKLLLYGRSLGGANAIYIARRYPH 183

Query: 60  TVDGGILQ 67
             DG IL+
Sbjct: 184 LCDGLILE 191

>KLLA0F06380g Chr6 complement(618296..620266) [1971 bp, 656 aa] {ON}
           similar to uniprot|P40345 Saccharomyces cerevisiae
           YNR008W LRO1 Acyltransferase that catalyzes
           diacylglycerol esterification one of several
           acyltransferases that contribute to triglyceride
           synthesis putative homolog of human lecithin cholesterol
           acyltransferase
          Length = 656

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 8/59 (13%)

Query: 1   MTSSFKGWGLSSLDQDIRE-----IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           M ++   W LS LD ++R+     ++  +E L+ E+ G  +K VL GHS GSQ   ++L
Sbjct: 266 MVTAAYDWRLSYLDLEVRDRYFTKLKMQIE-LQLEQTG--EKSVLVGHSMGSQVVFYFL 321

>KAFR0F00910 Chr6 complement(170172..172142) [1971 bp, 656 aa] {ON}
           Anc_6.298 YNR008W
          Length = 656

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 1   MTSSFKGWGLSSLDQDIRE-----IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           M ++   W L+ LD ++R+     ++  VE L   +    +KVVL GHS GSQ   ++L
Sbjct: 271 MITAAYDWRLAYLDLEVRDRYFTKLKQQVELLY--ELNDNEKVVLVGHSMGSQIVFYFL 327

>Ecym_2120 Chr2 complement(223032..224954) [1923 bp, 640 aa] {ON}
           similar to Ashbya gossypii AFL179C
          Length = 640

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 1   MTSSFKGWGLSSLDQDIRE--IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYG 58
           MT++   W L+ LD ++R+     L  ++      + +K VL GHS G+Q  I Y L + 
Sbjct: 257 MTTAAYDWRLAYLDLELRDQYFSKLKSHIEITYKATGEKSVLIGHSMGAQ-VIFYFLKWV 315

Query: 59  ET 60
           E 
Sbjct: 316 EA 317

>ZYRO0C05478g Chr3 complement(419816..421762) [1947 bp, 648 aa] {ON}
           similar to uniprot|P40345 Saccharomyces cerevisiae
           YNR008W LRO1 Acyltransferase that catalyzes
           diacylglycerol esterification one of several
           acyltransferases that contribute to triglyceride
           synthesis putative homolog of human lecithin cholesterol
           acyltransferase
          Length = 648

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 1   MTSSFKGWGLSSLDQDIRE-----IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLL 55
           MT++   W L+ LD + R+     ++  +E +    G   +KV L GHS GSQ  + Y L
Sbjct: 265 MTTAAYDWRLAYLDLERRDRFFTKLKQQIELIHELSG---EKVCLVGHSMGSQ-IVFYFL 320

Query: 56  NYGET 60
            + E 
Sbjct: 321 KWAEA 325

>TPHA0A00370 Chr1 (54913..55788) [876 bp, 291 aa] {ON} Anc_3.21
           YNL320W
          Length = 291

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 4   SFKGWGLSSLDQDIREIR----TLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGE 59
           S++G+G S+     + ++    T +E+L ++      K+VL+G S G  N I+    Y  
Sbjct: 120 SYRGYGNSTGSPTEKGLKIDADTAIEHLINDDFHKDKKLVLYGRSLGGANAIYIASKYKN 179

Query: 60  TVDGGILQAS 69
            VD  +L+ +
Sbjct: 180 IVDTVVLENT 189

>NCAS0E01340 Chr5 (260112..260966) [855 bp, 284 aa] {ON} Anc_3.21
           YNL320W
          Length = 284

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 4   SFKGWGLSSLDQD----IREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGE 59
           S++G+G S    +     ++   ++EYL       ++K+VL+G S G  N I+    + +
Sbjct: 113 SYRGYGKSQGSPNEAGLKKDADCVMEYLSKSSFHRKNKLVLYGRSLGGANAIYIASKFPK 172

Query: 60  TVDGGILQAS 69
             D  IL+ +
Sbjct: 173 ICDAVILENT 182

>CAGL0I05786g Chr9 complement(547982..550024) [2043 bp, 680 aa] {ON}
           some similarities with uniprot|P40345 Saccharomyces
           cerevisiae YNR008w LRO1
          Length = 680

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 1   MTSSFKGWGLSSLDQDIRE-----IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           MT++   W L+ LD + R+     +++ VE      G   +KV L GHS GSQ   ++L
Sbjct: 295 MTTASYDWRLAYLDLERRDKYFSKLKSQVELFYQSTG---EKVCLVGHSMGSQVVFYFL 350

>TBLA0A07740 Chr1 complement(1910240..1911706) [1467 bp, 488 aa]
           {ON} Anc_3.34 YOL132W
          Length = 488

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 12/62 (19%)

Query: 117 ISAYRWC--SLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAK 174
           +++Y+WC    M   G D           L +T+   +KP + +   C+Q +P++ D+ K
Sbjct: 233 VNSYQWCGTQTMESSGYDK----------LIRTYSSYTKPIIFSEFGCNQVLPRQFDEVK 282

Query: 175 LL 176
            L
Sbjct: 283 AL 284

>Kpol_1036.63 s1036 (174305..174967) [663 bp, 220 aa] {ON}
           (174305..174967) [663 nt, 221 aa]
          Length = 220

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 120 YRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLIAFSECDQYVPKEIDKAKLLRGW 179
           Y+W  L L GG+D       T +VL+     +SK  +     C +  P+++ +   L+GW
Sbjct: 141 YKWLDLALDGGEDGMV---VTQKVLDNLDSILSKNGVAYILFCARNHPEQVAEEMRLKGW 197

Query: 180 K 180
           K
Sbjct: 198 K 198

>Kpol_1038.19 s1038 (42740..43603) [864 bp, 287 aa] {ON}
           (42740..43603) [864 nt, 288 aa]
          Length = 287

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 4   SFKGWGLS--SLDQDIREIRT--LVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGE 59
           S++G+G S  S  +D  +I    ++ YL +       K++L+G S G  N I+    + +
Sbjct: 115 SYRGYGFSEGSPSEDGLKIDADRVMSYLATSSFHKNKKLILYGRSLGGANAIYIASKFSQ 174

Query: 60  TVDGGILQAS 69
             D  IL+ +
Sbjct: 175 LCDAVILENT 184

>NDAI0A07980 Chr1 complement(1833996..1836050) [2055 bp, 684 aa]
           {ON} 
          Length = 684

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 3/39 (7%)

Query: 119 AYRWCSLMLPGGDDDYFSSDSTSEVLEKTFGKISKPFLI 157
           AY W  L +  GDDD    DS SE LEK      KP LI
Sbjct: 209 AYGWEVLTVEKGDDDL---DSFSEALEKAKANKEKPTLI 244

>Suva_14.361 Chr14 (621887..623863) [1977 bp, 658 aa] {ON} YNR008W
           (REAL)
          Length = 658

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 1   MTSSFKGWGLSSLDQDIRE-----IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLL 55
           MTS+   W L+ LD + R+     ++  +E      G   +KV L GHS GSQ  I Y L
Sbjct: 276 MTSAAYDWRLAYLDLERRDRYFTKLKDQIELFYQLNG---EKVCLIGHSMGSQ-IIFYFL 331

Query: 56  NYGET 60
            + E 
Sbjct: 332 KWVEA 336

>YNR008W Chr14 (640396..642381) [1986 bp, 661 aa] {ON}
           LRO1Acyltransferase that catalyzes diacylglycerol
           esterification; one of several acyltransferases that
           contribute to triglyceride synthesis; putative homolog
           of human lecithin cholesterol acyltransferase
          Length = 661

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 1   MTSSFKGWGLSSLDQDIRE--IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYG 58
           MTS+   W L+ LD + R+     L E +      S +KV L GHS GSQ  I Y + + 
Sbjct: 279 MTSAAYDWRLAYLDLERRDRYFTKLKEQIELFHQLSGEKVCLIGHSMGSQ-IIFYFMKWV 337

Query: 59  ET 60
           E 
Sbjct: 338 EA 339

>Smik_14.338 Chr14 (598485..600470) [1986 bp, 661 aa] {ON} YNR008W
           (REAL)
          Length = 661

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 1   MTSSFKGWGLSSLDQDIRE-----IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLL 55
           MTS+   W L+ LD + R+     ++  +E      G   +KV L GHS GSQ  I Y +
Sbjct: 279 MTSAAYDWRLAYLDLERRDRYFTKLKEQIELFHQLNG---EKVCLIGHSMGSQ-IIFYFM 334

Query: 56  NYGET 60
            + E 
Sbjct: 335 KWVEA 339

>TPHA0N00660 Chr14 (145600..147162) [1563 bp, 520 aa] {ON} Anc_5.200
           YLR020C
          Length = 520

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 3   SSFKGWGLSSLDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYGETVD 62
           SS K W          +++ LV  + S  G   +K+ L GHS G+  T + L+N+ E  D
Sbjct: 243 SSDKLWDWDIKHMAFLDLKCLVTNVLSNTGA--EKLTLIGHSQGTTQTFYSLINHNEFND 300

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 14  DQDIREIRTLVEYLRSEKGGSRDK---VVLFGHSTGSQNTIHYLLNYGETVDGGILQASA 70
           D+D +   TL E+LR++   SR      V+ G     +N   Y+L+     +GG+L+ +A
Sbjct: 635 DKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQKKNRRKYILDQSLEEEGGLLKNTA 694

Query: 71  SDREAYTMTI 80
             R  Y   I
Sbjct: 695 FFRNLYFYVI 704

>YNL320W Chr14 (37700..38554) [855 bp, 284 aa] {ON} Putative protein
           of unknown function; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 284

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 14/75 (18%)

Query: 4   SFKGWGLSS---------LDQDIREIRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYL 54
           S++G+G S          LD D      ++ +L ++   S+ K+VL+G S G  N ++  
Sbjct: 113 SYRGYGNSEGSPSEKGLKLDAD-----CVISHLSTDSFHSKRKLVLYGRSLGGANALYIA 167

Query: 55  LNYGETVDGGILQAS 69
             + +  DG IL+ +
Sbjct: 168 SKFRDLCDGVILENT 182

>Skud_14.339 Chr14 (608465..610450) [1986 bp, 661 aa] {ON} YNR008W
           (REAL)
          Length = 661

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 1   MTSSFKGWGLSSLDQDIRE--IRTLVEYLRSEKGGSRDKVVLFGHSTGSQNTIHYLLNYG 58
           MTS+   W L+ LD + R+     L E +      S +KV L GHS GSQ  I Y + + 
Sbjct: 279 MTSAAYDWRLAYLDLEKRDRYFTKLKEEIELFHQLSGEKVCLIGHSMGSQ-IIFYFMKWV 337

Query: 59  ET 60
           E 
Sbjct: 338 EA 339

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,599,807
Number of extensions: 1055039
Number of successful extensions: 2660
Number of sequences better than 10.0: 56
Number of HSP's gapped: 2671
Number of HSP's successfully gapped: 56
Length of query: 224
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 118
Effective length of database: 41,326,803
Effective search space: 4876562754
Effective search space used: 4876562754
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)