Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G04950g5.528ON56754321160.0
KLTH0G03784g5.528ON5692054761e-51
Kwal_47.186315.528ON5842184682e-50
TDEL0A039205.528ON4662873929e-41
KNAG0B036805.528ON4821663568e-36
KLLA0A01760g5.528ON5831593404e-33
ZYRO0D12584g5.528ON5791723379e-33
NDAI0C010605.528ON637863159e-30
Kpol_1023.975.528ON5911653141e-29
NCAS0H025605.528ON587643077e-29
KAFR0C054005.528ON4811803021e-28
CAGL0H04631g5.528ON5881903014e-28
Kpol_1004.225.528ON4751822904e-27
YML007W (YAP1)5.528ON6502332936e-27
Suva_13.1555.528ON6451962901e-26
Smik_13.1445.528ON639642891e-26
Skud_13.1475.528ON665632892e-26
TBLA0G009305.528ON608552661e-23
TPHA0D023405.528ON5061882641e-23
TPHA0K005205.528ON560642472e-21
NCAS0F011005.528ON4751072231e-18
Ecym_40645.528ON426841864e-14
TBLA0D016405.528ON599611884e-14
ADR195C5.528ON288931594e-11
CAGL0F03069g5.528ON486861511e-09
KNAG0C032105.528ON3841031438e-09
KAFR0E032905.528ON265991391e-08
NDAI0H016105.528ON519651421e-08
YDR423C (CAD1)5.528ON4091151383e-08
Smik_4.6985.528ON393531223e-06
Suva_2.600singletonOFF382531214e-06
YPR199C (ARR1)na 1ON29455790.41
Skud_13.6singletonON31090770.78
NOTE: 1 genes in the same pillar as SAKL0G04950g were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G04950g
         (567 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   819   0.0  
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   187   1e-51
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   184   2e-50
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   155   9e-41
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   141   8e-36
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   135   4e-33
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   134   9e-33
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   125   9e-30
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   125   1e-29
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   122   7e-29
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   120   1e-28
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   120   4e-28
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...   116   4e-27
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   117   6e-27
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   116   1e-26
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   115   1e-26
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   115   2e-26
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   107   1e-23
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...   106   1e-23
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....   100   2e-21
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    91   1e-18
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    76   4e-14
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    77   4e-14
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    66   4e-11
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    63   1e-09
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    60   8e-09
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    58   1e-08
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    59   1e-08
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    58   3e-08
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    52   3e-06
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    51   4e-06
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    35   0.41 
Skud_13.6 Chr13 (6426..7358) [933 bp, 310 aa] {ON} YPR199C (REAL)      34   0.78 

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/543 (76%), Positives = 415/543 (76%)

Query: 25  VHKRPLDNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXX 84
           VHKRPLDNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQ              
Sbjct: 25  VHKRPLDNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKEL 84

Query: 85  XXXVTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNS 144
              VTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNS
Sbjct: 85  EDKVTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNS 144

Query: 145 QDRSGGSANTSEEGADVSHSSSESHIRDNIQKKMDFTFEFPWKDNAGRTQFXXXXXXXXX 204
           QDRSGGSANTSEEGADVSHSSSESHIRDNIQKKMDFTFEFPWKDNAGRTQF         
Sbjct: 145 QDRSGGSANTSEEGADVSHSSSESHIRDNIQKKMDFTFEFPWKDNAGRTQFPSPGSSSVS 204

Query: 205 XXXXXXXXXXXXXXXXXXXXXXXXXXLDMFYQDDALPKFTSSSLERGNNSGTIADAGFSI 264
                                     LDMFYQDDALPKFTSSSLERGNNSGTIADAGFSI
Sbjct: 205 SNHKPSFSSNAPFNATNNTPSTSSASLDMFYQDDALPKFTSSSLERGNNSGTIADAGFSI 264

Query: 265 TNDFDFESHFDEQVSEFCTRMNQACGTRDSPVPXXXXXXXXXXXXXXXXXXXXXXXXXXX 324
           TNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP                           
Sbjct: 265 TNDFDFESHFDEQVSEFCTRMNQACGTRDSPVPQTLSNQSSSTTTPITMTTTTRHDTATA 324

Query: 325 XXXXXXXXXXXXXXXXXXXXXGLNLTNTWETPXXXXXXXXXXXXXXXXXXXXXXXXXXXX 384
                                GLNLTNTWETP                            
Sbjct: 325 PAPAPALAPEEPNAASSSPQAGLNLTNTWETPSFGNLGFGGDGDSHGNGDGHGHGNGDDS 384

Query: 385 NKWLFTSDLGPSPGAAAANTPSNSADILPFIDTSIAFPTEQNELVFRDTAANNSSTVFDE 444
           NKWLFTSDLGPSPGAAAANTPSNSADILPFIDTSIAFPTEQNELVFRDTAANNSSTVFDE
Sbjct: 385 NKWLFTSDLGPSPGAAAANTPSNSADILPFIDTSIAFPTEQNELVFRDTAANNSSTVFDE 444

Query: 445 FLEEDPVVHQLTTEESVYDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPLVSDDV 504
           FLEEDPVVHQLTTEESVYDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPLVSDDV
Sbjct: 445 FLEEDPVVHQLTTEESVYDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPLVSDDV 504

Query: 505 VPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAK 564
           VPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAK
Sbjct: 505 VPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAK 564

Query: 565 HMS 567
           HMS
Sbjct: 565 HMS 567

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  187 bits (476), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 123/205 (60%), Gaps = 27/205 (13%)

Query: 385 NKWLFTSDLGPSPGAAAANTPSNSADILPFIDTSIAFPTEQNELVFRDTAANNSSTVFDE 444
           N+WLF  D      ++    PS   D +PFIDTS+AFPT+Q + +       NS  V ++
Sbjct: 370 NRWLFP-DFSSGNMSSTVRAPSAKIDSVPFIDTSMAFPTDQPDALL----PQNSDDVLNQ 424

Query: 445 FLEEDPVVHQLTTEESVYDVFSNDY---------------GAKKGKPFSPEENKG----- 484
           F EEDP+V QLTTEES YD F  D                 +    P   E N       
Sbjct: 425 FFEEDPIVSQLTTEESNYDPFKPDLQPSADSETSKHSVSSCSNDSDPSRAESNASTALTE 484

Query: 485 -NYTTLPLSQESSNPLVSD-DVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRT 542
            NYT    S  S+     D DVVP+RDG LLKC EIWDRIT+HPKYSD+DIDGLCMELRT
Sbjct: 485 PNYTIDKTSVPSAVLAAEDADVVPARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRT 544

Query: 543 KAKCSEKGVVVNADDVQKALAKHMS 567
           KAKCSEKGVVVN+DDVQ ALAKHMS
Sbjct: 545 KAKCSEKGVVVNSDDVQSALAKHMS 569

 Score =  155 bits (391), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 114/307 (37%), Positives = 140/307 (45%), Gaps = 65/307 (21%)

Query: 34  PTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLET 93
           P    KRKG    SKPGRKPL TEAKNKRTAQNRAAQ                 V  LE 
Sbjct: 14  PADLPKRKG----SKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEK 69

Query: 94  VREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEE-KKDNSQDRSGGSA 152
           VREQ+E+E+EFLRSQL  LI+E++KYRP+QS D+QVL+YLA+ EE  K    + R+G +A
Sbjct: 70  VREQSEMESEFLRSQLQMLIAEIQKYRPQQSSDSQVLKYLAEAEERCKAAPVEKRTGRNA 129

Query: 153 NTS-------------------------------------EEGADVSHSSSESHIRDNIQ 175
             S                                      E +  +     + I  N+Q
Sbjct: 130 ARSSISTSNRDDSENASRSRSRSTSLSEHNTLDTSRPQRYSENSSPADQDEAAKINANVQ 189

Query: 176 KKMDFTFEFPWKDNAGRTQFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDMFY 235
           +KM+FTFE+P         F                                   LD F 
Sbjct: 190 RKMNFTFEYPKDMPPANGAF--PSPSGSTSTTSNHSFSHRPFSQLSNTPRTSSGSLD-FL 246

Query: 236 QDDA-----LPKFTSSSLERGNNSGTIADAGFSITNDFDFESHFDEQVSEFCTRMNQACG 290
            D A     LPKF +S  E GN              DFDF +HFDEQVS FCT+MN+ CG
Sbjct: 247 GDSASNTQSLPKFPTS--ESGN-------------GDFDFNTHFDEQVSVFCTQMNEVCG 291

Query: 291 TRDSPVP 297
           TR+ P+P
Sbjct: 292 TRECPLP 298

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  184 bits (468), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 124/218 (56%), Gaps = 47/218 (21%)

Query: 385 NKWLFTSDLGPSPGAAAANTPSNSADILPFIDTSIAFPTEQNELVFRDTAANNSSTVFDE 444
           N+W+F      + G     T S +AD LPFIDTS+AFPT+  E    D  A N   V D+
Sbjct: 379 NRWMFAGFNAATEGGVIRTT-SATADSLPFIDTSMAFPTDPQE----DLLAPNPDDVLDQ 433

Query: 445 FLEEDPVVHQLTTEESVYDVFSNDYGAKKGKPFSPEE----------------------- 481
           F EEDP+V QLTTEES YD F       K  P++P +                       
Sbjct: 434 FFEEDPIVSQLTTEESAYDQF-------KSPPYAPYDMSKTSASASSNDSANSSADSNAS 486

Query: 482 ---NKGNYTTL----PLSQESSNP-----LVSDDVVPSRDGKLLKCGEIWDRITSHPKYS 529
                 NYTT     P    S+       L  D VVP+RDG LLKC E+WDRITSHPKYS
Sbjct: 487 TALTDPNYTTYKPGAPTPATSTAMAATTFLSEDAVVPARDGTLLKCSEVWDRITSHPKYS 546

Query: 530 DLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHMS 567
           D+DIDGLC+ELRTKAKCSEKGVVVN DDVQ+AL KHMS
Sbjct: 547 DIDIDGLCLELRTKAKCSEKGVVVNIDDVQRALTKHMS 584

 Score =  140 bits (353), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 143/306 (46%), Gaps = 63/306 (20%)

Query: 39  KRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQN 98
           KRKG    SKPGRKPL TEAKNKRTAQNRAAQ                 V  LE VREQ+
Sbjct: 19  KRKG----SKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQS 74

Query: 99  EVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQ------------- 145
           E+E+EFLRSQL  L++E++KYRP QS D+QVL +LAK EE +K + +             
Sbjct: 75  ELESEFLRSQLQKLLAEIQKYRPRQSSDSQVLNFLAKAEERRKSSQEAAAAAAAAATTAA 134

Query: 146 DRSGGSAN-----------------TSEEGADV-SHSSSESH-----------IRDNIQK 176
             +G SA+                 T+++G  V SH    S+           I  N+Q+
Sbjct: 135 TTTGDSASRHSSDSLSNSRSRSTSITAQDGTGVPSHLRGSSNSSPADPDEAAKINANVQR 194

Query: 177 KMDFTFEFPWKDNAGRTQFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDMFYQ 236
           KM+FTF +  KD    T                                        F  
Sbjct: 195 KMNFTFAY-AKDPTTSTGNANHSSTSGSAAFPSPSGSVSTSSSHNRP----------FSL 243

Query: 237 DDALPKFTSSSLE----RGNNSGTIADAGFSITNDFDFE--SHFDEQVSEFCTRMNQACG 290
               P+ +S SL+      NN+ ++     S     +F+  SHFDEQVSEFCTRMN+ CG
Sbjct: 244 SSNTPRTSSGSLDFLGYNSNNNQSLPKFVPSEPAKTEFDFNSHFDEQVSEFCTRMNEVCG 303

Query: 291 TRDSPV 296
           TR+ PV
Sbjct: 304 TRECPV 309

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  155 bits (392), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 108/287 (37%), Positives = 138/287 (48%), Gaps = 54/287 (18%)

Query: 27  KRPLD--NEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXX 84
           KRPL+  + P A A +      SKPGRKPL  E KNKRTAQNRAAQ              
Sbjct: 30  KRPLEQSSSPMAPAAK-----GSKPGRKPLDEETKNKRTAQNRAAQRAFRERKEKKMKEL 84

Query: 85  XXXVTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNS 144
              V  LE       VE+EFLRSQL+TL++ELKKYRP ++ D QVL+YLAK E  +    
Sbjct: 85  EDKVQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTE---- 140

Query: 145 QDRSGGSANTSEEGADVSHSSSESHIRDNIQKKMDFTFEFPWKDN----AGRTQFXXXXX 200
                                ++  I  ++QKKMDFTF FPWKD     A    F     
Sbjct: 141 --------------------PTDKEIEQSVQKKMDFTFAFPWKDRKEAEAQAQHFPSPGS 180

Query: 201 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL--------DMFYQDDA--LPKFTSSSLER 250
                                                  ++FY DDA  LP+F      +
Sbjct: 181 SMLSSSSASVNSAASPSNKRRSTASRSTSTSTSTTGWMDNVFYSDDAQKLPQFAI----K 236

Query: 251 GNNSGTIADAGFSITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
           G+++   AD  FS  N+F+F+  FDEQVS+FCT+MN+ACGTR+ P+P
Sbjct: 237 GDST---ADPLFS--NEFNFDDQFDEQVSQFCTKMNKACGTRECPIP 278

 Score =  138 bits (347), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 102/177 (57%), Gaps = 27/177 (15%)

Query: 393 LGPSPGAAAANTPSNSADILPFIDTSIAFPTEQNE-LVFRDTAANNSSTVFDEFLEE-DP 450
           L PS        PS     LPFID ++AFPT+ +E L FR     NS  +F E L+E +P
Sbjct: 312 LAPSKKQLTKTPPSQPE--LPFIDPTMAFPTDDDEGLFFRTHRDENS--LFAELLDEVEP 367

Query: 451 VVHQLTTEESVYDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESS-NPLVSDDVVPSRD 509
             +    E  +                    N+   TT  +++E+   P    DVVPSRD
Sbjct: 368 TDNNFVNENLI--------------------NEEPSTTTAVAEETRPKPKTETDVVPSRD 407

Query: 510 GKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHM 566
           GKLLKC E+WDRIT+HPKYS +DIDGLC EL TKAKCSEKGVVV A+DVQ+ L KHM
Sbjct: 408 GKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  141 bits (356), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 105/166 (63%), Gaps = 22/166 (13%)

Query: 412 LPFIDTSIAFPTEQ--------NELVFRDTAANNSSTVFDEFLEEDPVV--HQLTTEESV 461
           +PFI+TS+AFPT+         + + FRDT     S + D+FLEE+ +    Q    E  
Sbjct: 329 IPFINTSLAFPTDDGAVPQTVDDNIFFRDTQHEQRSAL-DDFLEEEELTDNQQQQQHEEK 387

Query: 462 YDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPLVSDDVVPSRDGKLLKCGEIWDR 521
            ++  N+       PFS E +K     +P S E  N      VVPS+DGKLLKC EIWDR
Sbjct: 388 INLLINEV------PFSIEADK----EVPFSIEP-NEDGDPQVVPSKDGKLLKCSEIWDR 436

Query: 522 ITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHMS 567
           IT+HPKYSDLDIDGLC EL TKAKCSE+GVVVNADDV+ AL +H++
Sbjct: 437 ITAHPKYSDLDIDGLCGELMTKAKCSERGVVVNADDVKDALNRHIA 482

 Score =  128 bits (321), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 93/266 (34%), Positives = 122/266 (45%), Gaps = 38/266 (14%)

Query: 36  AQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVR 95
           A+  +K T  ASKP    L  EA+ KRT QNRAAQ                 V  L  ++
Sbjct: 31  AEPLKKRTHTASKP----LDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQ 86

Query: 96  EQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTS 155
           +QNEVE+EFLR QL+TL+ ELKKYRPE S D++VLEYLAK      DN      G A  +
Sbjct: 87  KQNEVESEFLRGQLVTLVHELKKYRPETSNDSKVLEYLAKH-----DNVPPNQQGQAPAA 141

Query: 156 EEGADVSHSSSESHIRDNIQKKMDFTFEFPWKDNAGRTQFXXXXXXXXXXXXXXXXXXXX 215
            +                   + DF+FEFPWK   GRT                      
Sbjct: 142 RD-------------------RGDFSFEFPWK---GRT---APEFDNSTTQETTTATPSP 176

Query: 216 XXXXXXXXXXXXXXXLDMFYQDDALPKFTSSSLERGNNSGTIADAGF----SITNDFDFE 271
                          LD       L         +GN S +   AG+    +++N+  F+
Sbjct: 177 VSPGTKDQQGKPTDWLDEVLSSTELYAKQQQQQLQGNRSESPFLAGYDDSLTVSNEITFD 236

Query: 272 SHFDEQVSEFCTRMNQACGTRDSPVP 297
           + FDEQVS+FC RMN+ACG++ +PVP
Sbjct: 237 TQFDEQVSDFCVRMNEACGSKTNPVP 262

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  135 bits (340), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 96/159 (60%), Gaps = 24/159 (15%)

Query: 412 LPFIDTSIAFPTEQNEL--VFRDTAANNSSTVFDEFLE--EDPVVHQLTTEESVYDVFSN 467
           +PFIDT +AFP   + L  + ++   N       E +E   DP+   +  E S+     +
Sbjct: 444 IPFIDTGLAFPDYDDPLLDILKEEQEN-------EQVEGDSDPIQALINEEPSM--PLCH 494

Query: 468 DYGAKKGKPFSPEENKGNYTTLPLSQESSNPLVSDDVVPSRDGKLLKCGEIWDRITSHPK 527
           D  A  G   S  +   N       QE     +  D++PS DGKLLKC E+WDRIT+HP+
Sbjct: 495 DPAANAGASVSETDKLSN-------QEE----IVQDIIPSNDGKLLKCSEVWDRITAHPR 543

Query: 528 YSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHM 566
           YSDLDIDGLC+ELRTKAKCSEKGVVVNA+DVQKAL  HM
Sbjct: 544 YSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582

 Score =  124 bits (311), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 89/288 (30%), Positives = 136/288 (47%), Gaps = 31/288 (10%)

Query: 27  KRPLDNEPTAQ----------AKRKGTKPASK-----PGRKPLGTEAKNKRTAQNRAAQX 71
           KRP DN+                  G+ PASK     PGRKPL TEAK+KRTAQNRAAQ 
Sbjct: 7   KRPFDNKRAGSPDDGTDSDSGGNNSGSSPASKRRERKPGRKPLETEAKDKRTAQNRAAQR 66

Query: 72  XXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLRSQLMTLISELKKYRPE--QSMDTQV 129
                           V+ LE++ +Q+E+ET+FLR+Q+  L+SELK+Y PE  +  D+ +
Sbjct: 67  AFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSIL 126

Query: 130 LEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSSSESHIRDNIQKKMDFTFEFPWKDN 189
           L+YLAK+ +   D++ D S  +   +    D S + S S+          F FEFPWK +
Sbjct: 127 LDYLAKQRKASIDSNPDFSAAAN-KAANSKDSSTAISSSN----------FQFEFPWKMD 175

Query: 190 AGRTQFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDMFYQDDALPKFTSSSLE 249
             +                                       +       +   +S    
Sbjct: 176 PSKIPSPSSDSTSPSASTSILDNANNKSVSSTNLNHSRSSISNSSSSPSNVNGLSS---R 232

Query: 250 RGNNSGTIADAGFSITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
           + +N+  +     ++T++FDF+S FDE VS FC++++ ACGT+ +P+P
Sbjct: 233 KHSNTLNLYQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIP 280

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score =  134 bits (337), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 99/172 (57%), Gaps = 14/172 (8%)

Query: 399 AAAANTPSNSADILPFIDTSIAFPTEQNELVFRDTAANNSSTVFDEFLEEDPVVHQLTTE 458
             + N+P  +++ LPFIDTS+AFP EQ+  +FR+   +N   +F EF+E DP        
Sbjct: 409 VVSMNSPEKNSE-LPFIDTSLAFPEEQD--LFREQQPDN---MFAEFIEHDPQRDTTNGN 462

Query: 459 ESVYDVFSNDYGAKKGKPFSPEENKG--------NYTTLPLSQESSNPLVSDDVVPSRDG 510
           E       +++ A       P    G        N     +  E      SD VVPS DG
Sbjct: 463 EGNTSPDQDEFLASGMVQEEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDG 522

Query: 511 KLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKAL 562
           KLLKC E+WDRITSHPKYSD+DIDGLC EL  KAKCSE+GVVV A+DVQ AL
Sbjct: 523 KLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYAL 574

 Score =  125 bits (314), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 94/158 (59%), Gaps = 17/158 (10%)

Query: 31  DNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTH 90
           D+ PT+   RK      KPGRKPL +EAK+KRTAQNRAAQ                 V  
Sbjct: 24  DDSPTSDEPRKK---GGKPGRKPLDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHA 80

Query: 91  LETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGG 150
           LE + +Q+ VETEFLRSQL+TL++ELK+YRPE   D+QVL+YLAK E  K D+S      
Sbjct: 81  LEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVLQYLAKTENSKSDDS------ 134

Query: 151 SANTSEEGADVSHSSSESHIRDNIQKKMDFTFEFPWKD 188
               S+   D    S    I +++++KM FTF FPWK+
Sbjct: 135 ----SQNKKD----SESKEIEESVRRKMSFTFAFPWKN 164

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 44/75 (58%), Gaps = 9/75 (12%)

Query: 232 DMFYQDDA--LPKFTSSSLERGN------NSGTIADA-GFSITNDFDFESHFDEQVSEFC 282
           ++FY DDA  LP+F  S+    N      N+    D    + +N F+F   FDEQVSEFC
Sbjct: 269 NVFYNDDARQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQFNFNDKFDEQVSEFC 328

Query: 283 TRMNQACGTRDSPVP 297
           T++ Q CGT+D P+P
Sbjct: 329 TKLGQVCGTKDCPIP 343

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  125 bits (315), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 60/86 (69%), Positives = 67/86 (77%), Gaps = 1/86 (1%)

Query: 482 NKGNYTTLPLSQESSNPLVSDDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELR 541
           NK N  T   S+E  N    D +VPSRDG LL+C EIWDRIT+HPKYS+LDIDGLC EL 
Sbjct: 553 NKNNNLT-STSKEQENNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELM 611

Query: 542 TKAKCSEKGVVVNADDVQKALAKHMS 567
           TKAKCSE+GVVVNA+DVQ AL KHMS
Sbjct: 612 TKAKCSERGVVVNAEDVQMALTKHMS 637

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 64/109 (58%), Gaps = 5/109 (4%)

Query: 25  VHKRPLDNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXX 84
           + K+ LDN+   +     +K      ++ L  EA+NKRTAQNRAAQ              
Sbjct: 48  MKKQDLDNKTNTEQSNGNSK-----KKQLLDPEARNKRTAQNRAAQRAFRERKERKMKEL 102

Query: 85  XXXVTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYL 133
              V +L  +++QNE+E+EFLRSQL+TL++ELKKY+P     ++VL Y+
Sbjct: 103 EEKVANLTKIQKQNEIESEFLRSQLITLVNELKKYKPNNENASKVLNYI 151

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 1/41 (2%)

Query: 257 IADAGFSITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
           I D+   I+N FDF   FDEQVS+FC +M+ ACGTR +P+P
Sbjct: 302 IEDSNL-ISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIP 341

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 94/165 (56%), Gaps = 33/165 (20%)

Query: 410 DILPFIDTSIAFPTEQ-------NELVFRDTAANNSSTVFDEFLEEDPVVHQLTTEESVY 462
           ++LPFIDTSIAFP  +       N++ FRD   N S  + D+          +   ES  
Sbjct: 453 EVLPFIDTSIAFPETKADFDAFDNQMFFRDDGFNESLNISDD----------IVGAESDD 502

Query: 463 DVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPLVSDDVVPSRDGKLLKCGEIWDRI 522
           +  +N+      K    EE K +                D V+P+ DGKLLKC E+WDRI
Sbjct: 503 EQDNNNDNDLISKNLVCEEVKEH----------------DMVIPTSDGKLLKCSEVWDRI 546

Query: 523 TSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHMS 567
           T+HP+YSD+DIDGLC EL   AKCS+KGVVV++ DVQKAL+ HMS
Sbjct: 547 TAHPRYSDIDIDGLCQELMHNAKCSDKGVVVDSKDVQKALSNHMS 591

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 77/139 (55%), Gaps = 26/139 (18%)

Query: 48  KPGRKPLGT-EAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLR 106
           K GRK LG  E KNKRTAQNRAAQ                 V  LE V++QN+VE+EFLR
Sbjct: 45  KVGRKLLGDHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFLR 104

Query: 107 SQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSSS 166
           +QL  +I ELKKYRPE+S D +VLEYLAK EE                         + S
Sbjct: 105 NQLTLMIDELKKYRPEKSSDIKVLEYLAKHEE-------------------------NGS 139

Query: 167 ESHIRDNIQKKMDFTFEFP 185
              I+ NIQ+K DF+FE+P
Sbjct: 140 TEKIKKNIQRKEDFSFEYP 158

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 50/93 (53%), Gaps = 27/93 (29%)

Query: 232 DMFYQDDA--LPKFTSSS------------------------LERGNNSG-TIADAGFSI 264
           ++FY+DDA  LP F +SS                        L+  NNS  T+       
Sbjct: 230 NVFYKDDAQNLPHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYDSDLF 289

Query: 265 TNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
           +NDF+F+ HFD+QVS FC +MNQACGT+ +PVP
Sbjct: 290 SNDFNFDDHFDQQVSSFCVKMNQACGTKQNPVP 322

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  122 bits (307), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (90%)

Query: 504 VVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALA 563
           +VPSRDG LL+C EIWDRI++HPKYSDLDIDGLC EL TKAKCSE+GVVVNA+DVQ AL 
Sbjct: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583

Query: 564 KHMS 567
           KHMS
Sbjct: 584 KHMS 587

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/92 (46%), Positives = 58/92 (63%)

Query: 51  RKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLRSQLM 110
           +K L  EAKNKRTAQNRAAQ                 V +L  +++QNE+E+EFLR QL+
Sbjct: 60  KKQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFLRGQLI 119

Query: 111 TLISELKKYRPEQSMDTQVLEYLAKREEEKKD 142
           TL++ELKKYR     +++VLEYL++     KD
Sbjct: 120 TLVNELKKYRDPNPNESKVLEYLSQHNGNNKD 151

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/34 (67%), Positives = 26/34 (76%)

Query: 264 ITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
           ITN+FD    FDEQVS+FC +MN ACGTR  PVP
Sbjct: 280 ITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVP 313

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  120 bits (302), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/180 (40%), Positives = 93/180 (51%), Gaps = 67/180 (37%)

Query: 411 ILPFIDTSIAFPTE---QNEL------------------VFRDTAANNSSTVFDEFL--E 447
           I  F++ S+AFP+    +N L                   FRDT+      +FD+FL  E
Sbjct: 346 IFSFLNPSLAFPSSTSPENSLSDGSINNNIDNNNNSSLNNFRDTS------IFDDFLKHE 399

Query: 448 EDPVVHQLTTEESVYDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPLVSDDVVPS 507
            +P V  L  EE + D+                                     +DVVPS
Sbjct: 400 AEPSVEDLINEE-IDDI-------------------------------------NDVVPS 421

Query: 508 RDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHMS 567
           +D  LL+C E+WDRIT+HPKYSD+DIDGLC EL  KAKCSEKGVVVNA+DVQ AL+KH+S
Sbjct: 422 KDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHLS 481

 Score =  110 bits (274), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 78/148 (52%), Gaps = 29/148 (19%)

Query: 46  ASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFL 105
           ASK  R  L  EAK KRTAQNRAAQ                 V HL  +++QNE+E+EFL
Sbjct: 34  ASKSSRTELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIESEFL 93

Query: 106 RSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSS 165
           RSQL+TL+ ELKKYRPE + D+QVL YLAK E            G+ N            
Sbjct: 94  RSQLITLVKELKKYRPETANDSQVLNYLAKHE-----------NGNFN------------ 130

Query: 166 SESHIRDNIQKKMDFTFEFPWKDNAGRT 193
                 +N+ KK +F+F FPW DN   T
Sbjct: 131 ------ENLSKKSNFSFAFPWDDNNATT 152

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 48/69 (69%), Gaps = 6/69 (8%)

Query: 232 DMFYQDDALPKFTSSSLERGNNSGT---IADAGFSITNDFDFESHFDEQVSEFCTRMNQA 288
           D+F  ++ L  F+++ + R +++ +   + D+   I+N+F+FE  FDE+V++FC +MNQ 
Sbjct: 229 DLF--NEQLSSFSNTPISRNDSNESKNPMTDSQL-ISNEFNFEDQFDEKVTDFCIKMNQV 285

Query: 289 CGTRDSPVP 297
           CGTR +P+P
Sbjct: 286 CGTRSNPIP 294

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  120 bits (301), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 102/190 (53%), Gaps = 37/190 (19%)

Query: 412 LPFIDTSIAFPTEQNELVFR--------------------------------DTAANNSS 439
            PFI++S+AFP + +   FR                                DT  ++S+
Sbjct: 402 FPFINSSLAFPGDYDNNFFRETTDLNFDDNDQDDNFTNSNDLVNDYFTTNIPDTDNSDSA 461

Query: 440 TVFDEFLEEDPVVHQLTTEESVYDVFSNDY-GAKKGKPFSPEENKGNYTT-LPLSQESSN 497
            + +  ++E+P    + TE++     +ND   + + K     +N G  TT      +  +
Sbjct: 462 LIANGLVKEEP---SMQTEDTFKVQNTNDMLNSSRMKETIDNQNIGEKTTKDDNEDDDED 518

Query: 498 PLVSDDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADD 557
               + VVPSRD  LL+C EIWDRIT+HPKYSD+DIDGLC EL  KAKCSE+GVV+NADD
Sbjct: 519 DENDNTVVPSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADD 578

Query: 558 VQKALAKHMS 567
           VQ AL KHMS
Sbjct: 579 VQVALNKHMS 588

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 60/119 (50%)

Query: 54  LGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLRSQLMTLI 113
           L  E + KR AQNRAAQ                 V  LE + + NEVET FLR QL  L+
Sbjct: 23  LDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENLTKLNEVETNFLRDQLSILV 82

Query: 114 SELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSSSESHIRD 172
            EL+KYRPE   D +VL+YL K +          + GS +TS    D++ S++    +D
Sbjct: 83  KELRKYRPETKQDHKVLKYLEKHKGGAAGAGNGAATGSVSTSTRHTDLAASNANRVSKD 141

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 20/30 (66%), Positives = 25/30 (83%)

Query: 268 FDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
            DF + FDEQVSEFCT++NQACGT+  P+P
Sbjct: 239 IDFNNFFDEQVSEFCTKLNQACGTKACPIP 268

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score =  116 bits (290), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 103/182 (56%), Gaps = 25/182 (13%)

Query: 403 NTPSNSADILPFIDTSIAFPTEQNE-----------LVFRDTAANNSSTVFDEFLEEDPV 451
           ++P NS    P ID S+AFP   N            ++FRD      ST   +F++E P+
Sbjct: 302 DSPDNS---FPLIDASLAFPNNSNSNRNNNNNNNNNVLFRDI-----STAEMQFMDESPL 353

Query: 452 VH-QLTTEESVYDVFSNDYGAKKGK--PFSPEENKGNYTTLPLS---QESSNPLVSDDVV 505
            + +  +E+++  + S +         P     N  + +  PL+   QE  + L  D VV
Sbjct: 354 QNVEFNSEDAIKRLISEEPSPHYSNSVPHLHNNNVNSASLHPLTVLVQEPDDELDEDVVV 413

Query: 506 PSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKH 565
           PS D +L++C EIWDRIT++P+Y+DLDIDGLC EL   AKCS+KGVVV + DV K LAKH
Sbjct: 414 PSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKH 473

Query: 566 MS 567
           M+
Sbjct: 474 MA 475

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 61/101 (60%)

Query: 46  ASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFL 105
           ++K  +  +  EA+ +RTAQNRAAQ                 V  LE + ++NEVETEFL
Sbjct: 31  SNKIRKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFL 90

Query: 106 RSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQD 146
           RSQ++TL++ELKKYR E + D+++L+ ++   E  +D   D
Sbjct: 91  RSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTRDLRHD 131

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 251 GNNSGTIADAGFSITNDFDFESHFDEQVSEFCTRMNQACGTR 292
            NN    +D+G   +NDF+F + FDEQVS FC +MN     R
Sbjct: 175 SNNLPNASDSGL-FSNDFNFNNQFDEQVSTFCAKMNNNFENR 215

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  117 bits (293), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 86/233 (36%), Positives = 120/233 (51%), Gaps = 82/233 (35%)

Query: 396 SPGA------AAANT-PS---NSADILPFIDTSIAFPTE---------------QN---- 426
           SPG+      AA+NT PS   +S + +PFI+ ++AFP +               QN    
Sbjct: 437 SPGSTGIGNNAASNTNPSLLQSSKEDIPFINANLAFPDDNSTNIQLQPFSESQSQNKFDY 496

Query: 427 ELVFRDTAANNSSTVFDEFLEEDP---------------VVHQLTTEESVYDVFSNDYGA 471
           ++ FRD++    + +F EFLE+D                + +QL  EE            
Sbjct: 497 DMFFRDSSKE-GNNLFGEFLEDDDDDKKAANMSDDESSLIKNQLINEE------------ 543

Query: 472 KKGKPFSPEENKGNYTTLP-----LSQESSNPLVSDD-------------VVPSRDGKLL 513
                  PE  K    ++P     +SQ++ + L + D             VVPS++G LL
Sbjct: 544 -------PELPKQYLQSVPGNESEISQKNGSSLQNADKINNGNDNDNDNDVVPSKEGSLL 596

Query: 514 KCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHM 566
           +C EIWDRIT+HPKYSD+D+DGLC EL  KAKCSE+GVV+NA+DVQ AL KHM
Sbjct: 597 RCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 649

 Score =  102 bits (253), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 80/138 (57%), Gaps = 20/138 (14%)

Query: 54  LGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLRSQLMTLI 113
           L  E K KRTAQNRAAQ                 V  LE++++QNEVE  FLR QL+TL+
Sbjct: 62  LDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLV 121

Query: 114 SELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSSSE------ 167
           +ELKKYRPE   D++VLEYLA+R+               N      +V+HS+SE      
Sbjct: 122 NELKKYRPETRNDSKVLEYLARRD--------------PNLHFSKNNVNHSNSEPIDTPN 167

Query: 168 SHIRDNIQKKMDFTFEFP 185
             I++N+++KM+FTF++P
Sbjct: 168 DDIQENVKQKMNFTFQYP 185

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%)

Query: 251 GNNSGTIADAGFSITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
           G+NS T        +NDF+FE+ FDEQVSEFC++MNQ CGTR  P+P
Sbjct: 272 GSNSKTKNLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIP 318

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 107/196 (54%), Gaps = 39/196 (19%)

Query: 410 DILPFIDTSIAFPTE---------------QN----ELVFRDTAANNSSTVFDEFLEEDP 450
           D +PFI+TS+AFP +               QN    ++ FRD++    + +F+EFLEED 
Sbjct: 451 DDIPFINTSLAFPDDNPTNIQLQPLSQSQHQNKFDYDMFFRDSSKE-GNNLFEEFLEEDD 509

Query: 451 VVHQLTTEES------VYDVFSNDYGAKKGKPFSPEENKGNYTTLPLSQESSNPL----- 499
                   +         +   ++    K K  + E  + +   L   +  S  L     
Sbjct: 510 DDDDDDGNDGNDNDGEAVNASDDESNLIKNKLINEEPQQQSQCHLSTPKNGSEVLQNKNS 569

Query: 500 -----VSDD---VVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGV 551
                V+D+   VVPS++G LL+C EIWDRIT+HPKYSD+D+DGLC EL  KAKCSE+GV
Sbjct: 570 SNSEDVNDNDNEVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGV 629

Query: 552 VVNADDVQKALAKHMS 567
           V+NA+DVQ AL KHM+
Sbjct: 630 VINAEDVQLALNKHMN 645

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 88/158 (55%), Gaps = 14/158 (8%)

Query: 37  QAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVRE 96
           Q +RKG+K + K    P   E K KRTAQNRAAQ                 V  LE++++
Sbjct: 48  QPRRKGSKTSKKQDLDP---ETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQ 104

Query: 97  QNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSE 156
           +NEVE  FLR QL+TL+SELKKYRPE   D++VLEYLA+R+      + + +  S     
Sbjct: 105 ENEVEATFLRDQLVTLVSELKKYRPETRNDSKVLEYLARRDPNLHPPNSNTNNNSEPIVT 164

Query: 157 EGADVSHSSSESHIRDNIQKKMDFTFEFPW--KDNAGR 192
              D         I+ N+++KM+FTF++P    DN G+
Sbjct: 165 PNDD---------IQKNVKQKMNFTFQYPLDNDDNDGK 193

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 23/34 (67%), Positives = 30/34 (88%)

Query: 264 ITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
            +NDF+FE+ FDEQVSEFC++MNQACGT+  P+P
Sbjct: 288 FSNDFNFENQFDEQVSEFCSKMNQACGTKQCPIP 321

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%)

Query: 504 VVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALA 563
           VVPS++G LL+C EIWDRIT+HPKYSD+D+DGLC EL  KAKCSE+GVV+NA+DVQ AL 
Sbjct: 576 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 635

Query: 564 KHMS 567
           KHM+
Sbjct: 636 KHMN 639

 Score =  111 bits (278), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 92/166 (55%), Gaps = 23/166 (13%)

Query: 31  DNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTH 90
           DN+   Q KRKGTK + K    P   E K KRTAQNRAAQ                 V  
Sbjct: 42  DNDDNEQPKRKGTKTSKKQDLDP---ETKQKRTAQNRAAQRAFRERKERKMKELEKKVQS 98

Query: 91  LETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGG 150
           LE++++QNEVE  FLR QL+TL++ELKKYRPE   D++VLEYLAKR+             
Sbjct: 99  LESIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLAKRD------------- 145

Query: 151 SANTSEEGADVSHSSSE------SHIRDNIQKKMDFTFEFPWKDNA 190
             N        +H++S         I++N+++KM+FTF++P  +++
Sbjct: 146 -PNLHSSSIKANHNNSRPIITPNDEIQENVKQKMNFTFQYPLDNDS 190

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/34 (67%), Positives = 29/34 (85%)

Query: 264 ITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
            +NDF+FE+ FDEQVSEFC++MNQ CGTR  P+P
Sbjct: 283 FSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIP 316

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 56/63 (88%)

Query: 504 VVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALA 563
           VVPS++G LL+C EIWDRIT+HPKYSD+D+DGLC EL  KAKCSE+GVV+NA+DVQ AL 
Sbjct: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661

Query: 564 KHM 566
           KHM
Sbjct: 662 KHM 664

 Score = 89.0 bits (219), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 75/131 (57%), Gaps = 8/131 (6%)

Query: 54  LGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLRSQLMTLI 113
           L  E K KRTAQNRAAQ                 V  LE +++QNEVE  FLR QL+TL+
Sbjct: 62  LDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTLV 121

Query: 114 SELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSSSESHIRDN 173
           +ELKKYRPE   D++VLEYLA R+          +  ++  S     +   S E  I++N
Sbjct: 122 NELKKYRPETRNDSKVLEYLASRDPNLP------TSNNSTNSSSNRPIITPSEE--IQEN 173

Query: 174 IQKKMDFTFEF 184
           +++KM+FTF++
Sbjct: 174 VRQKMNFTFQY 184

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 29/34 (85%)

Query: 264 ITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP 297
            +N+F+FE+ FDEQVSEFC++MNQ CGTR  P+P
Sbjct: 280 FSNNFNFENQFDEQVSEFCSKMNQVCGTRQCPIP 313

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 49/55 (89%)

Query: 513 LKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHMS 567
           ++C E+WDRITSHPKYSDLDIDGLC EL  KAKCSEKGVVV ADDVQKAL KH+S
Sbjct: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 67/112 (59%), Gaps = 5/112 (4%)

Query: 27  KRPLD----NEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXX 82
           KR LD    NE TA A ++  K ++K GRK    EAK+KRTAQNRAAQ            
Sbjct: 15  KRHLDASDANE-TASATKETKKKSNKVGRKLSDQEAKSKRTAQNRAAQRAFRERRERKMQ 73

Query: 83  XXXXXVTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLA 134
                V  LE V +++E+E++FLR QL  L+ EL++YRPE+  D +V EYL+
Sbjct: 74  ELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLS 125

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score =  106 bits (264), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/188 (36%), Positives = 105/188 (55%), Gaps = 18/188 (9%)

Query: 395 PSPGAAAANTPSNSADIL-PFIDTSIAFPTEQNELVFRDT-----AANNSSTVFDEF--- 445
           P+    A   PS+S D+    +  SIAFP EQ  +V  D+       NN++  + +    
Sbjct: 320 PTTTLQANIQPSDSNDVTESLVAASIAFP-EQYNMVKSDSLYNFLKQNNNNIGYGDVRGN 378

Query: 446 LEEDP---VVHQLTTEESVYDVFSND--YGAKKGKPFSPEENKGNYTTLPLSQESSN--P 498
           +   P   + + L+  E  Y+ FS D  +   +       +    Y  +  + +SS+   
Sbjct: 379 ISTQPNSIMTNNLSNNEQNYN-FSKDAQFIVSQQNTVRNIQTANEYPNIYETDDSSDGGD 437

Query: 499 LVSDDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDV 558
            V   +VP  DG+LL+CGEIWDRIT++P+YSD+DIDGLC EL   AKCS+KGV+V++DDV
Sbjct: 438 EVVGQIVPLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDV 497

Query: 559 QKALAKHM 566
           QK L++ +
Sbjct: 498 QKVLSRRL 505

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%)

Query: 61  KRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLRSQLMTLISELKKYR 120
           KR AQNRAAQ                 V  LE + E+NE+ET FLR+QL++L++ELKKYR
Sbjct: 21  KRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNELKKYR 80

Query: 121 PEQSMDTQVLEYLAKREEEK 140
            +++ D ++ +  ++ + EK
Sbjct: 81  IDKNDDFRLKKIGSQLKHEK 100

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 267 DFDFESHFDEQVSEFCTRMNQACGTR 292
           +FDF + FDEQVS FC +MN+    R
Sbjct: 267 EFDFANEFDEQVSTFCAKMNKTFENR 292

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%)

Query: 504 VVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALA 563
           V+ + DG  LKC ++W R+T HPKYS+LDIDGLC EL  +AKCSEKGVVV + DVQKAL+
Sbjct: 496 VIRAEDGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKGVVVESRDVQKALS 555

Query: 564 KHMS 567
           K++S
Sbjct: 556 KYLS 559

 Score = 86.3 bits (212), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 76/160 (47%), Gaps = 25/160 (15%)

Query: 48  KPGRKPLG-TEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLR 106
           K GRK L  ++ K+KRT QNR AQ                 V  LE V E  E+ET FLR
Sbjct: 29  KVGRKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLR 88

Query: 107 SQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDN---------------------SQ 145
           S+L ++  ELKKYRP QS D +VLEYLAK+E+  K N                      +
Sbjct: 89  SRLKSMADELKKYRPAQSSDLEVLEYLAKKEQLAKYNHNANPIKEEEEVKEEEEDEEGEE 148

Query: 146 DRSGGSANTSEEGADVSHSSSESHIRDNIQKKMDFTFEFP 185
                 AN S E         +  I  NI+KK DFTFE+P
Sbjct: 149 GGDNIHANQSFEQESAKQ---KQEILSNIEKKKDFTFEYP 185

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 17/23 (73%)

Query: 264 ITNDFDFESHFDEQVSEFCTRMN 286
            +NDF+F+  F +QVS FC ++N
Sbjct: 296 FSNDFNFDDKFSDQVSSFCDKVN 318

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 5/107 (4%)

Query: 34  PTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLET 93
           P    +R G     +PGRKPL T AKN+RTAQNRAAQ                 ++ LE 
Sbjct: 14  PVVVKRRVG-----RPGRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLER 68

Query: 94  VREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEK 140
           +++ NEVE+ FLR  +M LI +++KYRP  S D++VL+YL+ +++ +
Sbjct: 69  IKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDSKVLKYLSLKKKNQ 115

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 78/161 (48%), Gaps = 22/161 (13%)

Query: 413 PFIDTSIAFPTEQNELVFRDTAANNSSTVFDEFLEEDPVVHQLTTEESVYDVFSNDYGAK 472
           P ID+++AFPT+ NE           + VF +  +E     Q   ++++     +   A 
Sbjct: 330 PLIDSNLAFPTDINE-----------NEVFVKQYQEYVSQQQPAEQDTITCPCQH---AD 375

Query: 473 KGKPFSPEENKGNYTTLPLSQESSNPLVSDDVVPSRDG-----KLLKCGEIWDRI-TSHP 526
            G     EE +  + +  L    S P +  D   S DG     K  KC  IW R  T  P
Sbjct: 376 TGADDDDEEIECEFISRNLLNNESIPSILRDKT-SIDGGMACNKYSKCSAIWKRFKTQKP 434

Query: 527 KYSDLDIDGLCMELRTKAKCSEKG-VVVNADDVQKALAKHM 566
           K+SD DID LC EL TKAKCS++G +V+ + DV+  L KH 
Sbjct: 435 KFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 4/84 (4%)

Query: 38  AKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQ 97
           ++RKG    +KPGRKPL TEAKN+RTAQNRAAQ                 V  LE  R Q
Sbjct: 38  SRRKG----NKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQ 93

Query: 98  NEVETEFLRSQLMTLISELKKYRP 121
           +E E + LR+Q+++L+ ELKKYRP
Sbjct: 94  SEREVQSLRNQVVSLLRELKKYRP 117

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 48/61 (78%), Gaps = 1/61 (1%)

Query: 502 DDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKA 561
           +++VP+ D ++L C +IWDRIT+ PKY+  DI+ LC EL +KAKCS+KGVVV++ DV K 
Sbjct: 527 NEMVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKV 585

Query: 562 L 562
           L
Sbjct: 586 L 586

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 34  PTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLET 93
           P + +    T   SK  +K    E K+KRTAQNRAAQ                 V  LE 
Sbjct: 9   PNSNSNGTATTTTSK-VQKDSNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEK 67

Query: 94  VREQNEVETEFLRSQLMTLISELKK 118
           V   +E ET FLRSQL+   +EL+K
Sbjct: 68  VCRAHESETSFLRSQLILFGTELRK 92

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 20/23 (86%)

Query: 268 FDFESHFDEQVSEFCTRMNQACG 290
           F+F++ FDEQ+S+FC ++N ACG
Sbjct: 356 FNFDNQFDEQISKFCLKLNSACG 378

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 49/93 (52%), Gaps = 4/93 (4%)

Query: 31  DNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTH 90
           D     + KR+G    +KPGRKPL TEAKN+RTAQNRAAQ                 V  
Sbjct: 15  DGPYVGETKRRG----NKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRR 70

Query: 91  LETVREQNEVETEFLRSQLMTLISELKKYRPEQ 123
           LE  R   E E + LR  ++ L+ EL+++R  Q
Sbjct: 71  LEEERSSAECEVQSLRGHVIALVRELRRWRARQ 103

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 46/86 (53%)

Query: 48  KPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLRS 107
           K GRK + TEAKNKRTAQNRAAQ                 +  L+ +  +   ETE+L+ 
Sbjct: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70

Query: 108 QLMTLISELKKYRPEQSMDTQVLEYL 133
            L  L++E+ KYRP    D  +L+ L
Sbjct: 71  CLSELLTEVTKYRPANEKDQGILKRL 96

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 11/72 (15%)

Query: 507 SRDGK-LLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKG----------VVVNA 555
           S +GK +L+C +I   +     Y  LD + LC EL  KAK S+ G          VV+ A
Sbjct: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473

Query: 556 DDVQKALAKHMS 567
            D+Q+ LAKH+S
Sbjct: 474 GDLQRTLAKHIS 485

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 46/103 (44%)

Query: 35  TAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETV 94
           T  A  +  K   +PGR+ L  EAKNKRT QNR AQ                 +  LE +
Sbjct: 4   TTGAAAETAKKVGRPGRRKLDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERL 63

Query: 95  REQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKRE 137
              NE   E + + L  L+ E  K+R E+  D  V E L  R+
Sbjct: 64  NSYNEDRAELMAAHLRDLLGEANKFRGEKPRDKTVRELLTARD 106

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 504 VVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAK--CSEKGVVVNADDVQKA 561
           +   R G    C  +   +T  P Y + D++ LC EL  K K    +  + V  +DV+ A
Sbjct: 318 IAEKRCGSNDTCAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGREDVRSA 377

Query: 562 LAKHMS 567
           L +H++
Sbjct: 378 LERHIA 383

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 48/99 (48%)

Query: 44  KPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETE 103
           +   +PGRK L  +AKNKRT QNR AQ                 V  L+          E
Sbjct: 7   RRVGRPGRKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEIIE 66

Query: 104 FLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKD 142
           FL+  +MTL+ E+K YR + + D ++L+ + K E +  D
Sbjct: 67  FLKQNVMTLLGEIKNYRKQTNKDKKLLDTIGKLENDGMD 105

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 39/65 (60%), Gaps = 9/65 (13%)

Query: 510 GKLLKCGEIWDRIT--------SHPKYSDLDIDGLCMELRTKAKCSEKG-VVVNADDVQK 560
            +  KC +IW+RI         S P++ D DID LC EL TKA+CS  G +V+   D+++
Sbjct: 454 NRFAKCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIKQ 513

Query: 561 ALAKH 565
           +L KH
Sbjct: 514 SLMKH 518

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 40/56 (71%)

Query: 88  VTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDN 143
           ++ LE ++++N +ET FLRS +  LI+E+ K+RP+ + D+++L+YL+ R     +N
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLSMRNTHMHNN 63

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 64/115 (55%), Gaps = 1/115 (0%)

Query: 44  KPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETE 103
           +   +PGRK + +EAK++RTAQNRAAQ                 V  LE    QN+  T+
Sbjct: 31  RKVGRPGRKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDAQNKTTTD 90

Query: 104 FLRSQLMTLISELKKYRPEQSMDTQVLEYLAK-REEEKKDNSQDRSGGSANTSEE 157
           FL   L +L+SE+ KYR + S D ++L +L   +E++K++N +  S   +  ++E
Sbjct: 91  FLLCSLKSLLSEITKYRAKNSDDERILAFLDDLQEQQKRENEKGTSTAVSKAAKE 145

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 515 CGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKG-VVVNADDVQKALAKHM 566
           C  I + I+S PKYS LDID LC EL  KAKC++   +VV A D+Q AL + +
Sbjct: 356 CYHILEEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 515 CGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKG-VVVNADDVQKALAKHM 566
           C  I   I+S PKYS LDID LC EL TKA+ ++   +VV A D+Q  L K +
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 50/90 (55%)

Query: 44  KPASKPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETE 103
           +   +PGRK + +EAKN+RTAQNRAAQ                 +  LE    QN+   +
Sbjct: 15  RKVGRPGRKRVDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQKDAQNKSVID 74

Query: 104 FLRSQLMTLISELKKYRPEQSMDTQVLEYL 133
           FL+S L +L+SE+ KYR +   D ++L +L
Sbjct: 75  FLQSSLKSLLSEVTKYRAKNVNDERILAFL 104

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 515 CGEIWDRITSHPKYSDLDIDGLCMELRTKAKCS-EKGVVVNADDVQKALAKHM 566
           C  I   I+S PK+S LDID LC EL  KAKCS +  ++V A  +Q  LA+ +
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%)

Query: 52  KPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEVETEFLRSQLMT 111
           + +  EAKN+RTAQNRAAQ                    LE+   Q++V T++L+  L +
Sbjct: 6   RKIAVEAKNERTAQNRAAQQAFRNRKEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRS 65

Query: 112 LISELKKYRPEQSM 125
           L+ E  K   E  +
Sbjct: 66  LLLENDKVSSECGL 79

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 27/55 (49%)

Query: 512 LLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHM 566
           LL   +IW  +  HPK +  D++ L  EL+  A CS   ++++     K  +  +
Sbjct: 240 LLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL 294

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 29/71 (40%), Gaps = 3/71 (4%)

Query: 48  KPGRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVTHLETVREQNEV---ETEF 104
           K GRKP  T  KNKR AQ RA+Q                    L    +Q  +   E E 
Sbjct: 8   KGGRKPSLTPPKNKRAAQLRASQNAFRKRKLERLEELEKKEAQLTVTNDQIHILKKENEL 67

Query: 105 LRSQLMTLISE 115
           L   L +L++E
Sbjct: 68  LHFMLRSLLTE 78

>Skud_13.6 Chr13 (6426..7358) [933 bp, 310 aa] {ON} YPR199C (REAL)
          Length = 310

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 40/90 (44%), Gaps = 9/90 (10%)

Query: 35  TAQAKRKGT-KPASKP-----GRKPLGTEAKNKRTAQNRAAQXXXXXXXXXXXXXXXXXV 88
           T  +KR+ T K  SKP     GRKP  T  K+KRTAQ RA+Q                  
Sbjct: 5   TNMSKRRITDKIMSKPRGRKGGRKPSFTPPKDKRTAQLRASQNAFRKRKLERLEELEKKE 64

Query: 89  THLETVREQNEV---ETEFLRSQLMTLISE 115
             L+   +Q  V   E E L   L +L++E
Sbjct: 65  AQLKVRNDQIHVLKKENELLNVMLGSLLTE 94

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 55/143 (38%), Gaps = 13/143 (9%)

Query: 434 AANNSSTVFDEFLEEDPV--VHQLTTEESVYD-VFSNDYGAKKGKP---FSPE----ENK 483
             N S+ V D+   +DP+  VH         D +FS     + GKP   F+ E    E  
Sbjct: 171 CLNLSADVLDQSFLDDPISEVHTFDDFNGKLDNIFSKPSTTQIGKPNNFFTEEVDAMETA 230

Query: 484 GNYTTLPLSQESSNPLVSDDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTK 543
              T +     S     +D         LL   +IW  I  H + +  D++ L  EL+  
Sbjct: 231 AASTVITPGFHSGQRYTTDSF---ESDVLLSAMDIWHFIKVHSRVNTFDLENLGTELKKT 287

Query: 544 AKCSEKGVVVNADDVQKALAKHM 566
           A CS   ++++     +  +  +
Sbjct: 288 AICSNFDILISLKHFVRVFSSKL 310

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,002,873
Number of extensions: 1876033
Number of successful extensions: 7596
Number of sequences better than 10.0: 72
Number of HSP's gapped: 7840
Number of HSP's successfully gapped: 121
Length of query: 567
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 452
Effective length of database: 40,294,809
Effective search space: 18213253668
Effective search space used: 18213253668
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)