Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G08844g5.351ON74674637940.0
KLTH0H14850g5.351ON72672330330.0
Kwal_34.159795.351ON72872229610.0
TPHA0E011205.351ON73373029040.0
Smik_8.1485.351ON73172928890.0
Kpol_339.125.351ON73373128880.0
YHR072W (ERG7)5.351ON73172428610.0
Suva_15.2625.351ON73172928590.0
Skud_8.1315.351ON73172428430.0
TBLA0A031205.351ON74372628350.0
KAFR0D046705.351ON73172828320.0
KNAG0B045805.351ON72972428260.0
TDEL0E027605.351ON73172928110.0
NCAS0H016405.351ON72872828090.0
KLLA0B10175g5.351ON73172927500.0
NDAI0C019705.351ON73172827320.0
CAGL0J10824g5.351ON73372327010.0
AGR351W5.351ON72972826640.0
Ecym_81825.351ON73273026620.0
ZYRO0D10164g5.351ON73273026440.0
Suva_16.18na 1ON58379850.15
TDEL0E00250singletonON58779840.21
YLL061W (MMP1)na 2ON58379780.96
SAKL0D04048gna 1ON58689771.2
Smik_12.2na 2ON58379761.8
KAFR0B00220singletonON585137761.9
Kwal_56.22951na 1ON596108761.9
TPHA0G03770singletonON60489742.7
SAKL0B03674g4.160ON37736715.2
TDEL0B00130singletonON58488716.5
Smik_6.483na 1ON590119709.2
NCAS0E002203.576ON74285709.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G08844g
         (746 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1466   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1172   0.0  
Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1145   0.0  
TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1123   0.0  
Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1117   0.0  
Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1117   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1106   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1105   0.0  
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...  1099   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1096   0.0  
KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1095   0.0  
KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1093   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1087   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1086   0.0  
KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1063   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1056   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1045   0.0  
AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...  1030   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...  1030   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1023   0.0  
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...    37   0.15 
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                 37   0.21 
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...    35   0.96 
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...    34   1.2  
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)     34   1.8  
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}       34   1.9  
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...    34   1.9  
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...    33   2.7  
SAKL0B03674g Chr2 (334446..335579) [1134 bp, 377 aa] {ON} conser...    32   5.2  
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                 32   6.5  
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...    32   9.2  
NCAS0E00220 Chr5 (31152..33380) [2229 bp, 742 aa] {ON} Anc_3.576...    32   9.7  

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1466 bits (3794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/746 (94%), Positives = 706/746 (94%)

Query: 1   MPILVRXXXXXXXXXXXXKLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQ 60
           MPILVR            KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQ
Sbjct: 1   MPILVRTTLQATAQTAMTKLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQ 60

Query: 61  SSYVKYLLQLPDFPAPKPERTSEDPEFTAYDAAYNGAQFLQLLQEESGIFPCQYKGPMFI 120
           SSYVKYLLQLPDFPAPKPERTSEDPEFTAYDAAYNGAQFLQLLQEESGIFPCQYKGPMFI
Sbjct: 61  SSYVKYLLQLPDFPAPKPERTSEDPEFTAYDAAYNGAQFLQLLQEESGIFPCQYKGPMFI 120

Query: 121 TIGYVATCYAAGIEIPEHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRL 180
           TIGYVATCYAAGIEIPEHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRL
Sbjct: 121 TIGYVATCYAAGIEIPEHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRL 180

Query: 181 LGLPSDHIVCRRARSTLLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALP 240
           LGLPSDHIVCRRARSTLLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALP
Sbjct: 181 LGLPSDHIVCRRARSTLLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALP 240

Query: 241 IHPGRWWVHTRAVYMPVGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGI 300
           IHPGRWWVHTRAVYMPVGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGI
Sbjct: 241 IHPGRWWVHTRAVYMPVGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGI 300

Query: 301 DLYYPHTKLLDVANWGMVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAF 360
           DLYYPHTKLLDVANWGMVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAF
Sbjct: 301 DLYYPHTKLLDVANWGMVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAF 360

Query: 361 CAVVTLIEEGVDSHEFNRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXX 420
           CAVVTLIEEGVDSHEFNRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQY       
Sbjct: 361 CAVVTLIEEGVDSHEFNRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELA 420

Query: 421 XXXXXRGIIVKAYKFLCRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAI 480
                RGIIVKAYKFLCRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAI
Sbjct: 421 ELPEFRGIIVKAYKFLCRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAI 480

Query: 481 IMVRNSPAFVEYRNEISDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPA 540
           IMVRNSPAFVEYRNEISDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPA
Sbjct: 481 IMVRNSPAFVEYRNEISDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPA 540

Query: 541 EVFGNIMVEFPYVECTDSSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYG 600
           EVFGNIMVEFPYVECTDSSVLGLTYFHKHYDYR                RSQAKNGSWYG
Sbjct: 541 EVFGNIMVEFPYVECTDSSVLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYG 600

Query: 601 SWGVCFTYAGMFALEALYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYV 660
           SWGVCFTYAGMFALEALYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYV
Sbjct: 601 SWGVCFTYAGMFALEALYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYV 660

Query: 661 SSEQSLVVQTAWSVIGLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMI 720
           SSEQSLVVQTAWSVIGLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMI
Sbjct: 661 SSEQSLVVQTAWSVIGLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMI 720

Query: 721 EYPSYKFLFPIKALGLYAKRYGNDAI 746
           EYPSYKFLFPIKALGLYAKRYGNDAI
Sbjct: 721 EYPSYKFLFPIKALGLYAKRYGNDAI 746

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1172 bits (3033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/723 (77%), Positives = 612/723 (84%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           KLY+D+LGLP TD T WRL TDELG E WEYLS E+A  +PQSSYVKYLLQ PDF AP+P
Sbjct: 2   KLYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAKADPQSSYVKYLLQNPDFEAPEP 61

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQEESGIFPCQYKGPMFITIGYVATCYAAGIEIPEH 138
            R+S+  EFTA DAA+NGAQF  LLQE++GIFPCQYKGPMF+TIGYVAT Y A I +PEH
Sbjct: 62  LRSSKCDEFTAGDAAFNGAQFFSLLQEDTGIFPCQYKGPMFLTIGYVATLYCARIPVPEH 121

Query: 139 ERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLL 198
            + EI+RYIVN AHPVDGGWGLH  DKST FGT+INYVILRLLGL +DHIVC+RAR TL 
Sbjct: 122 IKIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRARKTLH 181

Query: 199 KLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPVG 258
           +LGGAIGAPHWGK WLSILNLY WEGVNPAPPELWLLPYALPIHPGRWWVHTRAVY  +G
Sbjct: 182 RLGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYQALG 241

Query: 259 YLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGMV 318
           YLSA K+CCELTPLL+EIR EIY K +++IDFSKH+NTV G+DLYYPHTKLL++AN  + 
Sbjct: 242 YLSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIANVALT 301

Query: 319 FYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFNR 378
            YE YL+PNWFL Y+N+KVYELIKKEI NTDYLCIAPV+MAFCAVVTLIEEG DS+EF R
Sbjct: 302 LYENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSYEFKR 361

Query: 379 FRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLCR 438
           F D F++VLF GPQGMT+MGTNGVQVWDCAFA+QY            R  I KAYKFLCR
Sbjct: 362 FVDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYKFLCR 421

Query: 439 SQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEISD 498
           SQFDTECEPGSFRDKRVG WPFSTKTQGYTVSDCTAEAVKAIIMVRNSP F   R EISD
Sbjct: 422 SQFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRGEISD 481

Query: 499 ERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTDS 558
           ERLYKA+DILL LQN GSFEYGSFA+YEKIKA+T +EKLNPAEVFGNIMVEFPYVECTDS
Sbjct: 482 ERLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVECTDS 541

Query: 559 SVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEALY 618
           SVLGLTYF K+Y+YR                R Q  +GSWYG WGVCFTYAGMFALEALY
Sbjct: 542 SVLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFALEALY 601

Query: 619 TVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGLL 678
           TVGENYENSEVVRKGCDF  SRQ  DGGW ES KSSELH YV ++ S VVQTAW++IGLL
Sbjct: 602 TVGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWALIGLL 661

Query: 679 LAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLYA 738
           LA+YP++ VIDRGI LLK RQLPSGEWKFE +EGVFNHSC IEYPSYKFLFPIKALGLY+
Sbjct: 662 LAKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKALGLYS 721

Query: 739 KRY 741
           KRY
Sbjct: 722 KRY 724

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1145 bits (2961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/722 (74%), Positives = 603/722 (83%)

Query: 20  LYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKPE 79
           LYS++LGLPKTD  RWRL TD LG E WEYLS  +A ++PQS+YVKYLLQLPDF APKP 
Sbjct: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61

Query: 80  RTSEDPEFTAYDAAYNGAQFLQLLQEESGIFPCQYKGPMFITIGYVATCYAAGIEIPEHE 139
                  FTA DAA+NGAQF  LLQE+SGIFPCQYKGPMF+TIGYVA  Y A + IP   
Sbjct: 62  VNKNSAHFTAKDAAFNGAQFFSLLQEDSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTPV 121

Query: 140 RHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLLK 199
           + EI+RYIVN +HPVDGGWGLH  DKST FGT INYVILRLLGL  D+IVC+RAR TL +
Sbjct: 122 KQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLHR 181

Query: 200 LGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPVGY 259
           LGGA+GAPHWGK WLSILNLY WEGVNPAPPELWLLPYALPIHPGRWWVHTRA+Y  +GY
Sbjct: 182 LGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALGY 241

Query: 260 LSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGMVF 319
           LSA K+ C +TPLL+EIR EIYT+ +++IDFSK +N VCG+DLYYPHT+LL++AN  M+F
Sbjct: 242 LSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMIF 301

Query: 320 YEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFNRF 379
           YEKYL+P+WFL Y+N+KVYELIKKEI NTDYLCIAPV+MAFCA+VTLIEEG DS+EF RF
Sbjct: 302 YEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKRF 361

Query: 380 RDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLCRS 439
            +RF+DVLF GPQGMT+MGTNGVQVWDCAFA+QY               I KAYKFLCRS
Sbjct: 362 LERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCRS 421

Query: 440 QFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEISDE 499
           QFDTECEPGSFRDKR+G WPFSTKTQGYTVSDCTAE+VKAIIMVRNSP+F   R+EISDE
Sbjct: 422 QFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISDE 481

Query: 500 RLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTDSS 559
           RLYKAMD+LL LQN GSFEYGSFA+YEKIKA+T +EKLNPAEVFGNIMVEFPYVECTDSS
Sbjct: 482 RLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDSS 541

Query: 560 VLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEALYT 619
           VLGLTYF KHY YR                 +Q  +GSWYG WG+CFTYAGMFALEAL+T
Sbjct: 542 VLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALEALHT 601

Query: 620 VGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGLLL 679
           V E YENSEVV+KGCDFLVS+Q  DGGW ES KSSELH+YV S  S  VQTAW++IGLLL
Sbjct: 602 VDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLLL 661

Query: 680 AEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLYAK 739
           AEYP+K++ID+GI LLK RQL SGEWKFE +EGVFNHSC IEYPSYKFLFPIKALGLYAK
Sbjct: 662 AEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYAK 721

Query: 740 RY 741
           +Y
Sbjct: 722 KY 723

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1123 bits (2904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/730 (73%), Positives = 596/730 (81%), Gaps = 2/730 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLST-EQAAKEPQSSYVKYLLQLPDFPAPK 77
           + YS+Q+GLPKTDP  WRL TDELGRE+WEYL   E    + QS+Y K+LLQ+PDFPAP 
Sbjct: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63

Query: 78  PERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIP 136
           P   SE   F A +A +NGA F +LLQ+  SG+FPCQYKGPMF+ IGY+A  Y AGIEIP
Sbjct: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123

Query: 137 EHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARST 196
           +HER E++RYIVN +HPVDGGWGLHS DKST FGT++NYV LRLLGL  DH VC +AR T
Sbjct: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183

Query: 197 LLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMP 256
           L++LGGAIGAPHWGKIWLS LNLY WEGVNPAPPE WLLPY+LPIHPGRWWVHTR VY+P
Sbjct: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243

Query: 257 VGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWG 316
           V YLS  K+ CELTPLL EIRTEIYTK++++IDFSKHRNTVCG+DLYYPH+KLLDVAN  
Sbjct: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303

Query: 317 MVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEF 376
           +VFYE YLRP W    + K VYELIKKEI NTDYLCIAPVN AFCA+VTLIEEG +S +F
Sbjct: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363

Query: 377 NRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFL 436
            RF+ R KD LFHGPQGMT+MGTNG QVWDCAF +QY               I  AYKFL
Sbjct: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423

Query: 437 CRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEI 496
           CRSQFDTECEPGSFRDKRVG W FSTKTQGYTVSDCTAE++KAIIMVRNSP F +  NE 
Sbjct: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483

Query: 497 SDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECT 556
           SDERLYK +DIL++LQN+GSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVECT
Sbjct: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543

Query: 557 DSSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEA 616
           DSSVLGLTYFHKHYDY+                  Q K+GSWYG WG+CFTYAGMFA+EA
Sbjct: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603

Query: 617 LYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIG 676
           L TVGENY+NSEVVRKGCDFLV +QMEDGGW ES KSSELH YVSSE+SLVVQTAW +I 
Sbjct: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663

Query: 677 LLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGL 736
           LLLA+YP K VIDRGIQLLKSRQ PSGEWKFE +EGVFNHSC IEY SY+FLFPIKALGL
Sbjct: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723

Query: 737 YAKRYGNDAI 746
           Y K YGND+I
Sbjct: 724 YVKNYGNDSI 733

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1117 bits (2889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/729 (71%), Positives = 603/729 (82%), Gaps = 1/729 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           + YS+ +GLPKTDP  WRL TDE+GRE+WEYL++EQAA EP S++ ++LLQ P+FP P+P
Sbjct: 3   EFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHPQP 62

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
           ER    P F+A+DA +NGA F +LLQE +SGIFPCQYKGPMF+TIGYVA  Y AGI+IPE
Sbjct: 63  ERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIPE 122

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
           HER EI+RYIVN AHPVDGGWGLHS DKST FGT++NYVILRLLGLP DH VC ++R+TL
Sbjct: 123 HERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNTL 182

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
           L+LGGA+G+PHWGKIWLS LNLY WEGVNPAPPE WLLPY+LP+HPGRWWVHTRAVY+PV
Sbjct: 183 LRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIPV 242

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGM 317
            YLS  KF C +TPLL+E+R EIYTK +D I FSKHRNTVCG+DLYYPH+K L++AN  +
Sbjct: 243 SYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNFV 302

Query: 318 VFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFN 377
           VFYEKYLR  +  + + +KVY+L++KEI NTD LCIAPVN AFCA+VTLIEEGVDS  F 
Sbjct: 303 VFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAFK 362

Query: 378 RFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLC 437
           +F+ RFKD LFHGPQGMT+MGTNGVQ WDCAFA+QY               IV AYKFLC
Sbjct: 363 KFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFLC 422

Query: 438 RSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEIS 497
           R+QFDTEC PGSFRDKR G W FSTKTQGY VSDCTAEA+KAIIMV+NSP F E  N IS
Sbjct: 423 RAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMIS 482

Query: 498 DERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTD 557
           +ERL++ +D+LLNLQN+GSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVECTD
Sbjct: 483 NERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTD 542

Query: 558 SSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEAL 617
           SSVLGLTYFHK++DY+                +SQ  NGSWYGSWG+CFTYAGMFALEAL
Sbjct: 543 SSVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFALEAL 602

Query: 618 YTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGL 677
           +TVGE YENS  VRKGCDFLVS+QM+DGGWGES KSSELH+YV SE+SLVVQTAW +I L
Sbjct: 603 HTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIAL 662

Query: 678 LLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLY 737
           L AEYP K VIDRGI+LLK+RQ  SGEWKFE +EGVFNHSC IEYPSY+FLFPIKALG+Y
Sbjct: 663 LFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMY 722

Query: 738 AKRYGNDAI 746
           +K Y   A+
Sbjct: 723 SKAYEQHAL 731

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1117 bits (2888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/731 (71%), Positives = 601/731 (82%), Gaps = 3/731 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           + YS+++GL KTDP  WRL TD+LGRE+WEYL+ E A K+PQSSY ++LLQ+P+FP P P
Sbjct: 3   EFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPSP 62

Query: 79  ERTS--EDPEFTAYDAAYNGAQFLQLLQEE-SGIFPCQYKGPMFITIGYVATCYAAGIEI 135
            + S  ++  +TAYDA +NGA F +LLQ+E SGIFPCQYKGPMF+TIGY+A  Y AG++I
Sbjct: 63  LKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVKI 122

Query: 136 PEHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARS 195
           P+HER E++RYIVN AHPVDGGWGLHS DKST FGT +NYV LRLLGL  DH VC +AR 
Sbjct: 123 PDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKARD 182

Query: 196 TLLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYM 255
           TL+KLGGAIGAPHWGK WLS LNLY WEGVNPAPPE WLLPY+L IHPGRWWVHTR VY+
Sbjct: 183 TLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVYL 242

Query: 256 PVGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANW 315
           P+ YLS  ++ CELTPLL E+R EIYTK +D+IDFS+HRNTVCG+DLYYPH+K+LDVAN 
Sbjct: 243 PISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVAND 302

Query: 316 GMVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHE 375
            +VFYEKYLRP W  + + + VY+LIKKEI NTDYLCIAPVN AFCA+VTLIEEG DS  
Sbjct: 303 CIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQA 362

Query: 376 FNRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKF 435
           F RF  RFKD LFHGPQGMT+MGTNGVQVWDCAFA+QY               IV+AY+F
Sbjct: 363 FKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYEF 422

Query: 436 LCRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNE 495
           LCRSQFDTEC PGSFRDKRVG W FSTKTQGYTVSDCTAEA+KAIIMVRNS  F    ++
Sbjct: 423 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHDK 482

Query: 496 ISDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVEC 555
           ISDERL K +D+L++LQN+GSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVEC
Sbjct: 483 ISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVEC 542

Query: 556 TDSSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALE 615
           TDSSVLGLT+FHKH  YR                  Q ++GSWYG WG+CFTYAGMFA+E
Sbjct: 543 TDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAME 602

Query: 616 ALYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVI 675
           ALYTVGENY NSE VRKGCDFLVS+QMEDGGWGES KSSELH+YV SE+SLVVQTAW ++
Sbjct: 603 ALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVLV 662

Query: 676 GLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALG 735
            LLLAEYPDK VIDRGIQLLK RQLPSGEWKFES+EGVFNHSC IEYPSY+FLFPIKALG
Sbjct: 663 ALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 722

Query: 736 LYAKRYGNDAI 746
           LY K Y ++ I
Sbjct: 723 LYTKAYSDNGI 733

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1106 bits (2861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/724 (71%), Positives = 597/724 (82%), Gaps = 1/724 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           + YSD +GLPKTDP  WRL TDELGRE+WEYL+ +QAA +P S++ ++LLQ P FP P P
Sbjct: 3   EFYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQPHP 62

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
           ER    P+F+A+DA +NGA F +LLQE +SGIFPCQYKGPMF+TIGYVA  Y AGIEIPE
Sbjct: 63  ERNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPE 122

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
           HER E++RYIVN AHPVDGGWGLHS DKST FGT +NYVILRLLGLP DH VC +ARSTL
Sbjct: 123 HERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARSTL 182

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
           L+LGGAIG+PHWGKIWLS LNLY WEGVNPAPPE WLLPY+LP+HPGRWWVHTR VY+PV
Sbjct: 183 LRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPV 242

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGM 317
            YLS  KF C +TPLL+E+R EIYTK +D I+FSK+RNTVCG+DLYYPH+  L++AN  +
Sbjct: 243 SYLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANSLV 302

Query: 318 VFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFN 377
           VFYEKYLR  +  + + KKVY+LIK E+ NTD LCIAPVN AFCA+VTLIEEGVDS  F 
Sbjct: 303 VFYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEAFQ 362

Query: 378 RFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLC 437
           R + RFKD LFHGPQGMT+MGTNGVQ WDCAFA+QY               IV AYKFLC
Sbjct: 363 RLQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKFLC 422

Query: 438 RSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEIS 497
            +QFDTEC PGS+RDKR G W FSTKTQGYTV+DCTAEA+KAIIMV+NSP F E  + IS
Sbjct: 423 HAQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHMIS 482

Query: 498 DERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTD 557
            ERL++ +D+LLNLQN+GSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVECTD
Sbjct: 483 SERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTD 542

Query: 558 SSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEAL 617
           SSVLGLTYFHK++DYR                +SQ  +GSWYGSWG+CFTYAGMFALEAL
Sbjct: 543 SSVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALEAL 602

Query: 618 YTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGL 677
           +TVGE YENS  VRKGCDFLVS+QM+DGGWGES KSSELH+YV SE+SLVVQTAW++I L
Sbjct: 603 HTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALIAL 662

Query: 678 LLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLY 737
           L AEYP+K+VIDRGI LLK+RQ  SGEWKFES+EGVFNHSC IEYPSY+FLFPIKALG+Y
Sbjct: 663 LFAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMY 722

Query: 738 AKRY 741
           ++ Y
Sbjct: 723 SRAY 726

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1105 bits (2859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/729 (70%), Positives = 599/729 (82%), Gaps = 1/729 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           + YS+++GLPKTDP RWRL TD+LGRE+WEYL+ EQAA +P S++ ++LLQ PDFP P P
Sbjct: 3   EFYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTPEQAANDPPSTFTQWLLQDPDFPQPHP 62

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
            +    P+F+A+DA +NGA F +LLQE +SGIFPCQYKGPMF+TIGYVA  Y AGI+IPE
Sbjct: 63  AKNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGIQIPE 122

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
           HER E++RYIVN AHPVDGGWGLHS DKST FGT +NYVILRLLGL  DH VC +AR TL
Sbjct: 123 HERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKARDTL 182

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
           L+LGGAIGAPHWGK+WLS LNLY WEGVNPAPPE WLLPY+LPIHPGRWWVHTR VY+PV
Sbjct: 183 LRLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPV 242

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGM 317
            YLS  KF C +TPLL+E+R EIYTK +D I+FS HRNTVCG+DLYYPH+K+L++AN  +
Sbjct: 243 SYLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIANNFV 302

Query: 318 VFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFN 377
           VFYEKYLR  +  + + +KVY+L+KKEI NTD LCIAPVN AFCA+VTLIEEGVDS  F 
Sbjct: 303 VFYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDSQAFK 362

Query: 378 RFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLC 437
            F+ RFKD LFHGPQGMT+MGTNGVQ WDCAFA+QY               IV AYKFLC
Sbjct: 363 DFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAYKFLC 422

Query: 438 RSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEIS 497
           RSQFDTEC PGSFRDKR G W FSTKTQGYTVSDCTAE++KAIIMVRNSP F +  + I+
Sbjct: 423 RSQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVHHLIT 482

Query: 498 DERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTD 557
           +ERL++ +D+LLNLQNVGSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVECTD
Sbjct: 483 NERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYVECTD 542

Query: 558 SSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEAL 617
           SSVLGLTYFHK +DY+                +SQ  +G WYGSWG+CFTYAGMFALEAL
Sbjct: 543 SSVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFALEAL 602

Query: 618 YTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGL 677
           +TVGE YENS  VRKGCDFLVS+QMEDGGWGES KSSELH+YV SE+SLVVQTAW++I L
Sbjct: 603 HTVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWALIAL 662

Query: 678 LLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLY 737
           L AEYP ++VIDRGI+LLK RQ  SGEWKFE +EGVFNHSC IEYPSY+FLFPIKALG+Y
Sbjct: 663 LFAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMY 722

Query: 738 AKRYGNDAI 746
            K Y  +++
Sbjct: 723 TKAYEPESL 731

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1099 bits (2843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/724 (70%), Positives = 598/724 (82%), Gaps = 1/724 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           + YS+++GLPKTDP  WRL TDELGRE+WEYL+ EQAA EP S++ ++LLQ P+F  P+P
Sbjct: 3   EFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQPQP 62

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
            R    P+F+A+DA +NGA F QLLQ+ +SGIFPCQYKGPMF+TIGYVA  Y AG++IPE
Sbjct: 63  GRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIPE 122

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
           HER EI+RYIVN AHPVDGGWGLHS DKST FGT +NYVILRLLGLP DH VC +AR TL
Sbjct: 123 HERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGTL 182

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
           L+LGGAIG+PHWGKIWLS LNLY WEGVNPAPPE WLLPY+LP+HPGRWWVHTR VY+PV
Sbjct: 183 LRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPV 242

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGM 317
            YLS  KF C +TPLL+EIR EIYTK +D IDFS HRNTVCG+DLYYPH++ LD+AN  +
Sbjct: 243 SYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNFV 302

Query: 318 VFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFN 377
           VFYEKYLR  +  + + +KVY+LIK EI NTD LCIAPVN AFCA+VT IEEGVDS  F 
Sbjct: 303 VFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAFK 362

Query: 378 RFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLC 437
           +F+ RFKD LFHGPQGMT+MGTNGVQ WDCAFA+QY               IV AYKFLC
Sbjct: 363 KFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFLC 422

Query: 438 RSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEIS 497
           R+QFDTEC PGSFR+KR G W FSTKTQGYTV+DCTAE++KAIIMV+NSP F E  + I+
Sbjct: 423 RAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLIT 482

Query: 498 DERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTD 557
            ERL++ +D+LL+LQNVGSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVECTD
Sbjct: 483 SERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECTD 542

Query: 558 SSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEAL 617
           SSVLGLTYFHK +DY+                R+Q+ +GSWYGSWG+CFTYAGMFA+EAL
Sbjct: 543 SSVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFAMEAL 602

Query: 618 YTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGL 677
           +TVGENYENS  VRKGCDFLVS+QM+DGGWGES KSSELH+YV S +SLVVQ+AW++I L
Sbjct: 603 HTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIAL 662

Query: 678 LLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLY 737
             AEYP+K+VIDRGI+LLK+RQ  SGEWKFES+EGVFNHSC IEYPSY+FLFPIKALG+Y
Sbjct: 663 FFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMY 722

Query: 738 AKRY 741
           AK Y
Sbjct: 723 AKAY 726

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/726 (71%), Positives = 600/726 (82%), Gaps = 4/726 (0%)

Query: 20  LYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKPE 79
           LYSD+L LPKTDP RWRL TD+LGRE+WEYLS E + K PQS++VK+LLQ+PDFP PKP+
Sbjct: 14  LYSDELKLPKTDPRRWRLITDKLGRESWEYLSEEDSKKIPQSTFVKWLLQIPDFPTPKPK 73

Query: 80  RTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPEH 138
               D  FT +DA  NGA F +LLQ+ ESGIFPCQYKGPMF+TIGYVA  Y AGI+IPEH
Sbjct: 74  IKQGDKNFTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIPEH 133

Query: 139 ERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLL 198
           ER EI+RYIVN AHPVDGGWGLHS DKST FGT +NYVILRLLGLP  H VC +AR TL+
Sbjct: 134 ERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKTLI 193

Query: 199 KLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPVG 258
           +LGGAIG+PHWGKIWLS+LNLY WEGVNPAPPE WLLPY+LPIHPGRWWVHTR VY+PV 
Sbjct: 194 RLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLPVS 253

Query: 259 YLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGMV 318
           YL   KF C  TPL++EIR EIY  EYDTIDFSKHRNTVCG+DLYYPH+K+LDVAN  +V
Sbjct: 254 YLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNILV 313

Query: 319 FYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFNR 378
           FYEK++RPN+  N + +KV +LI+KEI NTDYLCIAPVN AFC++V L+E+GV+S EF R
Sbjct: 314 FYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEFER 373

Query: 379 FRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLCR 438
            + RFKD LFHGPQGMT+MGTNGVQ WDCAFAVQY            + +I+++YKFLCR
Sbjct: 374 CQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFLCR 433

Query: 439 SQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEISD 498
           SQFDTEC PGSFRDKR+GGW FSTKTQGYTVSDCTAE++KAIIMVRNSPAF E  +EISD
Sbjct: 434 SQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEISD 493

Query: 499 ERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTDS 558
           ERLY+ ++IL++LQN+G FEYGSFA+YEKIKA   +E LNPAEVF NIMVE+PYVECTDS
Sbjct: 494 ERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECTDS 553

Query: 559 SVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEALY 618
           SVLGLTYFHKHYDY+                R+Q  +GSWYGSWG+CFTYA MFALEAL 
Sbjct: 554 SVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEALE 613

Query: 619 TVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSS---EQSLVVQTAWSVI 675
           T+GE+Y NSE V+KGCDF+VS+Q +DGGW E+ KSSE+H YV S   E S VVQT+WSVI
Sbjct: 614 TIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWSVI 673

Query: 676 GLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALG 735
           GL+LA YPDK V+ RGI+ +KS+QLPSGEW+F+++EGVFNHSC IEYPSY+FLFPIKALG
Sbjct: 674 GLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKALG 733

Query: 736 LYAKRY 741
           LY  RY
Sbjct: 734 LYRTRY 739

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1095 bits (2832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/728 (70%), Positives = 589/728 (80%), Gaps = 1/728 (0%)

Query: 20  LYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKPE 79
            YSD++GL KTDP  WRL TD+LGR+TW+Y+    A  +PQ+++V++LLQLP FP+P P+
Sbjct: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNPD 63

Query: 80  RTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPEH 138
             + D  FTA DA YNGA F +LLQ+  SGIFPCQYKGPMF+TIGYVA  Y AGIEIPEH
Sbjct: 64  IKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123

Query: 139 ERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLL 198
           E+ E++RYIVN AHPVDGGWGLHS DKSTAFGT+INYVILRLLGL   H VC RAR TLL
Sbjct: 124 EKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTLL 183

Query: 199 KLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPVG 258
           +LGGAIG PHWGKIWLS+LNLY WEGVNPAPPE WLLPY LPIHPGRWWVHTR VY+P+ 
Sbjct: 184 RLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPIS 243

Query: 259 YLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGMV 318
           YLS  ++  E TPLL+EIR EIY K +D I+FS+HRNTVCG+DLYYPH+ LLD AN  +V
Sbjct: 244 YLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAIV 303

Query: 319 FYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFNR 378
            YEK+LRP W    + K +YELI+KE  NTDYLCIAPVN AFCA+ TLIEEGV+S  F +
Sbjct: 304 LYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFRK 363

Query: 379 FRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLCR 438
           +++RFKD LFHGPQGMT+ GTNGVQ WDCAFA+QY               +  A+KFLCR
Sbjct: 364 YQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLCR 423

Query: 439 SQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEISD 498
           SQFDTEC PGSFRDKRVG W FSTKTQGYTVSDCTAE++KAIIMVRNSP F +  +EI+D
Sbjct: 424 SQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEITD 483

Query: 499 ERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTDS 558
           ERL K +DILL+LQN+GSFE+GSFA+YEKIKA  ++EKLNPAEVFGNIMVE+PYVECTDS
Sbjct: 484 ERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTDS 543

Query: 559 SVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEALY 618
           SVLGLTYFH+HY YR                 +Q  +GSWYGSWG+CFTYAGMFA+EAL 
Sbjct: 544 SVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEALQ 603

Query: 619 TVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGLL 678
           +VGE YENS+ V KGCDFLVS+QM DGGW ES KSSELH YVS+++SLVVQTAW +I LL
Sbjct: 604 SVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIALL 663

Query: 679 LAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLYA 738
           LA+YPDK+VIDRGI LLKSRQ PSGEWKFES+EGVFNHSC IEYPSY+FLFPIKALGLY 
Sbjct: 664 LAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723

Query: 739 KRYGNDAI 746
           K YG   I
Sbjct: 724 KEYGAQGI 731

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1093 bits (2826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/724 (70%), Positives = 591/724 (81%), Gaps = 6/724 (0%)

Query: 20  LYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKPE 79
           LYS+QLGLP+TDP RWRL TDELGRETW+Y+  +Q   +PQSS+ ++LLQ+ D     P+
Sbjct: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65

Query: 80  RTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPEH 138
                   TA+D+  NGA F + LQ+  SG+FPCQYKGPMF+TIGY+A  Y AGIEIP+H
Sbjct: 66  EP-----VTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPKH 120

Query: 139 ERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLL 198
           ER EI+RYIVN +HPVDGGWGLHS DKST FGT +NYVILRLLGL  DH VC +AR TLL
Sbjct: 121 ERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTLL 180

Query: 199 KLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPVG 258
           +LGGAIGAPHWGKIWLS+LNLY WEGVNPAPPE WLLPY LPIHPG+WWVHTR VY+P+ 
Sbjct: 181 RLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPIS 240

Query: 259 YLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGMV 318
           YLS   + CELTPLL+EIR EIYTK +D+IDFSKHRNTVCG+DLYYPH+K+LD+AN  ++
Sbjct: 241 YLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAII 300

Query: 319 FYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFNR 378
           FYEKYLRP W    +  KVY LI+KEI NTDYLCIAPVN AFCA+VTLIEEGVDS  F +
Sbjct: 301 FYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFTK 360

Query: 379 FRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLCR 438
           FR RFKD LFHGPQGMT+MGTNGVQ WDCAFAVQY               IV AY+FL R
Sbjct: 361 FRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLIR 420

Query: 439 SQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEISD 498
           SQFDTEC PGSFRDKR G W FSTKTQGYTVSDCTAEA+KAIIMV+N+P F +  +EI D
Sbjct: 421 SQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIED 480

Query: 499 ERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTDS 558
            RLY+ +D+LL+LQN GSFEYGSFA+YEKIKA  ++EKLNPAEVFGNIM+E+PYVECTDS
Sbjct: 481 SRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTDS 540

Query: 559 SVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEALY 618
           SVLGLT+FHK+Y YR                R+Q  +GSWYG WG+C+TYAGMFALEAL+
Sbjct: 541 SVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFALEALH 600

Query: 619 TVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGLL 678
           +V ENY NS +VRKGCDFLVS+Q+ DGGWGES KSSELH+YVS+ +SLVVQTAW+VI LL
Sbjct: 601 SVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIALL 660

Query: 679 LAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLYA 738
           LAEYPDKKVI+RGI+LL+SRQLPSGEWKFES+EGVFNHSC IEYPSY+FLFPIKALGLY 
Sbjct: 661 LAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYN 720

Query: 739 KRYG 742
           K Y 
Sbjct: 721 KTYA 724

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/729 (70%), Positives = 584/729 (80%), Gaps = 1/729 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           + YS++LGL +TDP  WRL TDELGRETW YL+ EQA  + Q ++ ++LLQ   FP P P
Sbjct: 3   QFYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAKNDEQCTFTQWLLQSEKFPKPSP 62

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
            R S   +F A DA  NGA F +LLQ+  SGIFPCQYKGPMF+TIGYVA  Y +G  IPE
Sbjct: 63  NRHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGTTIPE 122

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
           HER EI+RYIVN AHPVDGGWGLHS DKSTAFGT +NYVILRLLGLP DH VC +AR+ L
Sbjct: 123 HERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKARALL 182

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
           +KLGGAIGAPHWGKIWLS+LNLY WEGVNPAPPE+WLLPYALPIHPGRWWVHTRA+Y+PV
Sbjct: 183 MKLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAIYLPV 242

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGM 317
            YLS  ++ C L  LL+E+R+EIY K +D+I+FS +RNTVCGIDLYYPHT +L++AN  M
Sbjct: 243 SYLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMANNVM 302

Query: 318 VFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFN 377
           VFYEK+LRPNW       +VY LIKKEI NTDYLCIAPVN AFCA+VT IEEG +S  F 
Sbjct: 303 VFYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKESSAFK 362

Query: 378 RFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLC 437
           +F DR KD LFHGPQGMT+MGTNGVQ WDCAFA+QY               I  AYKFLC
Sbjct: 363 KFEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAYKFLC 422

Query: 438 RSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEIS 497
           R+QFDTEC  GSFRDKRVG WPFSTK QGYTVSDCTAEA+KAIIMVRNSP F   RNEI+
Sbjct: 423 RTQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIRNEIT 482

Query: 498 DERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTD 557
           DERL K +D+LL+LQN+ SFEYGSFA+YEKIKA   +EKLNPAEVFGNIMVEFPYVECTD
Sbjct: 483 DERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYVECTD 542

Query: 558 SSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEAL 617
           SSVLGLTYFH  YDYR                R Q ++GSWYG WGVC++YAGMFA+EAL
Sbjct: 543 SSVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFAMEAL 602

Query: 618 YTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGL 677
           ++VGENY NSE VRKGCDFLVSRQ+ DGGWGES KSSELH+YVS+ +SLVVQTAW +I L
Sbjct: 603 HSVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWVLIAL 662

Query: 678 LLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLY 737
           LL +YP+K VID GI+LLK RQL +GEWKFE IEGVFNHSC IEYPSY+FLFPIKALGLY
Sbjct: 663 LLGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKALGLY 722

Query: 738 AKRYGNDAI 746
              YG+D+I
Sbjct: 723 TATYGDDSI 731

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/728 (71%), Positives = 594/728 (81%), Gaps = 5/728 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           KLYSD+LGL KTDPTRWRL T+ LGR TWEY+++EQ   +PQS++ K+LLQLPDFPAP P
Sbjct: 4   KLYSDELGLQKTDPTRWRLRTNPLGRHTWEYINSEQKTNDPQSTFTKWLLQLPDFPAPTP 63

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
             T+E+P  TA +A Y+GA F +LLQ+ ESG FPCQYKGPMF+TIGYVA  Y AG+EIP 
Sbjct: 64  --TTEEPR-TAREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGLEIPN 120

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
           HER EI+RY+VN AHPVDGGWGLHS DKST FGT INYVILRLLG+  DHIVCRRAR TL
Sbjct: 121 HERIEIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRARKTL 180

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
           L LGGAIGAPHWGK+WLS+LNLY WEGVNPAPPE WLLPY LPIHPGRWWVHTR VY+P+
Sbjct: 181 LSLGGAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGVYLPI 240

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKE-YDTIDFSKHRNTVCGIDLYYPHTKLLDVANWG 316
            YLS   F CELTPLLKEIR EIYT + ++ I F+++RN VCG+DLYYPH+++LDVAN  
Sbjct: 241 SYLSLVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDVANAC 300

Query: 317 MVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEF 376
           +V YE+YLRP W    + +KVYELIKKEI+NTDYLCIAPVN AFCA+VTLIEEGVDS+ F
Sbjct: 301 IVKYEEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVDSNAF 360

Query: 377 NRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFL 436
            +F  RFKD LFHGPQGMT+MGTNGVQVWDCAFA+QY               I  AY FL
Sbjct: 361 QKFSYRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASAYAFL 420

Query: 437 CRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEI 496
           CRSQFDTEC  GSFRDKRVG W FSTKTQGYTVSDCTAE++KAIIMV+NSP F    + I
Sbjct: 421 CRSQFDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAIHHLI 480

Query: 497 SDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECT 556
           +DE++Y+ +D+LL+LQNVGSFEYGSFA+YEKIKA   +EKLNPAEVFGNIMVE+PYVECT
Sbjct: 481 TDEKIYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPYVECT 540

Query: 557 DSSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEA 616
           DSSVLGLTYFH +Y+YR                  QA +GSWYGSWG+C+TYAGMFA+EA
Sbjct: 541 DSSVLGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMFAMEA 600

Query: 617 LYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIG 676
           L++VGE Y NS VV+KGCDFLV+RQM DGGWGE  KSSELH YV+SE+S VVQTAW VI 
Sbjct: 601 LHSVGECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAWVVIA 660

Query: 677 LLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGL 736
           LLLA+YP K VI +G++LLKSRQ PSGEWKFES EGVFNHSC IEYPSY+ LFPIKALGL
Sbjct: 661 LLLAKYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIKALGL 720

Query: 737 YAKRYGND 744
           YA+ Y  +
Sbjct: 721 YAEIYDKE 728

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1063 bits (2750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/729 (67%), Positives = 583/729 (79%), Gaps = 1/729 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           +LYS+ +GLP+TDP RWRL TD+LGR+TWEYLS   + K PQS++ ++LL+  DFP P P
Sbjct: 3   ELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHP 62

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
           E  S+   FTA++AA+NGA+F +LLQ+ +SG FPCQYKGPMF+TIGYV T Y A IEIPE
Sbjct: 63  EINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPE 122

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
           HE+ E++RY+ N AHPVDGGWGLH  DKST  GT +NYV++RLLGLP DH VC RAR TL
Sbjct: 123 HEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTL 182

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
           L+LGGAI +PHW KIWLSILNLY WEGVNPAPPELW+LPY L IHP RWWVHTR +Y+PV
Sbjct: 183 LRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPV 242

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGM 317
            YLS+ ++ CEL PLL+EIRTEIYT+ ++TIDF KHRNTVCG+DLYYPHTK+LD  N+ +
Sbjct: 243 SYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFI 302

Query: 318 VFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFN 377
             YE+Y+RPNW L  +  +VYEL+KKEI NTDYLCIAPVN AFCA+VTLIEEG DS EF 
Sbjct: 303 SKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFG 362

Query: 378 RFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLC 437
           RF  RFKDVLFHGPQG+T+MGTNGVQVWDCAF +QY               IV+++KFLC
Sbjct: 363 RFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLC 422

Query: 438 RSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEIS 497
           RSQF  +C  GSFRDKR+G WPFSTKTQGYTVSDCTAEA+KAIIMV NS  + +      
Sbjct: 423 RSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYD 482

Query: 498 DERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTD 557
            E+L   +D+LL LQN+ SFEYGSFA+YEKIKA  L+EKLNPAEVFGNIMVEFPYVECTD
Sbjct: 483 TEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTD 542

Query: 558 SSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEAL 617
           SSVLGLTYF ++++YR                +SQ  NGSWYG WG+C+TYAGMFALEAL
Sbjct: 543 SSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEAL 602

Query: 618 YTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGL 677
            T+GE YENSEVVRKGCDF V++Q+ DGGW E  KSSELH YVS ++S VVQTAW +IGL
Sbjct: 603 NTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIGL 662

Query: 678 LLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLY 737
           +LA++PDK VIDR I LLK RQ PSGEWK+E++EGVFNHSC IEYPSY+FLFPIKALGLY
Sbjct: 663 ILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGLY 722

Query: 738 AKRYGNDAI 746
            K YG+ AI
Sbjct: 723 VKEYGHSAI 731

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/728 (69%), Positives = 586/728 (80%), Gaps = 3/728 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           KLYS++LGL KTDP  WRL T+  GR++WEY++ +Q+  +PQS++ K+LLQLPDFP P+ 
Sbjct: 4   KLYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDPQSNFTKWLLQLPDFPTPQY 63

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQEE-SGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
               +D   +A      GA+F +LLQ+E SG FPCQYKGPMF+TIGYVA  Y A I+IPE
Sbjct: 64  PDNIKD--VSAEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADIKIPE 121

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
            ER EI+RYIVN AHPVDGGWGLHSEDKST FGT +NY+ILRLLGL ++H VC +AR TL
Sbjct: 122 SERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKARDTL 181

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
           L+LGGAI APHWGK+WLS+LNLY WEGVNPAPPE WLLPY +PIHPGRWWVHTR VY+P+
Sbjct: 182 LRLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGVYLPI 241

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGM 317
            YLS   + CELT LLKEIR+EIY K +D+IDFSKHRNTVCG+DLYYPH+K LD AN  +
Sbjct: 242 SYLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFANSLI 301

Query: 318 VFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFN 377
           V YEKYLRPN   +Y+  KVY+LIKKEI NTDYLCIAPVN AFCA+VTL+EEG DS  F 
Sbjct: 302 VPYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADSKAFE 361

Query: 378 RFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLC 437
           RF+ RFKD LF GPQGMT+MGTNGVQ WDCAFA+QY               I  AYKFLC
Sbjct: 362 RFQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAYKFLC 421

Query: 438 RSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEIS 497
           RSQFDT+C  GSFRDKR G W FSTKTQGYTVSDCTAE++KAIIMVRNS  F +  +EIS
Sbjct: 422 RSQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIHDEIS 481

Query: 498 DERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTD 557
           DERLYKA+DILL+LQN GSFE+GSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVECTD
Sbjct: 482 DERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYVECTD 541

Query: 558 SSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEAL 617
           SSVLGLT FHKHY+YR                + Q  +GSWYGSWG+C+TYAGMFA+EAL
Sbjct: 542 SSVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFAMEAL 601

Query: 618 YTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGL 677
           ++VGE Y NS VV+KGCDFLV+RQ+EDGGWGES KSSELH YVS+++SLVVQTAW V+ L
Sbjct: 602 HSVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVLAL 661

Query: 678 LLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLY 737
           LLA+YP+K +ID+GI LLK RQ  SGEWKFES EGVFNHSC IEYPSY+FLFPIKALGLY
Sbjct: 662 LLAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALGLY 721

Query: 738 AKRYGNDA 745
           ++ Y ++A
Sbjct: 722 SQIYEHNA 729

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/723 (69%), Positives = 579/723 (80%), Gaps = 3/723 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           + YSD +G+P+TDP RWRL T ELGRE WEY+  ++   +PQS++V++LLQ  +FP P P
Sbjct: 3   QFYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQSTFVQWLLQDEEFPTPSP 62

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQEE-SGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
            +  +D   ++  A Y GA F +LLQ++ SGIFPCQYKGPMF+TIGYVA  Y AG+++PE
Sbjct: 63  RKEGDD--LSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGVKLPE 120

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
           HER E++RYIVN AHPVDGGWGLHS DKST FGT +NYV LRLLGLP DHIVC RAR TL
Sbjct: 121 HERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRARHTL 180

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
            +LGGA GAPHWGKIWLSILNLY WEGVNPAPPE WLLPY+LPIHPGRWWVHTRAVY+PV
Sbjct: 181 HRLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAVYLPV 240

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGM 317
            YLS  K+ C LT LL EIR EIYTK +D I+FS+HRNTVCG+DLYYPH+K+LD AN  +
Sbjct: 241 SYLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTANDVI 300

Query: 318 VFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFN 377
           VFYEKYLRP      + K VY LIKKEI NTD LCIAPVN AFCA+VT +EEG DS  F 
Sbjct: 301 VFYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDSKAFE 360

Query: 378 RFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLC 437
           RF+ RFKD LFHGPQGMT+MGTNGVQ WDCAF +QY            R +I+ AYKFLC
Sbjct: 361 RFQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAYKFLC 420

Query: 438 RSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEIS 497
           RSQFDTEC  GSFRDKRVG W FSTKTQGYTVSDCTAEA+KAIIMVRNSP F    +EI+
Sbjct: 421 RSQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVHDEIT 480

Query: 498 DERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTD 557
           DERL K +D+LL+LQN+G FEYGSFA+YEKIKA   +EKLNPAEVFGNIMVE+PYVECTD
Sbjct: 481 DERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYVECTD 540

Query: 558 SSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEAL 617
           SSVLGLTYFHK+YDYR                ++Q  +G WYG WG+CFTYAGMFA+EAL
Sbjct: 541 SSVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFAMEAL 600

Query: 618 YTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGL 677
           ++VGE Y+NS  VRKGCDFL+S+QM DGGWGES KSSELH+YV S +SLVVQTAW++I L
Sbjct: 601 HSVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWALIAL 660

Query: 678 LLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLY 737
           LLA+ P++  I+RGI LLKSRQ PSGEWKFES EGVFNHSC IEYPSY+FLFPIKALGLY
Sbjct: 661 LLAKCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALGLY 720

Query: 738 AKR 740
             R
Sbjct: 721 NGR 723

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score = 1030 bits (2664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/728 (65%), Positives = 582/728 (79%), Gaps = 1/728 (0%)

Query: 20  LYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKPE 79
           LYSD+LGLP TD  RWRL  DE+G E WEY+  ++ +K PQ++ V++LL +P FP P+PE
Sbjct: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61

Query: 80  RTSEDPEFTAYDAAYNGAQFLQLLQEE-SGIFPCQYKGPMFITIGYVATCYAAGIEIPEH 138
            +S+D  FTA +AAYNGA+FL LLQ+E SG FPC Y+GPMF+TIGYV   +  G+ IPE 
Sbjct: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121

Query: 139 ERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLL 198
           +R E+VRY+VN AHPVDGGWGLHSEDKST  GT++NYV+LRLLG+  +HIV +RAR TLL
Sbjct: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181

Query: 199 KLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPVG 258
           ++GGAIG+P+WGK+WLS+LNLY WEGVNPAPPELWLLPY  P HP RWWVHTRA+++P+ 
Sbjct: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241

Query: 259 YLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGMV 318
           YL+  ++ C LTPLL+EIR+EI+T+ ++ IDF+ +RN VCGIDLYYPHT +L+  N  +V
Sbjct: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301

Query: 319 FYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFNR 378
            YEKYLRPNW L Y+  ++YELIK EI NTDYLCIAPVN A  A+VT IEEG DS EF R
Sbjct: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361

Query: 379 FRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLCR 438
           F DRFK+VLF GPQGM +MGTNGVQVWDCAF +Q                IV+AY+FLCR
Sbjct: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421

Query: 439 SQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEISD 498
           SQ   +C PGS+RD R+G WPFSTKTQGY VSDCTAEA K++++VRNSP F E R+EIS 
Sbjct: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481

Query: 499 ERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTDS 558
           E+L KA+D LL LQN+GSF+YGSFASYEKI+A   IE LN AEVF NIMVE PYVECTDS
Sbjct: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541

Query: 559 SVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEALY 618
           SVLGL+++ K++DYR                 +Q K+GSWYG WG+C+TYAGMFALEAL+
Sbjct: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601

Query: 619 TVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGLL 678
             GE+Y +SEVV+KGC+FLVS+Q+ DGGW E+ KSSELH YVS ++S VVQTAW++IGLL
Sbjct: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661

Query: 679 LAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLYA 738
           LA+YPD+KVIDRGIQLLK RQLPSGEWK+ESIEGVFNHSC IEYPSY+F+FPIKALG+Y+
Sbjct: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721

Query: 739 KRYGNDAI 746
           K+Y  DA+
Sbjct: 722 KKYAKDAL 729

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/730 (65%), Positives = 577/730 (79%), Gaps = 2/730 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           +LYSD LGLP TDP+RWRL+   LG  +W+Y+S   + K PQ +  K+LL   +F  P+P
Sbjct: 3   ELYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSKKIPQCNCTKWLLNADNFSTPEP 62

Query: 79  ERTSEDPEFTAYDAAYNGAQFLQLLQ-EESGIFPCQYKGPMFITIGYVATCYAAGIEIPE 137
           +  + D  F AY+AAYNGA FL+LLQ ++SG FP QYKGPMF+TI YV + Y    EIPE
Sbjct: 63  DVGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRKEIPE 122

Query: 138 HERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
            E+ EI+RYIVN AHPVDGGWGLH+  KST FGT +NY++LRLLG+  DH+VCRRARSTL
Sbjct: 123 CEKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRARSTL 182

Query: 198 LKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPV 257
            +LGGAIGAPHWGKIWLSILNLY WEGVNPAP E W LPY +PIHP RWW+HTRA+Y+P+
Sbjct: 183 HRLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAIYLPM 242

Query: 258 GYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGM 317
            YL    + CELTPLL+EIR EIYT  +D I FSKHRNTVC +DLY+PH+ +L+V N  +
Sbjct: 243 SYLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVINSAI 302

Query: 318 VFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFN 377
           V+Y+ YLRP+W + Y+NKKVYELI+KEI NT+YLC+APV+ AFC++VT IEEG DS EF 
Sbjct: 303 VWYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADSPEFE 362

Query: 378 RFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFLC 437
           R  + F   +FHGPQGMT+MGTNG QVWDC+F VQY            +  +  AYKFLC
Sbjct: 363 RLMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAYKFLC 422

Query: 438 RSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEIS 497
           RSQF  EC  GS+RDKRVGGWPFSTKTQGYTVSDCTAEA+KA+IMV+ SP F    +EIS
Sbjct: 423 RSQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIHDEIS 482

Query: 498 DERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTD 557
           +E L KA+D+LL+LQNVGS EYGSFA+YEKI+A  ++EKLNPAEVF NIMVE+PYVECTD
Sbjct: 483 EEALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYVECTD 542

Query: 558 SSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEAL 617
           S +LGLTYF ++YDYR                + Q K+GSWYG WG+C+TYAGMFALEAL
Sbjct: 543 SCILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFALEAL 602

Query: 618 YTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQ-SLVVQTAWSVIG 676
           YT+GENYENSEVVR+GCDFLV +Q+ DGGW ES KS+EL  Y++ ++ SLVV T+W++IG
Sbjct: 603 YTIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSWALIG 662

Query: 677 LLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGL 736
           LLLA+YPDK+VIDRGIQLLKSRQL SGEWKFE IEG+FNHSC IEYP+Y+FLFPIKALG+
Sbjct: 663 LLLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIKALGI 722

Query: 737 YAKRYGNDAI 746
           YAK+YG  AI
Sbjct: 723 YAKKYGKRAI 732

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/730 (65%), Positives = 576/730 (78%), Gaps = 2/730 (0%)

Query: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKP 78
           KLYS++L L +TDP  WRL  D+LGRE+WEY+S E A  +PQS YV++LLQLP FP P P
Sbjct: 3   KLYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQSKYVQWLLQLPSFPKPSP 62

Query: 79  E-RTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIP 136
           +  +    +F A +A  NGA F QLLQ+ +SGIFPCQYKGPMF+TIGYV   Y AGIEIP
Sbjct: 63  KIHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGIEIP 122

Query: 137 EHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARST 196
           + +R E++RYIVN +HPVDGGWGLHS DKST FGT+INYV LRLLGLP DH VC +AR T
Sbjct: 123 KPKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKARRT 182

Query: 197 LLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMP 256
           L KLGGA+GAPHWGKIWLS+LNLY WEGVNPAPPE WLLPY LPIHPGRWWVHTRA+Y+P
Sbjct: 183 LHKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAIYLP 242

Query: 257 VGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWG 316
           V YLS  ++ C LTPLL+E+R E+Y K +++IDF  +RNTVCG+DLYYPH+K+LD+ N  
Sbjct: 243 VSYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLMNSV 302

Query: 317 MVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEF 376
           +VFYEK+LR NW       +VY LIKKEI NTDYLCIAPVN AFCA+VTLIEEGV+S +F
Sbjct: 303 LVFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNSPQF 362

Query: 377 NRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYXXXXXXXXXXXXRGIIVKAYKFL 436
            RF+ RF D LFHGPQGMT+MGTNGVQ WDCAF +Q                +V+AY+FL
Sbjct: 363 KRFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAYEFL 422

Query: 437 CRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEI 496
            R+QF  EC PGSFRD R G W FSTKTQGYTVSDCTAE++KAIIMV+ SP + +  + I
Sbjct: 423 NRAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVHSLI 482

Query: 497 SDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECT 556
            DERL +A+D+LL+LQNVG FEYGSFA+YE IKA  L+EKLNPAEVFGNIMVE+PYVECT
Sbjct: 483 DDERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVECT 542

Query: 557 DSSVLGLTYFHKHYDYRXXXXXXXXXXXXXXXXRSQAKNGSWYGSWGVCFTYAGMFALEA 616
           DS+VLGLT FH + DYR                + Q ++GSWYG WGVCFTYAGMFALEA
Sbjct: 543 DSAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFALEA 602

Query: 617 LYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIG 676
           L++VGE+Y NS++V+KGCDFLV RQM DGGWGE+ KS ELH YV S++S+VVQT+W +I 
Sbjct: 603 LHSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWVIIA 662

Query: 677 LLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGL 736
           LLL++YP+K VIDR ++ L++RQ  SGEWKF+ +EGVFNHSC IEYP+Y+F+FPIKALGL
Sbjct: 663 LLLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKALGL 722

Query: 737 YAKRYGNDAI 746
           Y   +G +AI
Sbjct: 723 YVNAFGKEAI 732

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 152 HPVDGGWGLHSE---DKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLLKLGGAIGAPH 208
           +PV G + LH+    D S  F   INY+++ L+  PS+ + C     T+     ++    
Sbjct: 131 YPVSGSYALHASRFIDPSAGFSVGINYLLMWLISFPSELVGCSL---TMTYWAPSVNPAV 187

Query: 209 WGKIWLS---ILNLYGWEG 224
           W  I  +   +LNL+G  G
Sbjct: 188 WVAIAFTLSMLLNLFGARG 206

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 9/79 (11%)

Query: 152 HPVDGGWGLHSE---DKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLLKLGGAIGAPH 208
           +PV G + LH+    D S  F   +NY+++ L+  PS+ + C     TL     ++    
Sbjct: 135 YPVSGSYALHASRFIDPSVGFSVGMNYLLMWLVSFPSELVGCSL---TLSYWNNSVNPAV 191

Query: 209 WGKI---WLSILNLYGWEG 224
           W  I   ++ +LNL+G  G
Sbjct: 192 WVAIFFVFVMLLNLFGVRG 210

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 152 HPVDGGWGLHSE---DKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLLKLGGAIGAPH 208
           +PV G + LH+    D S  F   INY+++ L+  PS+ + C     T+     ++    
Sbjct: 131 YPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSL---TISYWAPSVNPAA 187

Query: 209 WGKIWL---SILNLYGWEG 224
           W  I      +LNL+G  G
Sbjct: 188 WVAIAFVLSMLLNLFGARG 206

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 38/89 (42%), Gaps = 11/89 (12%)

Query: 152 HPVDGGWGLHSE---DKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLLKLGGAIGAPH 208
           +PV G +  H     D S  F  S NY +  L+  PS+ I C     TL     ++    
Sbjct: 134 YPVSGSFATHVSRFIDSSVGFTVSTNYALAWLISFPSELIGC---AITLRYWNDSVNPAV 190

Query: 209 WGKI---WLSILNLYGWEGVNPAPPELWL 234
           W  I   ++  LNL+G  G   A  E WL
Sbjct: 191 WIAIFYVFIMCLNLFGVRGF--AETEFWL 217

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 152 HPVDGGWGLHSE---DKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLLKLGGAIGAPH 208
           +PV G + LH+    D S  F   INY+++ L+  PS+ + C     T+     ++    
Sbjct: 131 YPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSL---TISYWAPSVNPAA 187

Query: 209 WGKIWL---SILNLYGWEG 224
           W  I      +LN++G  G
Sbjct: 188 WVAIAFVLSMLLNMFGARG 206

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 54/137 (39%), Gaps = 35/137 (25%)

Query: 118 MFITIGYVAT----CYAAGIEIPEHERHEIVRYIVNMA--HPVDGGWGLHSE---DKSTA 168
           +FI +GY       C   G  +       +V+    ++  +PV G +  H     D+S  
Sbjct: 93  LFIGLGYSLASGPGCLLIGFILVGLSMFCVVQSAAELSCQYPVSGSYATHVTRFIDESIG 152

Query: 169 FGTSINYVILRLLGLPSDHIVCRRARSTLLKLGGAIGAPHWG-----KIWLSI------- 216
           F  S NY +  L+  PS+             +G A+   +W       +W++I       
Sbjct: 153 FTVSTNYALAWLISFPSEL------------MGSAMVIQYWNDSVDPAVWIAIFYLFVMF 200

Query: 217 LNLYGWEGVNPAPPELW 233
           LNL+G EG   A  E W
Sbjct: 201 LNLFGVEGF--AETEFW 215

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 45/108 (41%), Gaps = 30/108 (27%)

Query: 143 IVRYIVNMA--HPVDGGWGLHSE---DKSTAFGTSINYVILRLLGLPSDHIVCRRARSTL 197
           +V+    MA  +PV G +  H     + S  F  S NY +  L+  PS+ I C       
Sbjct: 131 VVQSAAEMACQYPVSGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPSELIGC------- 183

Query: 198 LKLGGAIGAPHW----GKIWLSI-------LNLYGWEGVNPAPPELWL 234
                AI   +W    G +W++I       LNL+G  G   A  E W+
Sbjct: 184 -----AITLRYWSSVNGAVWVAIFYVFIMQLNLFGVRGYGEA--EFWM 224

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 11/89 (12%)

Query: 152 HPVDGGWGLHSE---DKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLLKLGGAIGAPH 208
           +PV G +  H     D+S  F  S NY +  L+  PS+ I       T+     +I    
Sbjct: 152 YPVSGSYATHVSRFLDESLGFTVSTNYALAWLISFPSELI---GISMTISYWNDSINPCV 208

Query: 209 WGKI---WLSILNLYGWEGVNPAPPELWL 234
           W  I   ++ ILNL+G +G   A  E WL
Sbjct: 209 WIAIFYVFIMILNLFGVKGF--AETEFWL 235

>SAKL0B03674g Chr2 (334446..335579) [1134 bp, 377 aa] {ON} conserved
           hypothetical protein
          Length = 377

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 311 DVANWGMVFYEKYLRPNWFLNYTNKKVYELIKKEIT 346
           +++N G V Y++  R NW L YT K+  E+  KEIT
Sbjct: 267 NISNMGCVLYKRSTRGNWDLCYTFKR--EITNKEIT 300

>TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 27/88 (30%)

Query: 152 HPVDGGWGLHSE---DKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLLKLGGAIGAPH 208
           +PV G +  H     D+S  F  S NY +  L+  PS+ I C            +I   +
Sbjct: 132 YPVSGSYATHVSRFVDESVGFTVSTNYALAWLISFPSELIGC------------SITITY 179

Query: 209 WGK-----IWLSI-------LNLYGWEG 224
           W +     +W++I       LNL+G  G
Sbjct: 180 WNQSVNPAVWVAIFYIFIMGLNLFGVRG 207

>Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W
           (REAL)
          Length = 590

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 118 MFITIGY-VATCYAA---GIEIPEHERHEIVRYIVNMA--HPVDGGWGLHSE---DKSTA 168
           +FI +GY +A+  AA   G  I       +V+    ++   PV G +  H     D+S  
Sbjct: 98  LFIGLGYSLASGPAALLIGFLIVGTSMFCVVQSAAELSCQFPVSGSYATHVSRFIDESVG 157

Query: 169 FGTSINYVILRLLGLPSDHIVCRRARSTLLKLGGAIGAPHWGKI---WLSILNLYGWEG 224
           F  + NY +  L+  PS+ I C     T+      +    W  I   ++ +LNL+G +G
Sbjct: 158 FTVATNYALAWLISFPSELIGCSL---TISYWNQTVNPAVWVAIFYTFIMVLNLFGVKG 213

>NCAS0E00220 Chr5 (31152..33380) [2229 bp, 742 aa] {ON} Anc_3.576
           YGL249W
          Length = 742

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 13/85 (15%)

Query: 269 LTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKL---------LDVANWGMVF 319
           L  L+KE +  I   EYD +  S  R     I LY  H  L          ++A W M+ 
Sbjct: 604 LQKLIKEYKRVIVLVEYDQVLLSVDREIFWKIQLYLSHLALEVHFVGSTTKEIAKWIMIL 663

Query: 320 YEKYLRPNWFLNYTNKKVYELIKKE 344
             KY       N+T   VY++++++
Sbjct: 664 SSKYAT----CNFTELPVYDMVQED 684

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,720,183
Number of extensions: 3316936
Number of successful extensions: 7199
Number of sequences better than 10.0: 34
Number of HSP's gapped: 7254
Number of HSP's successfully gapped: 34
Length of query: 746
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 629
Effective length of database: 40,065,477
Effective search space: 25201185033
Effective search space used: 25201185033
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)