Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G08910g5.348ON50550524330.0
Kwal_34.159895.348ON5064327141e-87
KLTH0H14784g5.348ON5144326052e-71
Ecym_81855.348ON4713704204e-45
AGR348W5.348ON5423234079e-43
Suva_2.4865.348ON4154253674e-38
Skud_4.5835.348ON4153803534e-36
YDR317W (HIM1)5.348ON4143803525e-36
Smik_4.5765.348ON4154243472e-35
TDEL0E027905.348ON4112463368e-34
ZYRO0F00550g5.348ON4153753332e-33
CAGL0H07161g5.348ON4243943298e-33
Kpol_1051.45.348ON4263763122e-30
KAFR0C018805.348ON3452732782e-26
TPHA0D020605.348ON4962742433e-21
KLLA0B10120g5.348ON3482522182e-18
TBLA0A031005.348ON3721931862e-14
TBLA0A105007.148ON2371041212e-06
Kwal_47.188627.148ON2241011077e-05
KLTH0H00264g7.148ON222127998e-04
ZYRO0D09548g7.148ON225147970.002
TBLA0F033107.148ON161123930.003
Ecym_44797.148ON224105950.003
NCAS0E02080singletonON22579940.004
ADR005W7.148ON224100920.007
TPHA0L007607.148ON226169920.007
NCAS0E020907.148ON225114860.034
KAFR0G027507.148ON225119860.034
YER004W (FMP52)7.148ON23177860.042
KNAG0L00930singletonON229148840.066
SAKL0C11550g3.218ON68667860.071
KNAG0L00925singletonON228149820.12
Suva_5.917.148ON22977820.13
Kpol_312.97.148ON22178800.18
NDAI0E036407.148ON225163810.18
CAGL0H09768g7.148ON23374800.24
Skud_5.1037.148ON22777780.37
Smik_5.1187.148ON23174780.38
TDEL0H031107.148ON22474780.40
KLLA0D13684g7.148ON22480780.41
SAKL0C12254g3.66ON27293770.53
KLTH0B00352gsingletonON93482770.91
TDEL0E00190singletonON69771770.95
TDEL0E001503.218ON70371760.97
TDEL0G04910singletonON70266751.6
Skud_16.1768.591ON24989713.2
KLTH0A01958g3.218ON68868713.9
NDAI0A072803.218ON69371713.9
KLTH0G04510g5.560ON62866705.6
KNAG0B060004.236ON92163706.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G08910g
         (505 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   941   0.0  
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   279   1e-87
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   237   2e-71
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   166   4e-45
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   161   9e-43
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   145   4e-38
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   140   4e-36
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   140   5e-36
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   138   2e-35
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   134   8e-34
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   132   2e-33
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   131   8e-33
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   124   2e-30
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...   111   2e-26
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...    98   3e-21
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...    89   2e-18
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...    76   2e-14
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    51   2e-06
Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa] ...    46   7e-05
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    43   8e-04
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    42   0.002
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    40   0.003
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    41   0.003
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      41   0.004
ADR005W Chr4 (712873..713547) [675 bp, 224 aa] {ON} Syntenic hom...    40   0.007
TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.1...    40   0.007
NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON}      38   0.034
KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.14...    38   0.034
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    38   0.042
KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON}               37   0.066
SAKL0C11550g Chr3 complement(1033898..1035958) [2061 bp, 686 aa]...    38   0.071
KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}               36   0.12 
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    36   0.13 
Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..222...    35   0.18 
NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON...    36   0.18 
CAGL0H09768g Chr8 complement(954112..954813) [702 bp, 233 aa] {O...    35   0.24 
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    35   0.37 
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    35   0.38 
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    35   0.40 
KLLA0D13684g Chr4 complement(1180483..1181157) [675 bp, 224 aa] ...    35   0.41 
SAKL0C12254g Chr3 complement(1094427..1095245) [819 bp, 272 aa] ...    34   0.53 
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    34   0.91 
TDEL0E00190 Chr5 (23197..25290) [2094 bp, 697 aa] {ON}                 34   0.95 
TDEL0E00150 Chr5 (13297..15408) [2112 bp, 703 aa] {ON} Anc_3.218...    34   0.97 
TDEL0G04910 Chr7 (908763..910871) [2109 bp, 702 aa] {ON}               33   1.6  
Skud_16.176 Chr16 (320555..321304) [750 bp, 249 aa] {ON} YPL107W...    32   3.2  
KLTH0A01958g Chr1 (172931..174997) [2067 bp, 688 aa] {ON} simila...    32   3.9  
NDAI0A07280 Chr1 (1658165..1660246) [2082 bp, 693 aa] {ON} Anc_3...    32   3.9  
KLTH0G04510g Chr7 (358564..360450) [1887 bp, 628 aa] {ON} simila...    32   5.6  
KNAG0B06000 Chr2 complement(1175060..1177825) [2766 bp, 921 aa] ...    32   6.0  

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  941 bits (2433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/505 (91%), Positives = 460/505 (91%)

Query: 1   MTDASAQDXXXXXXXXXXERIREKRSMLFKNAPDASDVAANDHQHLVEKSPPELPDIEFE 60
           MTDASAQD          ERIREKRSMLFKNAPDASDVAANDHQHLVEKSPPELPDIEFE
Sbjct: 1   MTDASAQDKLYYKKQLLKERIREKRSMLFKNAPDASDVAANDHQHLVEKSPPELPDIEFE 60

Query: 61  QQCGSLTTPXXXXXXXXXXXXXXXXXXXXXXXXAEPWLYLGTTNDVQDKIQMMFEAGDLS 120
           QQCGSLTTP                        AEPWLYLGTTNDVQDKIQMMFEAGDLS
Sbjct: 61  QQCGSLTTPNLLTDSYLLLGTTGLTGGIILNSLAEPWLYLGTTNDVQDKIQMMFEAGDLS 120

Query: 121 SESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLALLEIPSTPEYINDYWEYSIDYKGT 180
           SESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLALLEIPSTPEYINDYWEYSIDYKGT
Sbjct: 121 SESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLALLEIPSTPEYINDYWEYSIDYKGT 180

Query: 181 KYHSKKNNISFGVPTLKFGKLVNSNENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQT 240
           KYHSKKNNISFGVPTLKFGKLVNSNENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQT
Sbjct: 181 KYHSKKNNISFGVPTLKFGKLVNSNENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQT 240

Query: 241 LIISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVS 300
           LIISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVS
Sbjct: 241 LIISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVS 300

Query: 301 ALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSP 360
           ALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSP
Sbjct: 301 ALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSP 360

Query: 361 YFHTKLKLEQDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLSTVCYY 420
           YFHTKLKLEQDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLSTVCYY
Sbjct: 361 YFHTKLKLEQDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLSTVCYY 420

Query: 421 KKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSXXXXXXXXXXXIRTIQ 480
           KKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYS           IRTIQ
Sbjct: 421 KKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSVPVAKVAVVAAIRTIQ 480

Query: 481 KIQNDPESGGIRVQLIKSDELDVMV 505
           KIQNDPESGGIRVQLIKSDELDVMV
Sbjct: 481 KIQNDPESGGIRVQLIKSDELDVMV 505

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  279 bits (714), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 170/432 (39%), Positives = 247/432 (57%), Gaps = 42/432 (9%)

Query: 94  AEPWLYLGTTNDVQDKIQMMFEAGDLSSESNPPNVKRT---FGQILRGEKSIEITKNLFC 150
           A+PW+YL  TND+Q KI  +F   D   E +   ++RT      +L  EKS+E+TKNLFC
Sbjct: 97  AQPWVYLNATNDLQRKISSLFPFSD-QLEKHHHFMRRTRSPLCNLLTKEKSVEVTKNLFC 155

Query: 151 FNRKLALLEIPSTPEYINDYWEYSIDYKGTKYHSKKNNISFGVPTLKFGKLV----NSNE 206
           F R+   LE     + ++  WE+SIDYKG+K    K N+S   P +K G        S+ 
Sbjct: 156 FTRRSVTLE-QICLDGLDASWEHSIDYKGSKMVCSKENLSCEEPFVKRGTTTFFQDASDA 214

Query: 207 NSITNQCQLQQFDYKFEFQR-EDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLH 265
            ++T   QLQ+F Y   +    D   +  R    TL+I L++N+I I+E +S+ WP+LL 
Sbjct: 215 PAVTLTIQLQKFTYHLNYDNSRDVHGETCR---HTLMIQLRVNIILIVEEDSQKWPMLLT 271

Query: 266 STFGDTDTNVALHVQG-QVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLN 324
             FG   +   L V+  + P     P L+++NT+VS+LGS +FE+KK  +SR F DY+LN
Sbjct: 272 RIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSLGSKSFEKKKPKISRHFADYELN 331

Query: 325 FKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPELDELVI 384
             +A  F  + +  G++KK+V+ITSFNN  LSSTS YF +KL LEQDL T++  LD+LV+
Sbjct: 332 MLLAHAFCKDKTR-GLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALDKLVL 390

Query: 385 LRPGPLIGSHT-----------PEFIPGDPPKSTNGLLKPLSTVCYYKKACYDHKRHFLQ 433
           LRPGPL+G+HT           P FIP         + K L     +KK C + K   L+
Sbjct: 391 LRPGPLVGNHTHQLQSPSIIDKPSFIP-------TAMFKVLK----FKKNCIERKLQLLR 439

Query: 434 SVTQVGLKTKMTEVFARLIYRSSCSWMFGYSXXXXXXXXXXXIRTIQKIQNDPESGGIRV 493
            ++QVG++TK++E+ ARL Y+ SCS + G+            IR +      P+S    V
Sbjct: 440 EISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRAV----FSPDSASF-V 494

Query: 494 QLIKSDELDVMV 505
           +LIKSDE++ M 
Sbjct: 495 ELIKSDEIEKMA 506

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  237 bits (605), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 159/432 (36%), Positives = 231/432 (53%), Gaps = 39/432 (9%)

Query: 94  AEPWLYLGTTNDVQDKIQMMFEAGDLSSESNPPNV-----KRTFGQILRGEKSIEITKNL 148
           A+PW+YL  TND+Q K+  ++ A DL   +   N+     K     IL   KSIE+TKNL
Sbjct: 101 AQPWIYLNATNDLQSKVDSLYPA-DLERFTKH-NIFVKKPKSPLCNILVRRKSIEVTKNL 158

Query: 149 FCFNRK-LALLEIPSTPEYINDYWEYSIDYKGTKYHSKKNNISFGVPTLKFGKLVNSNEN 207
           +C  R+ +A+  +P   + ++  WE+++  KG      K  IS      +   +    E 
Sbjct: 159 YCLARRPIAVEGMPL--DGLDASWEHTVRCKGFDLICGKGGISRDCTLERNAAMY---EL 213

Query: 208 SITNQC-------QLQQFDYKFEFQR-EDPSMQNLRTRAQTLIISLKINVIQILEPNSKL 259
           + T+ C       QLQ F +K  ++   DP      T    L++ L INVI +++ +S+ 
Sbjct: 214 ASTHNCPGREIILQLQSFSFKLVYENSRDPHGD---TCGHALMVKLNINVICVIDTDSQR 270

Query: 260 WPLLLHSTFGDTDTNVALHVQGQVPTPMI---FPSLSKVNTLVSALGSTTFEQKKSHVSR 316
           WP LL   FG+      L  QGQ    +    FPSL  V TLVSALGST  +++KS + R
Sbjct: 271 WPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGSTRHQERKSSIPR 330

Query: 317 DFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRI 376
            +VDY+LN  +A+EF    +  G +KK+VV+TSFN+  LS+ S YF TKLKLEQDL T++
Sbjct: 331 HYVDYELNLTLAQEFCQRKAR-GTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKV 389

Query: 377 PELDELVILRPGPLIGSHTPEFIPGDPPKSTNG---LLKPLSTVCYYKKACYDHKRHFLQ 433
             +D LV+LRPGPL+G+HTP       P +TN    L   L  +   KK C+D K   L+
Sbjct: 390 HGMDNLVLLRPGPLVGNHTPH---AQTPPATNKFTFLPAALFHILVLKKRCFDRKVRLLR 446

Query: 434 SVTQVGLKTKMTEVFARLIYRSSCSWMFGYSXXXXXXXXXXXIRTIQKIQNDPESGGIRV 493
            + +VGL+ K++E+ ARL Y+  C  +                R I      P+S    V
Sbjct: 447 DLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAASRAIY----SPDSASF-V 501

Query: 494 QLIKSDELDVMV 505
           +LIKSDE++ M 
Sbjct: 502 ELIKSDEIEKMA 513

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  166 bits (420), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 182/370 (49%), Gaps = 47/370 (12%)

Query: 142 IEITKNLFCFNRKL-----ALLEIPSTPEYINDYWEYSIDYKGTKYHSKKNNISFGVPTL 196
           +++TKN++CFNR+L     ++ ++P T       W   ++Y G  +  +K ++       
Sbjct: 131 LKLTKNIWCFNRRLKTVDFSISKLPPT-------WTAVVNYGGEPHIIRKYDLKIKQHIT 183

Query: 197 KFGKLVNSNENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPN 256
           + GKL          + Q  QFD++ +   ++             + ++ +NV QI++ +
Sbjct: 184 EIGKLDGL-------EFQWDQFDWELKLPTDE-------------VKNVTVNVFQIIQND 223

Query: 257 SKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSR 316
           SK W      TF +  T     +  ++   +  PS+ +V TL+S LGS+++E +K    R
Sbjct: 224 SKKW----DKTFSELFTGNRKPLNDRIE--VYLPSIDQVETLISTLGSSSWESRKMKTPR 277

Query: 317 DFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRI 376
            FVDY LN  MA+ F  +  +  IK  +V++TSFNN AL   SPYF TK KLE DL   +
Sbjct: 278 SFVDYTLNMDMAKVFAPDQKKSLIKH-MVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV 336

Query: 377 PELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLSTVCY-YKKACYDHKRHFLQSV 435
           P L  L ILRPGPLIG H  + I        +G+L      CY +K++    K H+L  V
Sbjct: 337 PGLTHLTILRPGPLIGQHGKQIILAPQLPVGSGVLYK----CYAWKRSLLKAKLHWLSQV 392

Query: 436 TQVGLKTKMTEVFARLIYRSSCSWMFGYSXXXXXXXXXXXIRTIQK---IQNDPESGGIR 492
             VG   K+TE+ A+  Y    +W+ GYS              + K    +ND ++  + 
Sbjct: 393 KDVGPSKKVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKRNLARNDSDALVVE 452

Query: 493 VQLIKSDELD 502
           V L  S E+D
Sbjct: 453 VTLWSSQEMD 462

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  161 bits (407), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 106/323 (32%), Positives = 168/323 (52%), Gaps = 40/323 (12%)

Query: 146 KNLFCFNRKLALLEIPSTPEYINDYWEYSIDYKGTKYHSKKNNISFGVPTLKFGKLVNSN 205
           +  +CF+RK   +EI  +   +   W   ++++G K+  +KN++       + G ++   
Sbjct: 205 RTFWCFSRKFQDVEIDIS--NLPKTWTAIVEFEGEKHVIRKNDVRLIRHLSECGGMLGL- 261

Query: 206 ENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLH 265
                 +C   Q+++       D  +     R  T      INV+Q+++P+S+ WP L +
Sbjct: 262 ------KCHWDQYNW-------DVVLTTGEVRNAT------INVVQVVQPDSRRWPDLFN 302

Query: 266 STF-GDTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLN 324
             F G   T  A        + +  P+++++ TL+S LGST++E +KS   R FVDY LN
Sbjct: 303 KMFTGGVRTFNAY-------SEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLN 355

Query: 325 FKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPELDELVI 384
            +MA+ F  +  + G  K +V++TSFN+ AL   S YF TK +LE DL   +P L  L I
Sbjct: 356 MQMAKTFAPDPKK-GTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGLTHLTI 414

Query: 385 LRPGPLIGSH--TPEFIPGDPPKSTNGLLKPLSTVCY-YKKACYDHKRHFLQSVTQVGLK 441
           LRPGPL+G H   P   P +P   T  +L    T CY YKK     + ++L  V +VG  
Sbjct: 415 LRPGPLLGEHGSKPVISPTNP--DTGNML----TRCYTYKKNVMRTQFNWLAQVKEVGPT 468

Query: 442 TKMTEVFARLIYRSSCSWMFGYS 464
           TK+TE+ A+  Y    +W+ GYS
Sbjct: 469 TKVTELVAKATYHLPGNWIVGYS 491

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  145 bits (367), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 123/425 (28%), Positives = 199/425 (46%), Gaps = 60/425 (14%)

Query: 98  LYLGTTNDVQDKIQMMFEAGDLSSESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLAL 157
            Y+   +D+QDK+  + E  +                      ++ + K++FC NRK ++
Sbjct: 34  FYIKNVSDLQDKLDSLTEINE----------------------NVVLNKHIFCINRK-SV 70

Query: 158 LEIPS---TPEYINDYWEYSIDYKGTKYHSKK-----------NNISFGVPTLKFGKLVN 203
            E  S   T +Y+N     SI +KG +Y+ +            N+ +F     + G + N
Sbjct: 71  TEQKSFIKTIDYVN---MKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDFEEGIIRN 127

Query: 204 SNENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLL 263
           S      ++ +   F + +  ++   ++     + ++  I     V Q++ P S  WP L
Sbjct: 128 S-----MDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKL 182

Query: 264 LHSTFGDTDTNVALHVQGQ-VPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYD 322
           L   F  T       V  +   +    P+L+ + T+V ALGS+    +KS V   FVDY 
Sbjct: 183 LPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYH 242

Query: 323 LNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIP-ELDE 381
           L+F +A+EFT  +      KK+VVITSFNN  LS T  YF  K KLE DL   +P +L E
Sbjct: 243 LSFNLAQEFTNTTD-----KKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKE 297

Query: 382 LVILRPGPLIGSH-TPEFIPGDPPKSTNGLLKPLSTVCYYKKACYDHKRHFLQSVTQVGL 440
           L+ILRPGP+ G H  P  +  D  +  N  L       YY +    +K+  +  V +VGL
Sbjct: 298 LIILRPGPMCGQHGNPVHVEMDIQQ--NPTLS--ERFFYYPRYILKYKQQCISEVRKVGL 353

Query: 441 KTKMTEVFARLIYRSSCSWMFGYSXXXXXXXXXXXIRTIQKIQNDPESGGIRVQLIKSDE 500
           +T+++EV A  IYR   S + GYS           +  I+K     +  G +V++I S +
Sbjct: 354 RTRLSEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEK---KSKEAGPKVEVINSYQ 410

Query: 501 LDVMV 505
           +D++ 
Sbjct: 411 IDMIA 415

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  140 bits (353), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 104/380 (27%), Positives = 176/380 (46%), Gaps = 30/380 (7%)

Query: 139 EKSIEITKNLFCFNRKLALLE--IPSTPEYINDYWEYSIDYKGTKYHSKKNNI------S 190
           ++ + + K++FC NR+    +     T +Y+N     SI +KG +Y+ +          +
Sbjct: 53  KEDVVLNKHVFCINRRNVTEQKSFLKTIDYVN---MKSITWKGGRYYLRSRTANDNGRET 109

Query: 191 FGVPTLKFGKLVNSNENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVI 250
               T  +             + Q   F + +  ++   S+     + ++  I     V 
Sbjct: 110 SSTDTFFYDNFEEGFIRGAAYEGQKGNFSFAYNQKQFSYSLHYACRKEESFGIKYNFTVT 169

Query: 251 QILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTP-MIFPSLSKVNTLVSALGSTTFEQ 309
           Q++ P S+ WP LL   F          +  +        PSL  + T+V  LGST+   
Sbjct: 170 QLIIPPSESWPRLLSRIFSKEQKLEKFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSARV 229

Query: 310 KKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLE 369
           +++ V   FVDY L F +A+EF   ++     K++VV+TSFNN  L  T  YF  K KLE
Sbjct: 230 RRTQVPNSFVDYHLVFSLAQEFANTTN-----KRLVVVTSFNNDLLMRTFEYFRIKAKLE 284

Query: 370 QDLATRIP-ELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLS---TVCYYKKACY 425
            DL   +P +L ELVILRPGP+ G H      GDP      + +  +    + YY +   
Sbjct: 285 NDLEEALPNKLKELVILRPGPMCGQH------GDPVNVKLDVQENPTFSERILYYPRYVL 338

Query: 426 DHKRHFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSXXXXXXXXXXXIRTIQKIQND 485
            +K+ ++    +VGL+TK++E+ A  IYR   S + GYS           ++ I+K    
Sbjct: 339 KYKKQYISEARKVGLRTKLSELIASSIYRMPGSALLGYSVPVSKVSYVTSLKAIEK---R 395

Query: 486 PESGGIRVQLIKSDELDVMV 505
            +  G +V++I S ++D++ 
Sbjct: 396 SKEAGPKVEMINSYQIDMIA 415

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  140 bits (352), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 113/380 (29%), Positives = 187/380 (49%), Gaps = 35/380 (9%)

Query: 141 SIEITKNLFCFNRKLALLE--IPSTPEYINDYWEYSIDYKGTKYH--SKKNNISFGVP-- 194
           ++ + K++FC NR+    E     T +YIN     S+ ++G +Y+  S+K   +  VP  
Sbjct: 55  NVVLNKHVFCVNRRCINEEKSFMKTIDYIN---MRSVTWQGGRYYLRSRKEKDTEKVPSS 111

Query: 195 --TLKFGKLVNSNENSITNQCQLQQFD-YKFEFQREDPS--MQNLRTRAQTLIISLKINV 249
             T  +    N  E  I N  + +  D Y F + ++  S  +     + + + I     V
Sbjct: 112 PNTFCYD---NFEEGFIKNTPEERGKDGYSFVYNQKQFSYTLHYACGKEKGIEIICNFTV 168

Query: 250 IQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTP-MIFPSLSKVNTLVSALGSTTFE 308
            Q++ P S+ WP LL   F  T       +  +   P    PSL  ++T+V +LGST+  
Sbjct: 169 TQLIIPRSETWPKLLPRIFSGTQKLEKFDIDNKNYVPGRSLPSLCDISTMVCSLGSTSAR 228

Query: 309 QKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKL 368
            +++ V   F DY L F +A+EFT  ++     K++VV T+FNN  LS T  YF  K KL
Sbjct: 229 VRRTQVPSSFADYYLPFNLAQEFTNTTN-----KRLVVTTAFNNDFLSKTFEYFRIKAKL 283

Query: 369 EQDLATRIP-ELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKP--LSTVCYYKKACY 425
           E DL   +P +L ELVILRPGP+ G H      G+P     G      L  + YY     
Sbjct: 284 ENDLDEALPNKLKELVILRPGPMCGQH------GNPINVELGKENSTFLEKIFYYPHYLL 337

Query: 426 DHKRHFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSXXXXXXXXXXXIRTIQKIQND 485
            +K+ ++    ++GL+TK++E+ A  IYR   S + GY+           + ++  I+  
Sbjct: 338 VYKKKYISEARRIGLRTKLSEIIASSIYRMPGSALLGYA---VPVSKVSYVASLMAIERK 394

Query: 486 PESGGIRVQLIKSDELDVMV 505
            +  G ++++I S ++D++V
Sbjct: 395 SKEAGPKLEVISSYQIDMIV 414

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  138 bits (347), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 114/424 (26%), Positives = 199/424 (46%), Gaps = 58/424 (13%)

Query: 98  LYLGTTNDVQDKIQMMFEAGDLSSESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLAL 157
            Y+   +D+QDK+  + E                    ++G+  + + K++FC NR+ ++
Sbjct: 34  FYIKNVSDLQDKLNSLTE--------------------IKGD--VVLNKHVFCINRR-SI 70

Query: 158 LEIPSTPEYINDYWEYSIDYKGTKYH--SKKNNISFGVP----TLKFGKLVNSNENSITN 211
            E  S  + I+     SI +K  +Y+  S+  N +  +P    T  +           T+
Sbjct: 71  TEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAFEEGFIKKTTD 130

Query: 212 QCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLHSTFGDT 271
           +     F   +  +R   ++     + +   I  K  V Q++ P S+ W  LL   F  T
Sbjct: 131 ENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSRLLSYIFSGT 190

Query: 272 ------DTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNF 325
                 D N   +V G+       P+L  ++T+V  LGST+   +++ V   FVDY L F
Sbjct: 191 QKLEKFDANNKTYVAGKS-----LPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPF 245

Query: 326 KMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPEL-DELVI 384
            +A+EFT  +      K++V+ITSFNN  LS+T  YF  K KLE DL   +P    EL+I
Sbjct: 246 SLAQEFTNTTD-----KRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII 300

Query: 385 LRPGPLIGSHTPEFIPGDPPKSTNGLLKPLS---TVCYYKKACYDHKRHFLQSVTQVGLK 441
           LRPGP+ G H      G+  K    + + L+    + YY +    +K+ ++  V ++GL+
Sbjct: 301 LRPGPMCGQH------GNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLR 354

Query: 442 TKMTEVFARLIYRSSCSWMFGYSXXXXXXXXXXXIRTIQKIQNDPESGGIRVQLIKSDEL 501
           TK++E+ A   YR   S + GYS           + ++  I+   +  G ++++I S ++
Sbjct: 355 TKLSELIASSTYRMPGSALLGYS---VPVSKVSYVASLMAIERKSKEAGPKMEVINSYQI 411

Query: 502 DVMV 505
           D++ 
Sbjct: 412 DMIA 415

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  134 bits (336), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 81/246 (32%), Positives = 131/246 (53%), Gaps = 25/246 (10%)

Query: 220 YKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALHV 279
           Y+ E++ E+         ++ L+I+    ++QI  P+S  W  LL   F      VAL  
Sbjct: 148 YQVEYKSEN---------SKKLLITFNFVILQIACPDSSKWCELLPDIFSGC---VALRS 195

Query: 280 QGQV-PTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEH 338
           + +   T    P L ++ T++  LG+ +   ++S   R +VDY+L FK+A+ F  N+ E 
Sbjct: 196 EAEPDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTFKLAQSF--NNCE- 249

Query: 339 GIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRI-PELDELVILRPGPLIGSHTPE 397
              K++V++T+FNN  +    PYF TK KLE DL  ++ P L +LV+LRPGPL+G H   
Sbjct: 250 --GKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGRP 307

Query: 398 FIPGDPPKSTNGLLKPLSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSSC 457
                    +  +LK    + YYK+ C+  K    +   ++G +T+ +E+ AR +YR   
Sbjct: 308 LTKSLTIGHSTNMLK---QILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMYRKPG 364

Query: 458 SWMFGY 463
           SWM GY
Sbjct: 365 SWMLGY 370

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  132 bits (333), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/375 (27%), Positives = 179/375 (47%), Gaps = 42/375 (11%)

Query: 98  LYLGTTNDVQDKIQMMFEAGDLSSESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLAL 157
           LYL   ND+Q K+++ +E  D++                       + K  +C NRKL  
Sbjct: 39  LYLDAGNDLQSKLEL-YENSDINH--------------------FTLNKFFYCVNRKLNN 77

Query: 158 LEIPSTPEYINDYWEYS-IDYKGTKYHSKKNNISFGVPTLK-----FGKLVNSNENSI-- 209
            +     EY+ +  + + + ++G  Y+   NN S   P  +      G  V   + +I  
Sbjct: 78  EKRSPGNEYLMERCKATPLVFRGQDYY-LHNNTSATPPASQSSNPSLGNNVFEEDGTIQL 136

Query: 210 TNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLHSTFG 269
           T     +    +F   R+   ++ +    + L+I+    ++Q++  +S  W  LL S F 
Sbjct: 137 TKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADLLPSIFS 196

Query: 270 DTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAE 329
                V L  +    T    P L +V T++  LG  +   K SH  R FV+Y L F++ +
Sbjct: 197 G---EVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQ 253

Query: 330 EFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRI-PELDELVILRPG 388
            F +        K++V++TSFNN  +S   PYF  K +LE DL  ++ P L +LV+LRPG
Sbjct: 254 NFASCED-----KRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPG 308

Query: 389 PLIGSHTPEFIPGDPPKSTNGLLKPLSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVF 448
           P++G+H          + +  L + L    +YK+ C+++K+ F++ + ++G KTK +E+ 
Sbjct: 309 PIVGNHVNLNDRDLRLRYSPSLCEQLK---HYKEWCWEYKKSFVKEIRKIGFKTKASELV 365

Query: 449 ARLIYRSSCSWMFGY 463
           A+ +YR   S + GY
Sbjct: 366 AKAMYRKPGSSVLGY 380

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  131 bits (329), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 110/394 (27%), Positives = 184/394 (46%), Gaps = 55/394 (13%)

Query: 135 ILRGEKSIEITKNLFCFNRKLA-----LLEIPSTPEYINDYWEYSIDYKGTKYHSKK--- 186
           I  G +++ I   L+CFNRK+       L+ PS     N +  +   + G++YH  K   
Sbjct: 61  IEEGLENVTIKTCLYCFNRKIGEPLDKYLKSPSA----NSFGPFC--FNGSQYHYNKGTC 114

Query: 187 ------------NNISF-GVPTLK-FGKLVNSNENSITNQCQLQQFDYKFEFQREDPSMQ 232
                       N+ +F G    K  GK V + +N I+ +   +++ Y  E+   + ++ 
Sbjct: 115 VPLDIDQDIETSNDATFDGFLYYKDKGKNV-TGKNPISGEYYGKEYMYYLEYMSAEGNL- 172

Query: 233 NLRTRAQTLIISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSL 292
                   L ++   N IQ++  NS  WP ++   F D     A+  + ++P    FP L
Sbjct: 173 --------LKLNFIFNHIQLIIKNSFSWPSVIPIIFSDEVE--AISFREKMPLKRYFPLL 222

Query: 293 SKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNN 352
           S + T++S +G+TT   K S+ + + +DY LN  + + F+         K V+++TSFNN
Sbjct: 223 SDIKTMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAFSNTDD-----KSVIIVTSFNN 277

Query: 353 FALSSTSPYFHTKLKLEQDLATRI-PELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLL 411
             +S+ SPYF  K+KLE  LA  I P L  L ILRPGPL+G H+  +   D     + L 
Sbjct: 278 TIISTVSPYFKIKMKLESTLANAITPPLKTLTILRPGPLVGRHSDIYPTNDSILKNSSLF 337

Query: 412 KPLSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSXXXXXXX 471
           +       +KKA   +   F+  +   G+  K +E+ AR  YR   S + GY        
Sbjct: 338 E---RALLHKKAFLQNMECFVDDIRTGGMSIKASEIVARTFYRIPGSKLLGYCIPAQKVA 394

Query: 472 XXXXIRTIQK-IQNDPESGGIRVQLIKSDELDVM 504
               I  + K +  +P +     +++ S+E+D M
Sbjct: 395 YAISIAAVDKYLHEEPLT-----RVVTSEEMDNM 423

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  124 bits (312), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 105/376 (27%), Positives = 171/376 (45%), Gaps = 30/376 (7%)

Query: 141 SIEITKNLFCFNRKLALLEIPSTPEYINDYWEY----SIDYKGTKYHSKKNNISFGVPTL 196
           +I+I KN+FC NR+   L++     +  D  E      I +K  +Y   K   + G  + 
Sbjct: 70  TIKIVKNIFCINRRSQTLDL-----FNKDALESVKVGRIKFKDLEYRLDK---TPGETSY 121

Query: 197 KFGKLVNSNENSITN-QCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEP 255
           +   L N  E+   N  C+       FE Q++   +         L I  +I+V  I+ P
Sbjct: 122 ESSYLTNEIESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIP 181

Query: 256 NSKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVS 315
            S  WP LL   F        +  +     P   P L  + T++S+LG    +Q     S
Sbjct: 182 TSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKS 241

Query: 316 RDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATR 375
              +D+DL  K+ + F  N++     KK+VVIT+FNN  +S    YFH K K+E+ L   
Sbjct: 242 YRAIDFDLTLKLTQTFANNNN-----KKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNE 296

Query: 376 I-PELDELVILRPGPLIG-----SHTPEFIPGDPPKSTNGLLKPLSTVCYYKKACYDHKR 429
           + P+L +LVILRPGP++G     +  PEF P    K ++ L++        KK   D+K 
Sbjct: 297 LNPKLSQLVILRPGPIVGVPMTDAINPEFNPIL--KKSDNLVE---QSILLKKYLLDYKL 351

Query: 430 HFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSXXXXXXXXXXXIRTIQKIQNDPESG 489
             L+     G+  ++T++ A+ +YR   + + GY            ++ I+       S 
Sbjct: 352 ATLKKYRSTGIAPRLTDILAKTMYRKPGTSVLGYCIPATKVAKVAALKAIEPTIASTYSK 411

Query: 490 GIRVQLIKSDELDVMV 505
              VQ+I S ++D +V
Sbjct: 412 P-DVQIITSRQIDELV 426

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score =  111 bits (278), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 141/273 (51%), Gaps = 38/273 (13%)

Query: 135 ILRGEKSIEITKNLFCFNRKLALLEIPSTPE-----YINDYWEYS-IDYKGTKYHSKKN- 187
           I+ G   I   K ++CFNR         TP+     Y +D+ + S  D+ GTKY    N 
Sbjct: 48  IVSGVYDIAFDKIIYCFNR---------TPQNIRYKYHSDFEKNSQFDFGGTKYTLSNNP 98

Query: 188 --NISF-GVPTLKFGKLVNSNENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIIS 244
             N SF     L+F   +N  E  I  + Q+  +  +F F  E+          Q L ++
Sbjct: 99  EPNNSFESKGQLQFA--INDVEERIKIKYQVMPYSKEFGFSAEE---------EQQLNVT 147

Query: 245 LKINVIQILEPNSKLWPLLLHSTF-GDTDTNVALHVQGQV-PTPMIFPSLSKVNTLVSAL 302
             +  +QI+   S+ WP LL   F G+ +  +A   + ++ P      +++ ++T+V  L
Sbjct: 148 YNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTL 207

Query: 303 GSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYF 362
           G+++   KK +++ + +DYDL + +   FTT  +     KKV+++TSFNN  +S+  PYF
Sbjct: 208 GASSATAKKQNMTVNKIDYDLTYNLIRAFTTTEN-----KKVIIVTSFNNALISNIFPYF 262

Query: 363 HTKLKLEQDLATRI-PELDELVILRPGPLIGSH 394
            TKL+LE DL T + P + EL ILRPGP+ G H
Sbjct: 263 RTKLRLENDLKTTLEPPIKELYILRPGPIKGKH 295

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 132/274 (48%), Gaps = 21/274 (7%)

Query: 201 LVNSNE---NSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNS 257
           ++N NE   N I    +    +  F  Q+ D S+    +    L I+  + +  +   +S
Sbjct: 193 VINYNESEGNVILQPQEYSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDS 252

Query: 258 KLWPLLLHSTFGDTDTNVALH---VQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHV 314
            +WP LL   F D++T +  +   ++    T    P LS+V  ++++LGS +   K    
Sbjct: 253 TIWPSLLPVLF-DSNTKLVPNKGLIENIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETF 311

Query: 315 SRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLAT 374
               +DY LN  +   F   S      KKV++ITS N    +  S Y + K+ LE+DL T
Sbjct: 312 KN--IDYKLNLSLINSFNNTSD-----KKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKT 364

Query: 375 RIP-ELDELVILRPGPLIGS-HTPEFIPGDPP--KSTNGLLKPLSTVCYYKKACYDHKRH 430
            +  +++ELVILRPGPL+G+  T + IPG     K  +  LK L     YK+  +D+K  
Sbjct: 365 NLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQL---INYKRFAFDYKVA 421

Query: 431 FLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYS 464
            L+ +   G +   T + A+  YR   + + GY+
Sbjct: 422 LLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYT 455

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 109/252 (43%), Gaps = 36/252 (14%)

Query: 219 DYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALH 278
           ++K  F     ++    T    + I + + V  I EP+S  W  ++       D +  L 
Sbjct: 76  EWKCVFNESSNTISYSTTIHDLISICVNVEVTTIKEPDSTKWAQMIPHHIFINDPSADLS 135

Query: 279 VQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEH 338
           V                   +S LGST+   K++ V+RD+VD  LN  + +    N    
Sbjct: 136 V-------------------ISCLGSTSARSKRTGVARDWVDKILNLDILKAILNNDILS 176

Query: 339 GIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIP-ELDELVILRPGPLIGSHTPE 397
               + +++TSFNNFA+S   PYF  K +LE +    +      +VILRPGPLIG H   
Sbjct: 177 QKLSQYIIMTSFNNFAISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIGKH--- 233

Query: 398 FIPGDPPKSTNGLLKP------LSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVFARL 451
                   ST+    P      L ++  YKKA + H    +     VG+ T+ +E+ A+ 
Sbjct: 234 -------GSTSSFTVPELDDRLLHSILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQF 286

Query: 452 IYRSSCSWMFGY 463
            Y    ++  GY
Sbjct: 287 SYNMPGAFFVGY 298

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 95/193 (49%), Gaps = 25/193 (12%)

Query: 247 INVIQILEPNSKLWPLLLHSTFGDT-----DTNVALHVQGQVP---TPMIFPSLSKVNTL 298
           IN+ Q + P S  W  +L + F  T       N   +   Q     + ++ P L  +  +
Sbjct: 193 INIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLEDIQVM 252

Query: 299 VSALGSTTF-EQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSS 357
           +  LG+    +QKK       +D+DL F+++  F+     + + KK+V++T+FNN  LS 
Sbjct: 253 ICTLGTNLLCDQKK-------IDFDLTFQLSNWFS-----NRLGKKLVIVTAFNNSLLSK 300

Query: 358 TSPYFHTKLKLEQDLATRIP-ELDELVILRPGPLIGSHTPEFIPGDPPKST-NGLLKPLS 415
           T  YF+ K +LE+ L   +   L ELVILRPGPL+G+H     P +      N   K L 
Sbjct: 301 TFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLN--PSEEQAVVLNHSTKILK 358

Query: 416 TVCYYKKACYDHK 428
            + +YK    +HK
Sbjct: 359 QLWFYKTFFSNHK 371

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 10/104 (9%)

Query: 289 FPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVIT 348
           FP+  K++ L++ L +TT +       + ++D+DLN     +F   + E+G    VVV +
Sbjct: 62  FPT-DKIDILMTGL-ATTKKAAGGAQQQYYIDHDLNI----DFAKKAKENGCSTFVVVSS 115

Query: 349 SFNNFALSSTSPYFHTKLKLEQDLATRIPELDELVILRPGPLIG 392
           +      S+ S +F+ K+K E +   +  + D L+ILRPGPL+G
Sbjct: 116 A----GASADSRFFYLKMKGEIERDLKAIDFDHLIILRPGPLLG 155

>Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa]
           {ON} YER004W - Hypothetical ORF [contig 189] FULL
          Length = 224

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 10/101 (9%)

Query: 294 KVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNF 353
           K + + +AL +T  +  K H    +VD+DLN ++A++    + E+G K  V+V ++    
Sbjct: 66  KSDVVFTALATTREQAGKEHFY--WVDHDLNLQLAQK----AKENGCKTFVLVSSA---- 115

Query: 354 ALSSTSPYFHTKLKLEQDLATRIPELDELVILRPGPLIGSH 394
             S  SP+F+ K K E +        ++ +ILRPG L G+ 
Sbjct: 116 GASEKSPFFYFKTKAEIERDILALNFEKTIILRPGALFGAR 156

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 58/127 (45%), Gaps = 16/127 (12%)

Query: 296 NTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFAL 355
           + L S L +T  E  K +  +  VD+D+N ++A     ++ E G    VVV  S      
Sbjct: 67  DILFSGLATTRGEAGKENFYK--VDHDMNLQLAR----SAKEKGYSTYVVV--SSTGADE 118

Query: 356 SSTSPYFHTKLKLEQDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLS 415
           +S   Y  TK +LE+D+       +  +ILRPGPL+G  T            NGL   + 
Sbjct: 119 NSMFYYMKTKGELERDILA--LGFERTIILRPGPLLGERTK------SKGLLNGLSSKIG 170

Query: 416 TVCYYKK 422
           ++ Y  K
Sbjct: 171 SIVYRTK 177

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 65/147 (44%), Gaps = 39/147 (26%)

Query: 248 NVIQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTF 307
           NV QI+E +S  W  L                         FP  + V    SA G+T  
Sbjct: 43  NVKQIVETDSSKWAQL-------------------------FPE-TGVKFYFSAFGTT-- 74

Query: 308 EQKKSHVSRDF--VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTK 365
            +  +  + +F  +D+DLN ++A+   T     G    V+V +   N   +S  PYF  K
Sbjct: 75  -RAAAGSAENFYKIDHDLNVELAKAAKTK----GCTTMVLVSSVGAN--ENSMLPYFKDK 127

Query: 366 LKLEQDLATRIPELDELVILRPGPLIG 392
            ++E+D+     + D  +ILRPGPL+G
Sbjct: 128 GEIERDILAL--DFDHTIILRPGPLLG 152

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 54/123 (43%), Gaps = 14/123 (11%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +D++LN  +A++    + E+G    V+V +S  N    S   Y   K ++E+DL      
Sbjct: 20  IDHNLNIHLAKK----AKENGCSTFVLVSSSLAN--ADSRFTYLKMKGEIERDLEA--IG 71

Query: 379 LDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLSTVCYYKK-ACYDHKRHFLQSVTQ 437
            D L+ILRPG L+G    +F         N +   L    Y  +  C      F   V Q
Sbjct: 72  FDHLIILRPGKLLGERQNDF-----KGFANSMFTALGNSIYRSRLQCVLQYPVFGNEVGQ 126

Query: 438 VGL 440
           VG+
Sbjct: 127 VGV 129

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 11/105 (10%)

Query: 295 VNTLVSALGSTTFEQKKSHVSRDF-VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNF 353
           +N L SALG+T  +     +   + +D+ LN  +A+     + E G K   +V+ S    
Sbjct: 64  INVLFSALGTT--KAAAGSIENQYKIDHGLNLAVAKA----AKEKGCK--TLVLVSSLGA 115

Query: 354 ALSSTSPYFHTKLKLEQDLATRIPELDELVILRPGPLIGSHTPEF 398
           ++ S  PYF  K +LE+D+       +  ++LRPG L+G     +
Sbjct: 116 SIESRLPYFKMKGELERDVLA--LGFERTILLRPGVLLGERDSNY 158

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +D+DLN ++A+               +V+ S +  +L S   Y   K ++E+D+     +
Sbjct: 86  IDHDLNLELAKAAKAKGCS------TIVVVSSDRASLDSRFSYMRMKGEIERDIVA--LD 137

Query: 379 LDELVILRPGPLIGSHTPE 397
            D  +ILRPG L+G   P+
Sbjct: 138 FDHTIILRPGILLGERDPQ 156

>ADR005W Chr4 (712873..713547) [675 bp, 224 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER004W
          Length = 224

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query: 293 SKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNN 352
           + V+   S LG TT        ++  VD+DLN  +A+     + E G +  V VI S   
Sbjct: 61  AGVDVFFSGLG-TTRANAGGLENQYKVDHDLNIAVAKA----AKERGCR--VCVIVSAIG 113

Query: 353 FALSSTSPYFHTKLKLEQDLATRIPELDELVILRPGPLIG 392
            ++++  PY   K  +E+DL     E +  VILRPG L+G
Sbjct: 114 ASVNARLPYNKLKGDIERDLLA--LEFERTVILRPGVLLG 151

>TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.148
           YER004W
          Length = 226

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 75/169 (44%), Gaps = 42/169 (24%)

Query: 235 RTRAQTLIISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTPM--IFPSL 292
           R  A T   + KIN  QI+  NS+ W                     +VP  +  +F SL
Sbjct: 35  RKLADTYDNNTKIN--QIINKNSEEWV-------------------NEVPKGLDVVFTSL 73

Query: 293 SKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNN 352
           S   T   A GS   + K        +D+DLN ++ E+    + E+G K  V++ +S  N
Sbjct: 74  S---TTKGAAGSLENQYK--------IDHDLNLQLLEK----AKENGCKTVVLISSSGAN 118

Query: 353 FALSSTSPYFHTKLKLEQDLATRIPELDELVILRPGPLIGSHTPEFIPG 401
               S + Y   K ++E+D+ T++   D  +ILRPG L+G    +   G
Sbjct: 119 --EHSWAGYLKMKGEIERDV-TKLG-FDHTIILRPGVLLGERDSQNFKG 163

>NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 54/114 (47%), Gaps = 21/114 (18%)

Query: 281 GQVP--TPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEH 338
           G +P  T  IF +L+   T   A+G    + K        +D+DLN  +A+     + E 
Sbjct: 57  GLIPDDTKFIFTALA---TTRGAVGGFDNQYK--------IDHDLNVDLAKA----AKEK 101

Query: 339 GIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPELDELVILRPGPLIG 392
           G     VV+ S +  +L S   Y   K ++E+D+     + D  +ILRPG L+G
Sbjct: 102 GCS--TVVLVSSSGASLDSRFSYMRMKGEIERDILA--LDFDHTIILRPGILLG 151

>KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.148
           YER004W
          Length = 225

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 21/119 (17%)

Query: 301 ALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSP 360
           A+G T ++ K        +D+DLN ++A+     + E G    +V++T+    A    S 
Sbjct: 79  AVGGTGYQYK--------IDHDLNVELAKA----AREKGCST-IVIVTAHGAHA---DSR 122

Query: 361 YFHTKLKLEQDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLSTVCY 419
           +F+TK+K E +        +  +ILRPG L+G    E + G      NGL   L ++ Y
Sbjct: 123 FFYTKMKGEIERDISDLGFNRTIILRPGILLGER-HERLKG----FGNGLAVKLGSLLY 176

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 8/77 (10%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +D+DLN ++A+       E       +V+ S       S   Y   K ++E+D+     +
Sbjct: 89  IDHDLNLQLAQAAKEKGCE------TIVLVSSAGAHPDSRFGYMKMKGEIERDVIAL--D 140

Query: 379 LDELVILRPGPLIGSHT 395
              ++ILRPGPL+G  T
Sbjct: 141 FKHIIILRPGPLLGERT 157

>KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 39/148 (26%)

Query: 248 NVIQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTF 307
            +++++EP+S LW   +    G+ D                         L+ ALG+T  
Sbjct: 46  KLVKLIEPDSTLWGRAMRDIPGNLDV------------------------LICALGTT-- 79

Query: 308 EQKKSHVSRDF-VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKL 366
            + +S+    + VD+DL  ++A         H     VVV++S         S +F+ ++
Sbjct: 80  -RARSNAEEQYAVDHDLTLELATVAKREKHAH----TVVVVSSTGA---HPESRFFYARM 131

Query: 367 KLEQDLATRIPEL--DELVILRPGPLIG 392
           K   D+   I EL  +  V+LRPG L+G
Sbjct: 132 K--GDVERDITELQFNHTVLLRPGILLG 157

>SAKL0C11550g Chr3 complement(1033898..1035958) [2061 bp, 686 aa]
           {ON} similar to uniprot|P04397 Saccharomyces cerevisiae
           YBR019C GAL10 UDP-glucose-4-epimerase catalyzes the
           interconversion of UDP-galactose and UDP-D-glucose in
           galactose metabolism also catalyzes the conversion of
           alpha-D-glucose or alpha-D-galactose to their beta-
           anomers
          Length = 686

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 355 LSSTSPYFHTKLKLE---QDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLL 411
           L  T+PY  TKL +E   +DL T  P+L    ILR    IG+H    I  DP    N LL
Sbjct: 151 LGPTNPYGRTKLAIEDILRDLYTSDPQLWNFAILRYFNPIGAHPSGLIGEDPLGIPNNLL 210

Query: 412 KPLSTVC 418
             ++ V 
Sbjct: 211 PYMAQVA 217

>KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}
          Length = 228

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 61/149 (40%), Gaps = 37/149 (24%)

Query: 249 VIQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFE 308
           ++ ++EP+ KLW   +    GD D                         L+SALG+T   
Sbjct: 47  LVALVEPDGKLWGHAVRGIPGDLDV------------------------LLSALGTT--R 80

Query: 309 QKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLK- 367
                  +  VD+DL   +A     + +     K V +++S       + S +F+T++K 
Sbjct: 81  AAAGAEGQYAVDHDLCVAVARAARNDKN----CKSVALVSSAGAH---TDSRFFYTRMKG 133

Query: 368 -LEQDLATRIPELDELVILRPGPLIGSHT 395
             E+D+A         V LRPG L+G  T
Sbjct: 134 DTERDIAAL--AFPHAVFLRPGILLGQRT 160

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +D+DLN ++A        +       +V+ S     + S   Y   K ++E+D+      
Sbjct: 89  IDHDLNMQLARAAKDRGCD------TIVLVSSAGAHVDSRFGYMKMKGEIERDIIAL--N 140

Query: 379 LDELVILRPGPLIGSHT 395
               +ILRPGPL+G  T
Sbjct: 141 FKHTIILRPGPLLGKRT 157

>Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..22242)
           [666 nt, 222 aa]
          Length = 221

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +DYDLN ++A+     + E G    V+V ++  N    S   Y   K ++E+D+      
Sbjct: 85  IDYDLNIELAKA----AKEKGCSTLVLVSSAGAN--EHSWIAYLKMKGEIERDMIK--LG 136

Query: 379 LDELVILRPGPLIGSHTP 396
            D  +ILRPG ++G  T 
Sbjct: 137 FDHTIILRPGAILGERTS 154

>NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON}
           Anc_7.148 YER004W
          Length = 225

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 66/163 (40%), Gaps = 32/163 (19%)

Query: 294 KVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNF 353
           ++N L ++L STT         +  +D+DLN ++A+     + E G     +V+ S    
Sbjct: 64  EINVLFTSL-STTRGAAGGFDEQYKIDHDLNIELAKA----AKEKGCS--TIVLVSSRGA 116

Query: 354 ALSSTSPYFHTKLKLEQDLATRIPELDELVILRPGPLIG---SHTPEFIPGDPPKSTNGL 410
              S   Y   K ++E+D+       D  +ILRPG L+G   S+      G       G 
Sbjct: 117 HADSRMAYTRMKGEIERDIIA--LGFDHTIILRPGILLGQRDSNGDSGFGGGIASMIGGF 174

Query: 411 LKPLSTVCYYKKACYDHKRHFLQS-------VTQVGLKTKMTE 446
           L             Y+HKR+  +        V +VG+   + E
Sbjct: 175 L-------------YNHKRNLFKGHSVEAEDVGKVGVHLALDE 204

>CAGL0H09768g Chr8 complement(954112..954813) [702 bp, 233 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004w
          Length = 233

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +D+DLN ++A+    N  E       +V+ S      +S  PY   K ++E+D+      
Sbjct: 89  IDHDLNLELAKASKANGCE------TIVLVSSTGANKNSWMPYLRMKGEIEEDIIAL--N 140

Query: 379 LDELVILRPGPLIG 392
               +ILRP  L+G
Sbjct: 141 FKHTIILRPSALLG 154

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 8/77 (10%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +D+DLN ++A        E       +V+ S       S   Y   K ++E+D+      
Sbjct: 89  IDHDLNLQLARAAKEKGCE------TIVLVSSAGAHPDSRFGYMKMKGEIERDVIAL--N 140

Query: 379 LDELVILRPGPLIGSHT 395
               +ILRPGPL+G  T
Sbjct: 141 FKHTIILRPGPLLGERT 157

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +D+DLN ++A        E      +V+++S    A  S   Y   K ++E+D+      
Sbjct: 89  IDHDLNLQLARAAKDKGCE-----TIVLVSSAGAHA-DSRFGYMKMKGEIERDVIA--LN 140

Query: 379 LDELVILRPGPLIG 392
               +ILRPGPL+G
Sbjct: 141 FKHTIILRPGPLLG 154

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +D+DLN ++A+     + E G      V+ S       S   Y   K ++E+D+      
Sbjct: 86  IDHDLNIELAK----VAKEKGCS--TFVLVSSGGAKEDSMFAYMKMKGEIERDILAL--G 137

Query: 379 LDELVILRPGPLIG 392
            D  +ILRPGPL+G
Sbjct: 138 FDHTIILRPGPLLG 151

>KLLA0D13684g Chr4 complement(1180483..1181157) [675 bp, 224 aa]
           {ON} similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 224

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 8/80 (10%)

Query: 319 VDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPE 378
           +D+D+N ++A+             KV V+ S      +S  PY   K + E+D+     +
Sbjct: 88  IDHDMNVELAKVAKAKGY------KVCVLVSSLGANENSFLPYLKLKGETERDIIAL--D 139

Query: 379 LDELVILRPGPLIGSHTPEF 398
            D+ +ILRPG L+G     F
Sbjct: 140 FDKTIILRPGGLLGERNGTF 159

>SAKL0C12254g Chr3 complement(1094427..1095245) [819 bp, 272 aa]
           {ON} similar to uniprot|P41912 Saccharomyces cerevisiae
           YOL110W SHR5 Subunit of a palmitoyltransferase composed
           of Shr5p and Erf2p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage palmitoylation is
           required for Ras2p localization to the plasma membrane
          Length = 272

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 10/93 (10%)

Query: 278 HVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTT---- 333
           H+QGQ+ +P+     S +N++VS L + T E++  H  +D  + D  F    EF+     
Sbjct: 12  HLQGQMGSPLHDGMNSTLNSVVSKLPTATVEEESGH--KDGKNQDALFFNYHEFSVTEYM 69

Query: 334 ----NSSEHGIKKKVVVITSFNNFALSSTSPYF 362
                S E   + + + IT F N  +   SP F
Sbjct: 70  DINGGSYEQHEESRALCITHFPNIYVPMESPEF 102

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 14/82 (17%)

Query: 111 QMMFEAGDLSSESNP----PNVKRTFGQILRGEKSIEITK---------NLFCFNRK-LA 156
           ++++E  D S  S+      NVK +  Q LR   S++ T           L C  +  L 
Sbjct: 741 RVLYEKDDHSDSSHSLQMIVNVKESLAQALRSLISLQSTNWGLGFLSCYRLVCMAKYVLH 800

Query: 157 LLEIPSTPEYINDYWEYSIDYK 178
           L++I   PE  N +WEY  +YK
Sbjct: 801 LVDIDMLPEVTNRFWEYEKNYK 822

>TDEL0E00190 Chr5 (23197..25290) [2094 bp, 697 aa] {ON} 
          Length = 697

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 355 LSSTSPYFHTKLKLE---QDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLL 411
           L  T+PY HTK  +E   QDL      + +  ILR    IG+H    I  DP    N LL
Sbjct: 149 LDPTNPYGHTKFTIEKILQDLYASNTNIWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLL 208

Query: 412 KPLSTVCYYKK 422
             ++ V   ++
Sbjct: 209 PYMAQVAVGRR 219

>TDEL0E00150 Chr5 (13297..15408) [2112 bp, 703 aa] {ON} Anc_3.218
           YBR019C
          Length = 703

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 355 LSSTSPYFHTKLKLE---QDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLL 411
           L  T+PY HTK  +E   QDL      + +  ILR    IG+H    I  DP    N LL
Sbjct: 157 LDPTNPYGHTKFTIEKILQDLYASNTNIWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLL 216

Query: 412 KPLSTVCYYKK 422
             ++ V   ++
Sbjct: 217 PYMAQVAVGRR 227

>TDEL0G04910 Chr7 (908763..910871) [2109 bp, 702 aa] {ON} 
          Length = 702

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 3/66 (4%)

Query: 355 LSSTSPYFHTKLKLE---QDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLL 411
           L  T+PY HTK  +E   QDL        +  ILR    IG+H    I  DP    N LL
Sbjct: 156 LGPTNPYGHTKFTIEKMLQDLYASNTSTWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLL 215

Query: 412 KPLSTV 417
             ++ V
Sbjct: 216 SYMAQV 221

>Skud_16.176 Chr16 (320555..321304) [750 bp, 249 aa] {ON} YPL107W
           (REAL)
          Length = 249

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 13/89 (14%)

Query: 109 KIQMMFEAG--DLSSESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLALLEIPSTPE- 165
           K+ M FE    D+S+ S    +   FG  L+GE     ++ L    RK+A +++P+ P+ 
Sbjct: 24  KVDMTFEGNTQDIST-SAEERMSTVFGGRLKGEPPKSTSRVLTGGMRKIAGVQVPAKPQE 82

Query: 166 --------YINDYWE-YSIDYKGTKYHSK 185
                    +N  WE YS D +  K+  K
Sbjct: 83  PDNCCMSGCVNCVWEIYSEDLRDWKHRRK 111

>KLTH0A01958g Chr1 (172931..174997) [2067 bp, 688 aa] {ON} similar
           to uniprot|P04397 Saccharomyces cerevisiae YBR019C GAL10
           UDP-glucose-4-epimerase catalyzes the interconversion of
           UDP-galactose and UDP-D-glucose in galactose metabolism
           also catalyzes the conversion of alpha-D-glucose or
           alpha-D-galactose to their beta- anomers
          Length = 688

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 358 TSPYFHTKLKLEQ---DLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPL 414
           T+PY  TKL +E+   DL    PE     +LR    IG+H    I  DP    N LL  +
Sbjct: 158 TNPYGKTKLAIEEILEDLHASEPEKWRFAVLRYFNPIGAHPSGLIGEDPLGIPNNLLPYM 217

Query: 415 STVCYYKK 422
           + V   ++
Sbjct: 218 AQVAVKRR 225

>NDAI0A07280 Chr1 (1658165..1660246) [2082 bp, 693 aa] {ON}
           Anc_3.218
          Length = 693

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 355 LSSTSPYFHTKLKLE---QDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLL 411
           L  T+PY  TKL +E   +DL     ++ ++ ILR    IG+H    I  DP    N LL
Sbjct: 150 LGPTNPYGQTKLGIENILRDLYNSQKDIWKVAILRYFNPIGAHPSGLIGEDPLGIPNNLL 209

Query: 412 KPLSTVCYYKK 422
             ++ V   ++
Sbjct: 210 PYMAQVAVGRR 220

>KLTH0G04510g Chr7 (358564..360450) [1887 bp, 628 aa] {ON} similar
           to uniprot|Q04093 Saccharomyces cerevisiae YDR444W
           Hypothetical ORF
          Length = 628

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query: 99  YLGTTNDVQDKIQMMFEAGDLSSESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLALL 158
           YLG   +V   +  + + G L       N+ RTF   LR E  +   ++L  + RK  L 
Sbjct: 310 YLGVAGEVPPFVTAILDIGALGQTGVDLNLNRTF--FLRKEGIVRKDQHLGSYKRKPLLE 367

Query: 159 EIPSTP 164
            IPS P
Sbjct: 368 IIPSEP 373

>KNAG0B06000 Chr2 complement(1175060..1177825) [2766 bp, 921 aa]
           {ON} Anc_4.236 YLR382C
          Length = 921

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 2/63 (3%)

Query: 369 EQDLATRIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLSTVCYYKKACYDHK 428
           E+DL  R+PE+D L      PL   H PEF+    P   +G  +   T+  +  + + + 
Sbjct: 475 EKDLPVRLPEIDSLSTKGGNPL--EHIPEFVNVKCPSCGHGAKRETDTMDTFMDSSWYYF 532

Query: 429 RHF 431
           R+ 
Sbjct: 533 RYL 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,526,486
Number of extensions: 2253165
Number of successful extensions: 6498
Number of sequences better than 10.0: 62
Number of HSP's gapped: 6642
Number of HSP's successfully gapped: 62
Length of query: 505
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 391
Effective length of database: 40,409,475
Effective search space: 15800104725
Effective search space used: 15800104725
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)