Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G08866g5.350ON25525510961e-152
Kwal_34.159845.350ON2512556002e-77
KLTH0H14828g5.350ON2512555594e-71
NCAS0F028605.350ON2532395092e-63
Ecym_81835.350ON2652614981e-61
KAFR0C018605.350ON2592464911e-60
TDEL0E027705.350ON2582424683e-57
NDAI0C043105.350ON2592464544e-55
ZYRO0D10142g5.350ON2552424449e-54
KLLA0B10153g5.350ON2672444267e-51
CAGL0H07117g5.350ON2602444205e-50
Skud_4.5855.350ON2742674112e-48
Smik_4.5785.350ON2742644084e-48
Suva_2.4885.350ON2742684051e-47
YDR319C5.350ON2742684042e-47
AGR350C5.350ON2612553971e-46
Kpol_339.115.350ON2582293928e-46
KNAG0C055105.350ON2642543753e-43
TPHA0E011305.350ON2772373616e-41
TBLA0A031105.350ON2752233391e-37
KAFR0A046406.117ON2371831101e-05
KNAG0F025106.117ON246851056e-05
Kwal_14.17966.117ON36360920.003
TBLA0F025006.117ON32736910.004
SAKL0A07062g6.117ON42942860.018
NCAS0D031606.117ON39063860.021
Skud_7.1466.117ON316129850.021
KLTH0H06556g6.117ON36356820.053
TDEL0G035306.117ON36849820.064
AAR165W6.117ON36247790.13
YGL126W (SCS3)6.117ON38056780.19
Ecym_30686.117ON36736780.21
NDAI0I017506.117ON38142770.23
KLLA0F09526g6.117ON33743770.23
ZYRO0A09240g6.117ON37242760.31
Smik_7.1456.117ON38094760.34
CAGL0I00330g6.117ON37128760.36
Kpol_461.26.117ON39741740.59
TPHA0J018106.117ON39035740.62
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G08866g
         (255 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly ...   426   e-152
Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C...   235   2e-77
KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa] ...   219   4e-71
NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON...   200   2e-63
Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to...   196   1e-61
KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.35...   193   1e-60
TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...   184   3e-57
NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON...   179   4e-55
ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {O...   175   9e-54
KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {O...   168   7e-51
CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar...   166   5e-50
Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {O...   162   2e-48
Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {O...   161   4e-48
Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}...   160   1e-47
YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON} ...   160   2e-47
AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON} ...   157   1e-46
Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON} ...   155   8e-46
KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5....   149   3e-43
TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.35...   143   6e-41
TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON...   135   1e-37
KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON...    47   1e-05
KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON...    45   6e-05
Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {O...    40   0.003
TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.11...    40   0.004
SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {...    38   0.018
NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {O...    38   0.021
Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W (...    37   0.021
KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {...    36   0.053
TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {O...    36   0.064
AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic ho...    35   0.13 
YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protei...    35   0.19 
Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}...    35   0.21 
NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.1...    34   0.23 
KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} simila...    34   0.23 
ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {...    34   0.31 
Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa...    34   0.34 
CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly s...    34   0.36 
Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON} co...    33   0.59 
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    33   0.62 

>SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  426 bits (1096), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 211/255 (82%), Positives = 211/255 (82%)

Query: 1   MNNYVEKTVLSRSFVWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQ 60
           MNNYVEKTVLSRSFVWFYP             SAQELDRQKHEYYLLSSRNVINKVFAYQ
Sbjct: 1   MNNYVEKTVLSRSFVWFYPLVLLLGLLVNLLVSAQELDRQKHEYYLLSSRNVINKVFAYQ 60

Query: 61  GNXXXXXXXXXXXXXXXHIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVV 120
           GN               HIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVV
Sbjct: 61  GNQIFLITFILLAALQIHIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVV 120

Query: 121 FYIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHY 180
           FYIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHY
Sbjct: 121 FYIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHY 180

Query: 181 QKYISDNELRVNRKFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVM 240
           QKYISDNELRVNRKFAWIKY                ATYYHTVGEKVLGLVMGYTCPTVM
Sbjct: 181 QKYISDNELRVNRKFAWIKYLTLFVLVVWLFVLSVTATYYHTVGEKVLGLVMGYTCPTVM 240

Query: 241 YILIPSTTKLNKLMY 255
           YILIPSTTKLNKLMY
Sbjct: 241 YILIPSTTKLNKLMY 255

>Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C -
           Hypothetical ORF [contig 272] FULL
          Length = 251

 Score =  235 bits (600), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 114/255 (44%), Positives = 153/255 (60%), Gaps = 4/255 (1%)

Query: 1   MNNYVEKTVLSRSFVWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQ 60
           M+ ++EK      F   YP              A  L+RQ+  YYLLSS N++NK+FAY+
Sbjct: 1   MDKFIEKA----QFTLVYPSILAYGSLINLLVDASRLERQRSSYYLLSSGNIVNKLFAYR 56

Query: 61  GNXXXXXXXXXXXXXXXHIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVV 120
           GN                +H++  DLLPR++ S  R     LA+QY +K +LK +LLY+ 
Sbjct: 57  GNLTWTILFTLLAVFQVWLHAEQSDLLPRDARSVHRVGGVRLAKQYTVKLILKNVLLYLA 116

Query: 121 FYIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHY 180
           F  ID++F+WTGG CS S TRSAERCR  GGSW+ GFDISGHFCFLTN+SLILWYEL   
Sbjct: 117 FLFIDNLFVWTGGSCSTSSTRSAERCRKEGGSWDNGFDISGHFCFLTNISLILWYELRSI 176

Query: 181 QKYISDNELRVNRKFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVM 240
           QK IS +++   + +  +++                A YYHT+ EKVLGL MGY CPT+M
Sbjct: 177 QKKISSDDISPTKTWIVLRWSTLIVLITWSFILSVTAVYYHTLLEKVLGLTMGYLCPTIM 236

Query: 241 YILIPSTTKLNKLMY 255
           Y++IP+ + L  L+Y
Sbjct: 237 YLVIPNHSGLRSLLY 251

>KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa]
           {ON} similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 251

 Score =  219 bits (559), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 146/255 (57%), Gaps = 4/255 (1%)

Query: 1   MNNYVEKTVLSRSFVWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQ 60
           M+ ++E+      F + YP             +   L  QK  YYLLS  NVIN VFAY+
Sbjct: 1   MDKFIERG----RFAFVYPVVLICGLVVHLLANGSTLQHQKDTYYLLSPNNVINLVFAYK 56

Query: 61  GNXXXXXXXXXXXXXXXHIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVV 120
           GN                I     DLLPR++ ++       L ++YA+K +LK LLLYV+
Sbjct: 57  GNLIWTILFVSLAAYQIKIRVSRSDLLPRDARTTYPARWHRLGKEYAVKIILKNLLLYVI 116

Query: 121 FYIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHY 180
           F++ID VF+WTGG CS S T+SAERCR  GG WE GFDISGHFCFLTNVSLILW EL   
Sbjct: 117 FFVIDCVFVWTGGSCSSSATKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELSSI 176

Query: 181 QKYISDNELRVNRKFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVM 240
           QKY++ +E   ++ +  + Y                A YYHT  EK+LGL+MGY CP +M
Sbjct: 177 QKYLNSDERTPSKLWRVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPVIM 236

Query: 241 YILIPSTTKLNKLMY 255
           Y L+PS T L +L+Y
Sbjct: 237 YWLVPSHTALRQLLY 251

>NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON}
           Anc_5.350 YDR319C
          Length = 253

 Score =  200 bits (509), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 135/239 (56%), Gaps = 1/239 (0%)

Query: 18  YPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXXXX 77
           YP               + LDRQKHEYY+LSS+N++N+VFAY GN               
Sbjct: 14  YPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYFQV 73

Query: 78  HIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSI 137
            I  + QDLLPR++    R     L +QY +KF+LK LLL++ F  ID +F++TGG C+ 
Sbjct: 74  WIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLFLFTGGQCTY 133

Query: 138 S-KTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELRVNRKFA 196
                SAE+C+  GG WEGGFDISGHFCFL NVSLILW EL   ++Y+ D EL +     
Sbjct: 134 GLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEELEMETIIT 193

Query: 197 WIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKLMY 255
                               A YYHT+ EK+LG ++GY CP +MY LIP+  KLN ++Y
Sbjct: 194 NYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPNHYKLNHILY 252

>Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to
           Ashbya gossypii AGR350C
          Length = 265

 Score =  196 bits (498), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 148/261 (56%), Gaps = 10/261 (3%)

Query: 1   MNNYVEKTVLSRSFVWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQ 60
           MN+++    +++ ++  YP              ++ L+  +  +YLL+  N++N +F   
Sbjct: 9   MNSFI----VNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVIN 64

Query: 61  GNXXXXXXXXXXXXXXXHIHSKNQDLLPRNSS---SSPR---TEAAGLARQYAIKFLLKQ 114
           GN               +I +K  D LP   S   SS R   T    L +Q+ +K  LK 
Sbjct: 65  GNNVWLVLYILMAGVQCYIRTKESDSLPLGGSVPGSSSRERYTIFLCLVKQFIVKLALKM 124

Query: 115 LLLYVVFYIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILW 174
           +LL  +F++IDHVFIWTGG C++S T+S+  C  L G W GGFDISGHFCF+TN+SLILW
Sbjct: 125 VLLDRIFWLIDHVFIWTGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILW 184

Query: 175 YELYHYQKYISDNELRVNRKFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGY 234
            EL+  ++Y+S NE+R+ ++  WIKY                A +YHT+ EKVLGL++GY
Sbjct: 185 CELFSLEQYLSANEIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGY 244

Query: 235 TCPTVMYILIPSTTKLNKLMY 255
            CP VMY +IP   KL +++Y
Sbjct: 245 VCPVVMYAIIPYYPKLQRILY 265

>KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.350
           YDR319C
          Length = 259

 Score =  193 bits (491), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 135/246 (54%), Gaps = 11/246 (4%)

Query: 18  YPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXXXX 77
           YP             S +    QK   YLL S N+IN++FAY GN               
Sbjct: 15  YPCILFLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQI 74

Query: 78  HIHSKNQDLLPRN--SSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVC 135
           +I S    LLP +     S     A L ++Y +KFLLK  +L+V F IID++FI TGG C
Sbjct: 75  YIRSHTFILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILTGGSC 134

Query: 136 SIS-KTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNEL--RVN 192
           +    TRSAE+C+ LGG W GGFDISGHFCFLTN+SLILW EL+HY KY  + EL  R+N
Sbjct: 135 APGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQSRIN 194

Query: 193 RKFAWIKYXXXXXXXXX---XXXXXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTK 249
           +   WIK                    + YYHT+ EK+LG +MGY CP VMY LIP+  +
Sbjct: 195 K---WIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQPR 251

Query: 250 LNKLMY 255
           +  L+Y
Sbjct: 252 MKSLLY 257

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
           YDR319C
          Length = 258

 Score =  184 bits (468), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 130/242 (53%), Gaps = 3/242 (1%)

Query: 17  FYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXXX 76
            YP                 L+ Q+  YYLL S+N+IN +FAY+GN              
Sbjct: 16  IYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQ 75

Query: 77  XHIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVC- 135
            ++  +N  LLPR++ ++       L +QY  K +LK +LL + F+IID +F+ TGG C 
Sbjct: 76  IYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLTGGSCL 135

Query: 136 SISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNEL--RVNR 193
           +   TRSAERCR+ GG W+GGFDISGHFCFL N+S+ILW EL  ++ Y+    +   V++
Sbjct: 136 NGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPVSK 195

Query: 194 KFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKL 253
               +                  A YYHTV EKVLG  +GY C  VMY LIP + + N L
Sbjct: 196 VVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSRRFNGL 255

Query: 254 MY 255
           +Y
Sbjct: 256 LY 257

>NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON}
           Anc_5.350 YDR319C
          Length = 259

 Score =  179 bits (454), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 129/246 (52%), Gaps = 6/246 (2%)

Query: 16  WFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXX 75
           + YP               + L   K  YY+L+S+N+ N+V AY GN             
Sbjct: 13  YIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFILLSVI 72

Query: 76  XXHIHSKNQDLLPR--NSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGG 133
              + S N +LLPR  +S++S R     L +QY IKF+LK +LL  +F IID +FI TGG
Sbjct: 73  QIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVLLAFLFLIIDSLFILTGG 132

Query: 134 VCS-ISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELRVN 192
            C+ I    SAE C+  GG WEGGFDISGHFCFL N+SLILW EL    K + D E    
Sbjct: 133 ECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFLINISLILWSELSLLNKVLEDREETFT 192

Query: 193 RKFAWIKYXXXXXXXXX---XXXXXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTK 249
           +   W++                    A YYHT+ EK+LG ++G+ CP VMY  IP+  K
Sbjct: 193 KIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIPNNVK 252

Query: 250 LNKLMY 255
           L + +Y
Sbjct: 253 LKQTLY 258

>ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  175 bits (444), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 133/242 (54%), Gaps = 5/242 (2%)

Query: 18  YPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXXXX 77
           YP               + L+ Q+ E+Y L+  N IN++FAY+GN               
Sbjct: 15  YPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCGLAGLQV 74

Query: 78  HIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSI 137
           ++ +   D++PR++ +  R     L ++YA+K +LK LLL ++F  ID++FI TGG CS 
Sbjct: 75  YMKTHVPDVIPRDARTIVRKPMTSLLKEYAVKIILKNLLLAIIFLFIDNIFILTGGSCSD 134

Query: 138 -SKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELRVNRKFA 196
            S T SAE+C   GG WEGGFDISGHFCFL ++S+ILW EL H + ++ + ++ V R   
Sbjct: 135 HSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDM-VKRLNV 193

Query: 197 WIKYXXXXXXXXXXX---XXXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKL 253
           W K                    + YYHT+ EK+LG  MGY CP +MY LIP+   + K+
Sbjct: 194 WGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPNHDIVRKV 253

Query: 254 MY 255
           +Y
Sbjct: 254 LY 255

>KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C
          Length = 267

 Score =  168 bits (426), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 130/244 (53%), Gaps = 7/244 (2%)

Query: 18  YPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXXXX 77
           YP                EL+R++ E+Y +  RNV+N +FAY+G                
Sbjct: 22  YPALVIFGYFISVLIGEDELERERKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQV 81

Query: 78  HIHSKNQD-LLPRNSSSSPRT------EAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIW 130
           ++  K+++ LLP ++    R       +   + + Y+IKF+L  L+L+  F  IDH+F+W
Sbjct: 82  YVRMKHEESLLPTSNGEQDRNSPDLLKQVGKVLKVYSIKFVLVYLVLWACFLFIDHLFVW 141

Query: 131 TGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELR 190
           TGG C +S T+SAE+CR LGGSW GGFDISGHFCFLTN+SL LW EL    +Y + + + 
Sbjct: 142 TGGNCDLSDTKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELKLLLQYANQHTIS 201

Query: 191 VNRKFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKL 250
            N   +  ++                + YYHT  EKVLG   GY+C  V+Y ++P    +
Sbjct: 202 WNSPSSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSCLLVIYYILPRIKHV 261

Query: 251 NKLM 254
           NK +
Sbjct: 262 NKFL 265

>CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar to
           uniprot|Q06676 Saccharomyces cerevisiae YDR319c
          Length = 260

 Score =  166 bits (420), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 92/244 (37%), Positives = 135/244 (55%), Gaps = 7/244 (2%)

Query: 18  YPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXXXX 77
           YP             S +    Q+  YYLL+S+NV N++ AY+GN               
Sbjct: 13  YPVILILGCFLSVLLSEEAKINQRANYYLLNSKNVFNQILAYKGNWVWLFLFMGVAAVQY 72

Query: 78  HIHSKNQDLLPRNSSS---SPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGV 134
           ++ +K+Q LLP ++ +   S +T+   + ++Y  K+ LK  +L V+F +ID VFI TGG 
Sbjct: 73  NLRTKSQSLLPTDTRALVVSNKTKLQ-IIKEYFCKYFLKLFILDVIFLVIDGVFIMTGGS 131

Query: 135 CSI-SKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYIS--DNELRV 191
           C++ +++ SAE C+ LGG W GGFDISGHFCFL N+S+ILW EL    +++   D  + +
Sbjct: 132 CTVPNRSISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIAEHVCGYDTVISL 191

Query: 192 NRKFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLN 251
           +     +                  ATYYHT+ EK++G V GY CP VMY LIP++  LN
Sbjct: 192 SSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFVMYGLIPNSHDLN 251

Query: 252 KLMY 255
           KL Y
Sbjct: 252 KLFY 255

>Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  162 bits (411), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 132/267 (49%), Gaps = 24/267 (8%)

Query: 11  SRSFVWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXX 70
           SR     YP             S++ L  QK  Y LL S N+ N +FAY+ N        
Sbjct: 9   SRKAYLIYPFQVLVGAIISILVSSETLGHQKKTYALLKSSNLFNILFAYKANQLWPFLFF 68

Query: 71  XXXXXXXHIH-SKNQDLLPRNSSSSP---------------RTEAAGLA-RQYAIKFLLK 113
                  + H     D+LP   SSS                +    G+   QYA KF+LK
Sbjct: 69  SLAFLQIYFHYLARMDVLPLPISSSETGPTYSSYINRWPLLKDRVIGIMFAQYACKFILK 128

Query: 114 QLLLYVVFYIIDHVFIWTGGVCSI-SKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLI 172
            LLLYV F  IDHVFIWTGG CS  S T SAE+CR+  G W+GGFDISGHFCFL N+S+I
Sbjct: 129 SLLLYVCFQFIDHVFIWTGGECSSGSGTTSAEKCRLENGKWQGGFDISGHFCFLVNISMI 188

Query: 173 LWYELYHYQKYI-SDNELRVNRKFAWIKYXXXXXXXXXXX---XXXXXATYYHTVGEKVL 228
           LW EL+ + K++ +++   V  K  W++                    A YYHTV EK+L
Sbjct: 189 LWMELHLFSKFVQAEDMFWVANK--WVRACLAVISSILVIWICILWVTAIYYHTVLEKIL 246

Query: 229 GLVMGYTCPTVMYILIPSTTKLNKLMY 255
           G  MGY CP  +Y ++P    L+  +Y
Sbjct: 247 GCFMGYICPIFIYHVLPKIGLLHDYIY 273

>Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  161 bits (408), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 130/264 (49%), Gaps = 26/264 (9%)

Query: 11  SRSFVWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXX 70
           SR     YP             S + LD QK  + LL S N+ N +FAY+ N        
Sbjct: 9   SRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFF 68

Query: 71  XXXXXXXHIH-SKNQDLLPRNSSSSPRTEA----------------AGLARQYAIKFLLK 113
                  + H     D+LP   SSS    +                  +  QYA KF+LK
Sbjct: 69  SLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILK 128

Query: 114 QLLLYVVFYIIDHVFIWTGGVCSI-SKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLI 172
            +LL++ F  IDHVFIWTGG CS  S TRSAE+CR+  G W GGFDISGHFCFL N+S+I
Sbjct: 129 YMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMI 188

Query: 173 LWYELYHYQKYISDNEL--RVNRKFAWIKYXXXXXXXXXXX---XXXXXATYYHTVGEKV 227
           LW EL+ + ++I   ++   VN+   W++                    A YYHT+ EK+
Sbjct: 189 LWMELHMFCRFIQSEDMVWVVNK---WVRACLAVICTVLIIWICILWVTAIYYHTILEKI 245

Query: 228 LGLVMGYTCPTVMYILIPSTTKLN 251
           LG +MGY CP  +Y ++P    L+
Sbjct: 246 LGCLMGYICPIFIYHILPKIELLH 269

>Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  160 bits (405), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 133/268 (49%), Gaps = 26/268 (9%)

Query: 11  SRSFVWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXX 70
           SR     YP             S + L+ QK  Y LL S N++N +FAY+ N        
Sbjct: 9   SRKAYLVYPIQVLVGAVISILVSEETLNHQKKTYTLLKSSNLLNIIFAYKANKIWPIFFF 68

Query: 71  XXXXXXXHIHSKNQ-DLLPRNSSSSPRTEA----------------AGLARQYAIKFLLK 113
                  + H   + D+LP   SSS                       +A QYA KF+LK
Sbjct: 69  SLALLQIYFHYLARLDVLPLPISSSDTGSTYLSYGNRRPLLKDRVITTMAAQYACKFVLK 128

Query: 114 QLLLYVVFYIIDHVFIWTGGVCSI-SKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLI 172
            LLL++ F  IDHVF+WTGG CS  S T SAE+CR+  G W GGFDISGHFCFL N+S+I
Sbjct: 129 NLLLFLSFQFIDHVFVWTGGQCSSGSGTTSAEKCRLEKGKWYGGFDISGHFCFLVNISMI 188

Query: 173 LWYELYHYQKYISDNELR--VNRKFAWIKYXXXXXXXXXXX---XXXXXATYYHTVGEKV 227
           LW EL+ + +++   ++   VN+   W++                    A YYHT+ EK+
Sbjct: 189 LWMELHLFSRFVQAEDMLWVVNK---WVRACLVIISVVLLIWIGILWVTAIYYHTILEKM 245

Query: 228 LGLVMGYTCPTVMYILIPSTTKLNKLMY 255
           LG +MGY CP  +Y ++P    L+  +Y
Sbjct: 246 LGCLMGYICPVFIYHILPRIELLHDYLY 273

>YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON}
           Putative protein of unknown function, identified as an
           ortholog of the highly conserved FIT family of proteins
           involved in triglyceride droplet biosynthesis; interacts
           with Sst2p and Hsp82p in high-throughput two-hybrid
           screens
          Length = 274

 Score =  160 bits (404), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 135/268 (50%), Gaps = 26/268 (9%)

Query: 11  SRSFVWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXX 70
           SR     YP             S++ L+ QK    LL S N+ N +FAY+ N        
Sbjct: 9   SRKAYLIYPFQVFVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKANQLWPFLFF 68

Query: 71  XXXXXXXHIH-SKNQDLLPRNSSSSPRTEA----------------AGLARQYAIKFLLK 113
                  + H     D+LP   SS+  + +                + +  QYA KF+LK
Sbjct: 69  SLAFLQIYFHYLARMDILPLPISSTETSSSYLTYTNHWPLLKNRIISIMITQYACKFVLK 128

Query: 114 QLLLYVVFYIIDHVFIWTGGVCSI-SKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLI 172
            LLL++ F  IDHVFIWTGG CS  SKT SAE+CR+  G W+GGFDISGHFCFL ++S+I
Sbjct: 129 YLLLFLNFQFIDHVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFCFLVSISMI 188

Query: 173 LWYELYHYQKYISDNEL--RVNRKFAWIKYXXXXXXXXXXX---XXXXXATYYHTVGEKV 227
           LW EL+ + +++   ++   VN+   W++                    A YYHT+ EKV
Sbjct: 189 LWMELHLFSRFVQAEDMFWVVNK---WVRACLAIVCAVLVIWICILWVTAIYYHTILEKV 245

Query: 228 LGLVMGYTCPTVMYILIPSTTKLNKLMY 255
           LG +MG+ CP  +Y ++P    L+  +Y
Sbjct: 246 LGCLMGFICPVFIYHILPKIGILHNYLY 273

>AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR319C
          Length = 261

 Score =  157 bits (397), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 126/255 (49%), Gaps = 11/255 (4%)

Query: 1   MNNYVEKTVLSRSFVWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQ 60
           M+ Y+ +    R + + YP               + ++  +  +YLL+  N +N++F + 
Sbjct: 7   MDEYISE----RRYCYLYPALLLGGEVIKLILGEETIEHDRKTWYLLNGGNFVNQLFVHH 62

Query: 61  GNXXXXXXXXXXXXXXXHIHSKNQDLLPRNSSS------SPRTEAAGLARQYAIKFLLKQ 114
           G                H+ +   D LP ++         P      +A Q  IK LL  
Sbjct: 63  GVLLWTLLMGLVLALQYHVRTTEFDPLPLDARELGPVKRHPLKMLGSMAVQTVIKVLLVV 122

Query: 115 LLLYVVFYIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILW 174
            +L  +F+ +DH+F+WTGG C++S T+ +  CR LGG W GGFDISGHFC + N+SL+LW
Sbjct: 123 TVLQALFWFMDHLFVWTGGRCTVSDTKDSVACRRLGGEWVGGFDISGHFCLVMNLSLVLW 182

Query: 175 YELYHYQKYISDNELRVNRKFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGY 234
            EL   Q+Y+   E+++ RKFAW +                 A YYHT  EK+LG + GY
Sbjct: 183 LELTELQRYMHSQEIQL-RKFAWARTTVLGALGVWLALLAITAIYYHTFVEKLLGTIFGY 241

Query: 235 TCPTVMYILIPSTTK 249
           +   V+Y ++P   +
Sbjct: 242 STSLVIYYVLPRINR 256

>Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON}
           complement(17930..18706) [777 nt, 259 aa]
          Length = 258

 Score =  155 bits (392), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 89/229 (38%), Positives = 127/229 (55%), Gaps = 11/229 (4%)

Query: 36  ELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXXXXHIHSKNQDLLPRNSSSSP 95
           +L+ Q++ +Y+L S N++N++FAY GN               +  SK   LL  + S + 
Sbjct: 31  KLESQRNNFYILRSSNIVNELFAYHGNQVWLVLFIFLCLVQIYYRSKRFSLLISSESFNG 90

Query: 96  RTEAAG----LARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVC-SISKTRSAERCRVLG 150
           R +       L +QY  K +LK L+L +VF +ID+VFI++GG C S S TRS++RCR   
Sbjct: 91  RDQLIARGKPLVKQYICKLILKNLMLILVFSVIDNVFIFSGGECTSGSGTRSSQRCRHEN 150

Query: 151 GSWEGGFDISGHFCFLTNVSLILWYELYHYQKYIS----DNELRVNRKFAWIKYXXXXXX 206
           G WEGGFDISGHFCFL  +S+ILW EL+ ++K++       +L +  K   I        
Sbjct: 151 GHWEGGFDISGHFCFLVTISMILWIELHQFKKHVDLEGLSGQLSLYSKI--ILMTVFTVL 208

Query: 207 XXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKLMY 255
                     + YYHT  EKVLG  MGY  P VMY +IP+   L  ++Y
Sbjct: 209 CIWVFILFITSVYYHTFMEKVLGCAMGYITPYVMYHIIPNNEFLYSILY 257

>KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5.350
           YDR319C
          Length = 264

 Score =  149 bits (375), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 123/254 (48%), Gaps = 15/254 (5%)

Query: 15  VWFYPXXXXXXXXXXXXXSAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXX 74
           V  YP               Q  D+ K   Y  +S+NV+N+VFAY+GN            
Sbjct: 12  VLLYPFVLSIGLILHVLVPEQVQDQLKQHVYFFNSKNVLNQVFAYKGNLVWTVLFLYIAV 71

Query: 75  XXXHIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGV 134
               I + ++D  P    +  R     + RQY  K LLK  LLY+ F +ID VFI TGGV
Sbjct: 72  LSYFIKTMSRD--PLEQRAGGRQVDWQIVRQYCWKLLLKNGLLYLCFLVIDGVFIATGGV 129

Query: 135 CS-----ISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNEL 189
           C+     + K RSAE C+  GG WE GFDISGHFCFL N+SLILW EL   Q  I   EL
Sbjct: 130 CTTMGGEMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAELQLLQDAIRREEL 189

Query: 190 RVNRKFAWIKY--------XXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVMY 241
                  WI Y                        A++YHT  EK++G   GY CP VMY
Sbjct: 190 GEEELNLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSSEKLIGCAFGYVCPFVMY 249

Query: 242 ILIPSTTKLNKLMY 255
            LIP++ +LN+  Y
Sbjct: 250 HLIPTSPRLNEFFY 263

>TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.350
           YDR319C
          Length = 277

 Score =  143 bits (361), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 87/237 (36%), Positives = 117/237 (49%), Gaps = 14/237 (5%)

Query: 33  SAQELDRQKHEYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXXXXHIHSKNQDLLPRNSS 92
             + L+  K  +Y L+S+N IN++FAY GN               H  + N   L   S+
Sbjct: 40  GTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHLHFETVNSKELLPTSA 99

Query: 93  SSPR---------TEAAG--LARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSI-SKT 140
             P          T+ A   L +QY  K+ +K   L+V+F+ ID +F+ +GG C   S T
Sbjct: 100 DVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFAIDTLFVLSGGSCDDGSGT 159

Query: 141 RSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDN--ELRVNRKFAWI 198
             +E CR   G WEGGFDISGHFCFL  +SLILW ELY   K +     E+ +N  F  +
Sbjct: 160 TFSETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKRMESESFEVELNVVFTVM 219

Query: 199 KYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKLMY 255
                             A YYHT  EKVLG ++G+  P +MY  IPS   LN L+Y
Sbjct: 220 IGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMYYTIPSNEFLNGLLY 276

>TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON}
           Anc_5.350 YDR319C
          Length = 275

 Score =  135 bits (339), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 115/223 (51%), Gaps = 10/223 (4%)

Query: 43  EYYLLSSRNVINKVFAYQGNXXXXXXXXXXXXXXXHIHSKNQDL-LPRNSSSSPRTEA-- 99
           +++L+ S +  N++FAY GN               +   ++  L LP    +  R +   
Sbjct: 52  KFWLIRSNSWFNQLFAYNGNTVFLGLFLIIVSLQVYFSREDARLSLPIEIRTISRIKQFQ 111

Query: 100 ----AGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSI-SKTRSAERCRVLGGSWE 154
                 +A++Y  K +LK   LY+ F  IDH+F+ TGG C+  S TR A  CR   G W 
Sbjct: 112 TKHYLRIAKEYICKLILKYFFLYLEFLFIDHLFVLTGGYCTNGSGTRDAMICRSGNGEWV 171

Query: 155 GGFDISGHFCFLTNVSLILWYELYHYQKYISDNELR--VNRKFAWIKYXXXXXXXXXXXX 212
           GGFDISGHFCFL  +SLI+W EL+  +++I   +L+  V  +  ++ +            
Sbjct: 172 GGFDISGHFCFLVTLSLIIWLELFKLEEFIRSRDLKSNVTNEVIFMVFFIVSILILWIVM 231

Query: 213 XXXXATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKLMY 255
               + YYHT  EK+LG +MGY CP VMY ++P  T   + +Y
Sbjct: 232 LCVTSLYYHTFVEKLLGCIMGYICPIVMYRVLPRNTIFTRYIY 274

>KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON}
           Anc_6.117 YGL126W
          Length = 237

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 74/183 (40%), Gaps = 45/183 (24%)

Query: 100 AGLARQYAIK----FLLKQLLLYVVFYIIDHVFIWTGGVCS-----ISKTRSAERCRVLG 150
           A   R+Y++     FL  Q  ++    I+D +F+WTGG C          +S++ C+ +G
Sbjct: 64  ADTVRKYSVLSLWWFLFTQDNMFSNHAIMDLIFVWTGGKCDGGSTSSKLLKSSKHCKKIG 123

Query: 151 GSWEGGFDISGHFCFLTNVSLILWYELYHYQK---------------------------Y 183
           G+W  G D SGH   L+ ++  +  E    ++                           +
Sbjct: 124 GNWINGHDPSGHIFLLSIMTTFMINEFSKIRRVSMTQLRQDFVETDWNLDRQLPVKIILF 183

Query: 184 ISDNELRVNRKFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVMYIL 243
           IS+N + +   F  + +                  YYHT+ E++ GL+  Y     +Y+ 
Sbjct: 184 ISNNPVIIMLSFILLWW---------HSLVITSINYYHTLSEQLSGLLFAYIIMGPLYLF 234

Query: 244 IPS 246
           +PS
Sbjct: 235 LPS 237

>KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON}
           Anc_6.117 YGL126W
          Length = 246

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 12/85 (14%)

Query: 90  NSSSSPRTEAAGLARQYAIK----FLLKQLLLYVVFYIIDHVFIWTGGVCSISKT----- 140
             S + RT    L R+Y I     ++  Q L   V  ++D VF+W+GG C +        
Sbjct: 70  EDSVTTRTPLLPLLRRYTITTAAWYVFTQQLWLNVPPLMDLVFVWSGGSCLLDPATTPGT 129

Query: 141 ---RSAERCRVLGGSWEGGFDISGH 162
               ++  CR  GG W+GG D SGH
Sbjct: 130 LWLSTSAACRRHGGLWQGGHDPSGH 154

>Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {ON}
           YGL126W (SCS3) - involved in inositol biosynthesis
           [contig 237] FULL
          Length = 363

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 136 SISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELRVNRKF 195
           S  K  S+  CR LGG+W GG D SGH   +T + + L  EL    K  +   LR +RKF
Sbjct: 196 SWQKINSSNLCRSLGGNWVGGHDPSGHIFLITLMCMFLLGELQVLGKR-ALRVLRSDRKF 254

>TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.117
           YGL126W
          Length = 327

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 134 VCSISKT--RSAERCRVLGGSWEGGFDISGHFCFLT 167
           + SI  T   S+++CR +GG+W GG D SGH   LT
Sbjct: 226 ILSIDPTVENSSQKCRKIGGAWSGGHDPSGHMFLLT 261

>SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {ON}
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126W SCS3 Protein required for inositol prototrophy
          Length = 429

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 139 KTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHY 180
           +  S+++C+ LGG W GG D SGH   +T + + L  EL  +
Sbjct: 263 RIDSSQKCKSLGGHWSGGHDPSGHIFLITLMCMFLLGELQMF 304

>NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {ON}
           Anc_6.117 YGL126W
          Length = 390

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 136 SISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELRVNRKF 195
           S+ +  ++  CR  GG W  G D SGH   +T +++ +  EL   Q +I D   R+   F
Sbjct: 220 SMGRISTSAMCRSHGGYWTMGHDPSGHIFLITLMTMFILGEL---QFFIQDAMARLLHDF 276

Query: 196 AWI 198
            W+
Sbjct: 277 NWV 279

>Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W
           (REAL)
          Length = 316

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 53/129 (41%), Gaps = 12/129 (9%)

Query: 122 YIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQ 181
           +I D +  W G +     T SA+ CR  GG W GG D SGH    T + + L  EL  + 
Sbjct: 199 FIHDQMHRWQGPL-----TTSAQ-CRRFGGHWAGGHDPSGHVFLTTLMCMFLLGELRVFG 252

Query: 182 KYISDNELRVNRKFAWIKYXXXXXXXXXXXXXXXXATYYHTVGEKVLGLVMGYTCPTVMY 241
           +        +   +A   +                A+++HTV E + GL+  Y    V+Y
Sbjct: 253 RRA------LAHLYAQKWHLLGMVTWLWQLLLTAVASHFHTVREHISGLLAAYLVTGVVY 306

Query: 242 ILIPSTTKL 250
               +  +L
Sbjct: 307 ARDAAALRL 315

>KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 363

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 136 SISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELRV 191
           S  K  S+  CR +GG W GG D SGH   +T + + L  EL    + I    LRV
Sbjct: 196 SWKKINSSNLCRSMGGYWIGGHDPSGHIFLITLMCMFLLGEL----QAIGKRALRV 247

>TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {ON}
           Anc_6.117 YGL126W
          Length = 368

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%)

Query: 142 SAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELR 190
           S+  CR LGG W GG D SGH   +T + + L  EL+ + K      LR
Sbjct: 201 SSAVCRTLGGYWVGGHDPSGHIFLITLMIMYLLGELHIFGKRAFSRILR 249

>AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL126W (SCS3)
          Length = 362

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 136 SISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQK 182
           + S  RS+  C  LGG W GG D SGH   +T + + +  EL  + +
Sbjct: 196 TASAIRSSHACSRLGGHWMGGHDPSGHVFLITLMCMFMLGELQVFGR 242

>YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protein
           required for inositol prototrophy, identified as an
           ortholog of the FIT family of proteins involved in
           triglyceride droplet biosynthesis; disputed role in the
           synthesis of inositol phospholipids from inositol
          Length = 380

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 6/56 (10%)

Query: 122 YIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYEL 177
           +I D +  W G +     T SA+ CR  GG W GG D SGH    T + + L  EL
Sbjct: 201 FIHDQMHRWQGPL-----TTSAQ-CRRFGGHWAGGHDPSGHVFLATLMCMFLLGEL 250

>Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii AAR165W
          Length = 367

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 142 SAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYEL 177
           + + CR LGG W GG D SGH   +T +++ L  EL
Sbjct: 204 NGQMCRKLGGYWTGGHDPSGHVFLITLMTMFLIGEL 239

>NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.117
           YGL126W
          Length = 381

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 136 SISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYEL 177
           SI +  ++ +CR+ GG W  G D SGH   LT + + L  EL
Sbjct: 214 SIRRINTSAQCRMHGGYWTKGHDPSGHIFLLTLMVMFLSGEL 255

>KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q75EB2 Ashbya gossypii AAR165W AAR165Wp and
           weakly similar to YGL126W uniprot|P53012 Saccharomyces
           cerevisiae SCS3 Protein required for inositol
           prototrophy
          Length = 337

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 140 TRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQK 182
            +S+  C   GG W GG D SGH   +T + ++++ EL  YQ 
Sbjct: 172 VKSSAGCSYAGGHWVGGHDPSGHIFLITLMLMLMFGELSLYQS 214

>ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 372

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 136 SISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYEL 177
           S+ +  ++  CR  GG W+GG D SGH    T + + L  EL
Sbjct: 198 SVREISTSAACRATGGHWKGGHDPSGHIFLNTLMIMFLLGEL 239

>Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa]
           {ON} YGL126W (REAL)
          Length = 380

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 41/94 (43%), Gaps = 19/94 (20%)

Query: 84  QDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSISKTRSA 143
           +D L    +S+P+   A L+   AI             +I D +  W G +     T SA
Sbjct: 176 KDALHATDASAPKN--ATLSAAAAINT-----------FIHDQMHRWQGPL-----TTSA 217

Query: 144 ERCRVLGGSWEGGFDISGHFCFLTNVSLILWYEL 177
           + CR  GG W GG D SGH    T + + L  EL
Sbjct: 218 Q-CRRFGGHWAGGHDPSGHVFLATLMCMFLLGEL 250

>CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126w SCS3 inositol phospholipid synthesis protein
          Length = 371

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 146 CRVLGGSWEGGFDISGHFCFLTNVSLIL 173
           CR+ GG W+GG D SGH   LT + L L
Sbjct: 235 CRLNGGYWQGGHDPSGHIFLLTLMILFL 262

>Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON}
           complement(1735..2928) [1194 nt, 398 aa]
          Length = 397

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 143 AERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKY 183
           +  CR  GG W GG D SGH   LT + +++  E+    K+
Sbjct: 230 SSNCRAHGGHWVGGHDPSGHMFILTLMIMLISSEIPRIIKF 270

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 143 AERCRVLGGSWEGGFDISGHFCFLTNVSLILWYEL 177
           + +C+  GG W GG D SGH   LT + +++  EL
Sbjct: 222 SSKCKRNGGHWVGGHDPSGHIFLLTLMMMMIIAEL 256

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,181,118
Number of extensions: 742956
Number of successful extensions: 1976
Number of sequences better than 10.0: 41
Number of HSP's gapped: 1950
Number of HSP's successfully gapped: 42
Length of query: 255
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 148
Effective length of database: 41,212,137
Effective search space: 6099396276
Effective search space used: 6099396276
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)