Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G04928g5.527ON89289243210.0
KLTH0G03762g5.527ON70991211541e-145
TDEL0A039105.527ON74971410631e-131
Ecym_40655.527ON7216929871e-121
NCAS0F010905.527ON7877039721e-118
ADR194C5.527ON6373709261e-113
ZYRO0D12562g5.527ON8184569171e-109
Kwal_47.186425.527ON3093258621e-108
NDAI0H016005.527ON8423888561e-100
Skud_4.6965.527ON8113768271e-96
Suva_2.5995.527ON8273778262e-96
Smik_4.6975.527ON8173828192e-95
YDR422C (SIP1)5.527ON8153848131e-94
CAGL0F03047g5.527ON7444037819e-91
TBLA0D016505.527ON10163747161e-79
KNAG0C032305.527ON5613986392e-72
Kpol_1004.215.527ON7553826002e-65
KAFR0E033005.527ON4663655128e-56
Kpol_1023.985.527ON6673725151e-54
TPHA0K005305.527ON6463733474e-33
Kwal_47.18638singletonOFF3775702965e-28
TBLA0I032703.517ON4333032063e-16
KLLA0B00583g3.517ON486461583e-10
KNAG0B006003.517ON389691555e-10
CAGL0A03696g3.517ON415421546e-10
TPHA0A058103.517ON424421556e-10
Ecym_12103.517ON450711531e-09
Smik_5.1503.517ON417641512e-09
SAKL0F02002g3.517ON503461522e-09
KAFR0I023803.517ON409511502e-09
Skud_5.1363.517ON418811502e-09
Kwal_47.190403.517ON429451502e-09
KNAG0E015903.517ON423411493e-09
Kpol_195.23.517ON435411484e-09
Suva_5.1233.517ON423641466e-09
YER027C (GAL83)3.517ON417401441e-08
NDAI0B060103.517ON503401432e-08
NCAS0F037303.517ON432401422e-08
AER361C3.517ON475451422e-08
YGL208W (SIP2)3.517ON415441413e-08
KLTH0G01848g3.517ON416461413e-08
KAFR0F041403.517ON348661394e-08
Smik_7.553.517ON415441404e-08
TDEL0D058503.517ON404411404e-08
Suva_7.533.517ON414441395e-08
Skud_7.603.517ON441441396e-08
KNAG0B036905.527ON3261061368e-08
CAGL0K09350g3.517ON432561371e-07
NDAI0I028903.517ON582401371e-07
NCAS0E006203.517ON500441361e-07
ZYRO0E08404g3.517ON348401323e-07
ZYRO0D13904g5.581ON18862820.19
KNAG0C028804.100ON806104752.6
Kwal_47.191913.547ON79039718.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G04928g
         (892 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...  1669   0.0  
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   449   e-145
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   414   e-131
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   384   e-121
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   379   e-118
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   361   e-113
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   357   e-109
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   336   e-108
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   334   e-100
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   323   1e-96
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   322   2e-96
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   320   2e-95
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   317   1e-94
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   305   9e-91
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   280   1e-79
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   250   2e-72
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   235   2e-65
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   201   8e-56
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   202   1e-54
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   138   4e-33
Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [cont...   118   5e-28
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    84   3e-16
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    65   3e-10
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    64   5e-10
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    64   6e-10
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    64   6e-10
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    64   1e-09
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    63   2e-09
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    63   2e-09
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    62   2e-09
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    62   2e-09
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    62   2e-09
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    62   3e-09
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    62   4e-09
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    61   6e-09
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    60   1e-08
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    60   2e-08
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    59   2e-08
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    59   2e-08
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    59   3e-08
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    59   3e-08
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    58   4e-08
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    59   4e-08
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    59   4e-08
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    58   5e-08
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    58   6e-08
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    57   8e-08
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    57   1e-07
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    57   1e-07
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     57   1e-07
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    55   3e-07
ZYRO0D13904g Chr4 complement(1174048..1174614) [567 bp, 188 aa] ...    36   0.19 
KNAG0C02880 Chr3 (569230..571650) [2421 bp, 806 aa] {ON} Anc_4.1...    33   2.6  
Kwal_47.19191 s47 (1128688..1131060) [2373 bp, 790 aa] {ON} YFR0...    32   8.3  

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score = 1669 bits (4321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 832/892 (93%), Positives = 832/892 (93%)

Query: 1   MGNTASTVNLQEKRHHSHLLPRDRQHSITSQLFPGRNTRNAQDDSPVSXXXXXXXPGKWK 60
           MGNTASTVNLQEKRHHSHLLPRDRQHSITSQLFPGRNTRNAQDDSPVS       PGKWK
Sbjct: 1   MGNTASTVNLQEKRHHSHLLPRDRQHSITSQLFPGRNTRNAQDDSPVSAAAAAAAPGKWK 60

Query: 61  RRLSLNHAPAVVSTPSPLFKPNYSMNESSNASIAGLGSNYTTSSQEDLNKLQAVDSSRKN 120
           RRLSLNHAPAVVSTPSPLFKPNYSMNESSNASIAGLGSNYTTSSQEDLNKLQAVDSSRKN
Sbjct: 61  RRLSLNHAPAVVSTPSPLFKPNYSMNESSNASIAGLGSNYTTSSQEDLNKLQAVDSSRKN 120

Query: 121 TLSSIESNSASSKPAPPLLNPTNVSADDSSQLRDHLAGLTIHSEGLXXXXXXXXXXXXYD 180
           TLSSIESNSASSKPAPPLLNPTNVSADDSSQLRDHLAGLTIHSEGL            YD
Sbjct: 121 TLSSIESNSASSKPAPPLLNPTNVSADDSSQLRDHLAGLTIHSEGLSRNVSNAVSRSSYD 180

Query: 181 SSATPNPATNYVSSPRVYPFPLSPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQF 240
           SSATPNPATNYVSSPRVYPFPLSPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQF
Sbjct: 181 SSATPNPATNYVSSPRVYPFPLSPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQF 240

Query: 241 PSYLHRPSIVALKRSLVEGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPS 300
           PSYLHRPSIVALKRSLVEGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPS
Sbjct: 241 PSYLHRPSIVALKRSLVEGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPS 300

Query: 301 QLIDDDRQDSGRTDSIDIPGRGHAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEG 360
           QLIDDDRQDSGRTDSIDIPGRGHAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEG
Sbjct: 301 QLIDDDRQDSGRTDSIDIPGRGHAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEG 360

Query: 361 FLEDNDVLLNNAVLESAIRKDMKRKRQEKKRPEDQEKXXXXXXXXXXXXXXXGVKKLKPL 420
           FLEDNDVLLNNAVLESAIRKDMKRKRQEKKRPEDQEK               GVKKLKPL
Sbjct: 361 FLEDNDVLLNNAVLESAIRKDMKRKRQEKKRPEDQEKSFSSSLESAEPSAISGVKKLKPL 420

Query: 421 TPNEQERQRQVGEDYKNFLPSFQPIRTGATPKLFQVSGNGGRIDSFELGTVEHFESIGDD 480
           TPNEQERQRQVGEDYKNFLPSFQPIRTGATPKLFQVSGNGGRIDSFELGTVEHFESIGDD
Sbjct: 421 TPNEQERQRQVGEDYKNFLPSFQPIRTGATPKLFQVSGNGGRIDSFELGTVEHFESIGDD 480

Query: 481 HRTVSGGSNAPNGGGKTTSMRANKXXXXXXXXXXXXGARYGEDDLVNVVLKWRDCIVDPK 540
           HRTVSGGSNAPNGGGKTTSMRANK            GARYGEDDLVNVVLKWRDCIVDPK
Sbjct: 481 HRTVSGGSNAPNGGGKTTSMRANKEAEEEEEEEAAAGARYGEDDLVNVVLKWRDCIVDPK 540

Query: 541 TCKISVISSDISAVLALQSSKKIPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSN 600
           TCKISVISSDISAVLALQSSKKIPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSN
Sbjct: 541 TCKISVISSDISAVLALQSSKKIPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSN 600

Query: 601 FLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNYGSDLGVSMKESVNGGSDFTITA 660
           FLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNYGSDLGVSMKESVNGGSDFTITA
Sbjct: 601 FLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNYGSDLGVSMKESVNGGSDFTITA 660

Query: 661 PIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTGILSRSNSARPLLNQKKSSSYDVFAPL 720
           PIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTGILSRSNSARPLLNQKKSSSYDVFAPL
Sbjct: 661 PIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTGILSRSNSARPLLNQKKSSSYDVFAPL 720

Query: 721 PPKKYEYSTDIPELFKVNXXXXXXXXXXXXXXSYSSLLKGSEAEQPSFHCRVQDCNQDRL 780
           PPKKYEYSTDIPELFKVN              SYSSLLKGSEAEQPSFHCRVQDCNQDRL
Sbjct: 721 PPKKYEYSTDIPELFKVNDEEDHDHDIPEDPPSYSSLLKGSEAEQPSFHCRVQDCNQDRL 780

Query: 781 FSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPV 840
           FSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPV
Sbjct: 781 FSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPV 840

Query: 841 IPHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYENTNRKEELV 892
           IPHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYENTNRKEELV
Sbjct: 841 IPHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYENTNRKEELV 892

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  449 bits (1154), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 347/912 (38%), Positives = 449/912 (49%), Gaps = 232/912 (25%)

Query: 1   MGNTASTVNLQEKRHHSHLL--PRDRQHSITSQLFPGRNTRNAQDDSPVSXXXXXXXPGK 58
           MGN  ST N+Q KR  S L   PR RQ SITSQLFP R T     +S V           
Sbjct: 1   MGNNPSTANMQNKRV-SQLAQEPRGRQDSITSQLFPSR-TSGRNPESKVG---------- 48

Query: 59  WKRRLSLNHAPAV--VSTP---SPLFKPNYSMNESSNASIAGLGSNYTTSSQEDLNKLQA 113
           WK R+   + P+    STP   SP F+ NY++  +            T S+  +L K   
Sbjct: 49  WKSRVLHGNRPSASPASTPPVQSP-FRKNYTLEVT------------TESAPYNLKK--- 92

Query: 114 VDSSRKNTLSSIESNSASSKPAPPLLNPTNVSADDSSQ--LRDHLAGLTIHSEGLXXXXX 171
                          S S  PAPP+   T+ SAD+SS   LRDHLA L++          
Sbjct: 93  ---------------SISGNPAPPMCTTTHASADESSSSSLRDHLAELSLQ--------- 128

Query: 172 XXXXXXXYDSSATPNPATNYVSSPRVYPFPL--SPGPASPTVEPTRHEAELLPTRSEVDG 229
                   +S + PN  T+    P   P P+  SPGP++P V+ T+H+A           
Sbjct: 129 --------NSESQPNRKTSPGLGPAPAPAPVLRSPGPSTPVVKYTKHDA----------- 169

Query: 230 EAENDRYRDQFPSYLHRPSIVALKRSLVEGRIGSKLHVQTSNGDTTNASSSTAGSLKNYI 289
                   DQ  S      I +LK+ LVEGR+G  +H   +                   
Sbjct: 170 ------ISDQISS------ITSLKKMLVEGRVGDNIHPPPT------------------- 198

Query: 290 LDDNNRILLPSQLIDDDRQDSGRTDSIDIPGRGHAATATIGSNRDTTALSDDQDTSLSPG 349
                                    SIDIP R  AA +           SDD D   S  
Sbjct: 199 -------------------------SIDIPRRPSAALSD-------AYFSDDGDDEES-- 224

Query: 350 SPVSQLDLSEGFLEDNDVLLNNAVLESAIRKDMKRKRQEKKRPEDQEKXXXXXXXXXXXX 409
                  L +G    NDV++NN+VLE+A    MKRKR  KK      K            
Sbjct: 225 -------LLQG---TNDVVINNSVLENA----MKRKRGTKK-----NKGVGASSESHEHI 265

Query: 410 XXXGVKKLKPLTPNEQERQRQVGEDYKNFLPSFQPIR-----------TGATPKLFQVSG 458
              G+KKLKPL         + G D ++ LP F+ +            + A P+L   S 
Sbjct: 266 SYPGLKKLKPL---------EHGGDKRD-LPHFRAMHPRPSEDNVGPDSAAIPRLITDSL 315

Query: 459 NGGRIDSFELGTVEHFESIGDDHRTVSGGSNAPNGGGKTTSMRANKXXXXXXXXXXXXGA 518
           N  RIDSFE GTVEH+E   +     SG S+       ++ MR +              A
Sbjct: 316 N--RIDSFEKGTVEHYEGANE-----SGFSSQ---NLTSSDMRDSDD------------A 353

Query: 519 RYGEDDLVNVVLKWRDCIVDPKTCKISVISSDISAVL-ALQSSKKIPMEYETTEKSWFVP 577
                   +V+L W+D IVDPKTCK+S++S DIS+ L   +   KIPM ++     W   
Sbjct: 354 DEDRGPGTHVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSKIPMVFDMERNCWTAH 413

Query: 578 NLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMN 637
           +L LP GVYK QFLINGELRHS++LPTATDSFGN VNWFEV+ G+  IEP RDV      
Sbjct: 414 DLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDV------ 467

Query: 638 YGSDLGVSMKESVNGGSDFTITAPIPRPPLL---SQATSSSYRSSKYIERSTTPYSDYTG 694
                 +S ++         +  P P  P L     ++S+   SS+++ERS TP+SDYTG
Sbjct: 468 ------ISSEDVKLSKDQIAVEQPAPERPALGSDGSSSSNWKGSSRHVERSGTPFSDYTG 521

Query: 695 ILSRSNSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXXXXXXXXXSY 754
           + SRS   +P L    +SSYD+ AP+P  KYEY+ +IPELFK N                
Sbjct: 522 LCSRSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEER--- 578

Query: 755 SSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNS 814
             L K    + PSF  RVQDCNQD LF+DLQQ+ +ID+QAAEE FLQ+YP PDLP+YL+S
Sbjct: 579 -ELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDS 637

Query: 815 SYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTTRYEGKFITH 874
           S+LN VF+  Q   +  ++K  VN ++PHVNLNHLLTSSIR+EIISVGCTTRYEGKFIT 
Sbjct: 638 SFLNAVFSGFQ---DKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQ 694

Query: 875 VVYAPCYYENTN 886
           ++Y PCYY N +
Sbjct: 695 IIYTPCYYSNKD 706

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  414 bits (1063), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 273/714 (38%), Positives = 385/714 (53%), Gaps = 107/714 (14%)

Query: 199 PFPLSPGPASPTVEPTRHEAELLPTRSEVDGEAEN--DRYRDQFPSYLHRPSIVALKRSL 256
           P  L+PG ++PTV+PTR  A  +P  +++  + +N  ++ ++       RPS+VALK++L
Sbjct: 117 PSFLTPGHSTPTVQPTRQAA--VPA-ADLKNKLQNGLNQQKEISSHRFQRPSVVALKKTL 173

Query: 257 VEGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSI 316
           ++     +LH  +S   + +  SS +  + + +                         ++
Sbjct: 174 LDD---GELHSTSSRSTSGDVVSSASLDIYSAL-------------------------NL 205

Query: 317 DIPGRGHAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEGFLEDNDVLLNNAVLES 376
           D P +  +      ++ DT+   D  D               +G+L+  DV+LN ++L++
Sbjct: 206 DSPTQSGSKAKDTDADPDTSDFDDISD---------------DGYLQSEDVVLNQSLLQN 250

Query: 377 AIRKDMKRKRQEKKRPEDQEKXXXXXXXXXXXXXXXGVKKLKPLTPNEQERQRQVGEDYK 436
            +R+DMKRKR  KK      K                V        N  + ++     Y 
Sbjct: 251 VLRRDMKRKRPAKK-----SKVPNTSHVSNLKASSNSVSYESLENGNVPDAKKLKSLSYD 305

Query: 437 NFLPSFQPIRTGATPKLFQVSGNGG--RIDSFELGTVEHFESIGDDHRTVSGGSNAPNGG 494
             LPSFQP       +L  ++ + G  RIDSFE G+VEH E       T     N+ +  
Sbjct: 306 GSLPSFQPTAQN-NDRLNGLAHDNGFNRIDSFEKGSVEHREV-----ETSPTMRNSSSAS 359

Query: 495 GKTTSMRANKXXXXXXXXXXXXGARYGEDDLVNVVLKWRDCIVDPKTCKISVISSDISAV 554
             ++S+ +N                  E + V+V+LKWRD I DP  CKI++IS+DI++ 
Sbjct: 360 PSSSSIISNT-----------------EPEKVHVILKWRDQIEDPSKCKITIISTDIASA 402

Query: 555 LALQSSKK-----IPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSF 609
           L    S K       M+Y+  E +++VPNL LPPG+YK QF+INGE+RHSN LP+ATDS 
Sbjct: 403 LNFDPSDKSFHGTFSMKYDEKENNFYVPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSV 462

Query: 610 GNFVNWFEVLPGYYEIEPLRDVPVDSMNYGSDLGVSMKESVNGGS----------DFTIT 659
           GN VNWFEV+PGY  +EP R+     ++Y  ++G+   +S +  S             + 
Sbjct: 463 GNIVNWFEVIPGYESVEPFRN----EIDYHENMGIDPPQSDSSTSTGKHHDESPGKVPLV 518

Query: 660 APIP-RPPLLSQATSSSYRSSKYIERSTTPYSDYTGILSRSNSA---RPLLNQKKSSSYD 715
            P+P RPPL ++ TSS    S   ERS TPYSDYTG+ SR NSA    PL++Q  SS  D
Sbjct: 519 QPVPGRPPLAARHTSSY---SNKQERSGTPYSDYTGV-SRCNSAVRKSPLIHQTLSS-ID 573

Query: 716 VFAPLPPKKYEYSTDIPELFKVNXXXXXXXXXXXXXXSYSSLLKGSEAEQPSFHCRVQDC 775
           +   L PKKYEYS +IPELFK                    +   S  +QPSF   V DC
Sbjct: 574 LVTALQPKKYEYSNEIPELFKAGNVLGQSDENQFPTPPPPPMNPPS-YDQPSFLENVVDC 632

Query: 776 NQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKA 835
           NQD LF  LQQ   +DA+ AE+ FL+KY VPDLP+YLNS+YLNK+FN+ QK N+ G   +
Sbjct: 633 NQDNLFVSLQQGGLLDAETAEQLFLEKYTVPDLPVYLNSTYLNKIFNEFQKHNSLGSNSS 692

Query: 836 VVNPVIPHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYENTNRKE 889
            +N +IPHVNLNHLLTSSIR+E+ISVGCTTRYEGKFIT VVYAPCYY +  + E
Sbjct: 693 GLNHIIPHVNLNHLLTSSIRDEMISVGCTTRYEGKFITQVVYAPCYYASGPKAE 746

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 23/133 (17%)

Query: 24  RQHSITSQLFPGRNTRNAQDDSPVSXXXXXXXPGKWKRRLSLNHAPAVVSTPSPLFKPNY 83
           RQ SITSQLFP RNTR+                G        N  P     P  LFK +Y
Sbjct: 37  RQQSITSQLFPSRNTRHV---------------GPHSMNAKRNRHPH--PQPPSLFKSDY 79

Query: 84  SMNESSNASIAGLGSNYTTSSQEDLNKLQAVDSSRKNTLSSIESNSASSKPAPPLLNPTN 143
           S+  ++  + A  GS  T + ++++  L    S+    + S  +   S+    P + PT 
Sbjct: 80  SLRSTAEETPANTGS--TENIRDNMAGLSLKSSNENAQVPSFLTPGHST----PTVQPTR 133

Query: 144 VSADDSSQLRDHL 156
            +A  ++ L++ L
Sbjct: 134 QAAVPAADLKNKL 146

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  384 bits (987), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 259/692 (37%), Positives = 371/692 (53%), Gaps = 116/692 (16%)

Query: 202 LSPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSYLHRPSIVALKRSLVEGRI 261
           +SPGP+S TVE ++ EA + P                +  + +HRPSIVALK++L++G +
Sbjct: 135 MSPGPSSATVEHSKLEASISP----------------ELAAQVHRPSIVALKQNLIQGHM 178

Query: 262 GSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPGR 321
           G  LH    +    +          +Y+         PS              +IDIP  
Sbjct: 179 GHPLHSPLRDDYDGDDDDGDTAPSSSYV---------PSA-------------TIDIPYS 216

Query: 322 GHAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEGFLEDNDVLLNNAVLESAIRKD 381
             +   T+       A   +  ++ S    +S  DL +G++E++DV+L+ A+++S ++ D
Sbjct: 217 NPSTMNTLS----IIAQHQEDYSTRSSAVSISTQDL-DGYIENSDVVLSEALVDSVVKND 271

Query: 382 MKRKRQEKKRPEDQEKXXXXXXXXXXXXXXXGVKKLKPLTPNEQERQRQVGEDYKNFLPS 441
           M+RKRQ +K  +  E                 VKK K    N  +  +Q+G     FLP 
Sbjct: 272 MRRKRQLQK--QSAEASEAINENKNEANQQPDVKKAKVPMSNLLKPSKQMGTVTGTFLPQ 329

Query: 442 FQPIRTGATPKLFQVSGNGGRIDSFELGTVEHFESIGDDHRTVSGGSNAPNGGGKTTSMR 501
            +   +G                SFE G+V+H E   DD+                    
Sbjct: 330 SELKDSG----------------SFEYGSVQHVEVAADDN-------------------- 353

Query: 502 ANKXXXXXXXXXXXXGARYGED--DLVNVVLKWRDCIVDPKTCKISVISSDISAVLA-LQ 558
                             Y +D  + V V++KWRD  VDP+T KIS+ISSDI++V+   +
Sbjct: 354 ------------------YSDDCPERVQVIIKWRDTNVDPRTSKISIISSDIASVVQPTR 395

Query: 559 SSKKIPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
             KKIPM Y   E+ W   +LKLP G+YKL F ING++RHSN+LPTATDS  N VNWFEV
Sbjct: 396 KRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEV 455

Query: 619 LPGYYEIEPLRDVPVDSMNYGSDLGVSMKESVNGGSDFTITAPIP---RPPLLSQATSSS 675
           +PGY +IEP RD  ++     ++L    + S+      T   P P   RPPL+++ TSSS
Sbjct: 456 VPGYDQIEPYRDAAIE--RSPNELAAYNETSL----LLTNETPSPANIRPPLINRGTSSS 509

Query: 676 YRSSKYIERSTTPYSDYTGILSRSNSARPLLNQKKSSSYDVFAPLPPK-KYEYSTDIPEL 734
            R ++ IER+ TP SDYTG+L+R++ + P + + KS++      LP +    YS+D+PEL
Sbjct: 510 SR-ARVIERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPEL 568

Query: 735 FKVNXXXXXXXXXXXXXXSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQA 794
           FKV                  +  K  + + P+F   VQDCNQD LF  LQ+   ++AQ 
Sbjct: 569 FKVGNASTGGSQQGSDKNKLQNPSKYLQ-DSPNFMKNVQDCNQDELFHYLQEKWNMNAQE 627

Query: 795 AEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGE--TKAVVNPVIPHVNLNHLLTS 852
           AEE FL+KY VPDLPIYLNS+ LN++FN+LQ+++  G+   +  +  +IPHVNLNHLLTS
Sbjct: 628 AEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTS 687

Query: 853 SIREEIISVGCTTRYEGKFITHVVYAPCYYEN 884
           +IR+EIISVGCTTRYEGKFIT ++YAPCYYEN
Sbjct: 688 NIRDEIISVGCTTRYEGKFITQIMYAPCYYEN 719

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 36/73 (49%), Gaps = 21/73 (28%)

Query: 22  RDRQHSITSQLFPGRNTRNAQDDSPVSXXXXXXXPGKWKRRLSLNHAPAVVSTPSP---L 78
           R RQ SITSQLFPGR+   +                KWK +   N AP  VS       L
Sbjct: 48  RVRQQSITSQLFPGRHQARS----------------KWKSQ--RNVAPGAVSGVGGVDHL 89

Query: 79  FKPNYSMNESSNA 91
           FK +YS+++ S+A
Sbjct: 90  FKRDYSLSDDSSA 102

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  379 bits (972), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 263/703 (37%), Positives = 376/703 (53%), Gaps = 81/703 (11%)

Query: 202 LSPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSYLHRPSIVALKRSLVEGRI 261
           +SPGPA+PTVE T+H+              EN        S+ HRPSIV LK++L     
Sbjct: 140 MSPGPANPTVEQTKHDV----------TNKEN--------SFEHRPSIVTLKQTLS---- 177

Query: 262 GSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDS-GRTDSIDIPG 320
           G+K+    +N D  N + S++ + ++     ++ I   +  ID  +++     D++D   
Sbjct: 178 GTKV-TNDNNIDKLNKTISSSSNSQSVSTASSSSIANRTGSIDIPKENRYNFKDAMDTIP 236

Query: 321 RGHAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSE-GFLEDNDVLLNNAVLESAIR 379
           + H+  A      D   ++D+   + S G   +  D SE G L++ D++LN + L+ A++
Sbjct: 237 KQHSVHAY---QHDYFTINDENARNGSDGRLSTSGDNSEPGVLQNVDIVLNQSFLKDAMK 293

Query: 380 KDMKRKRQEKKRPEDQEKXXXXXXXXXXXXXXXGVKKLKPLTPNEQERQRQVGEDYKNFL 439
           +DMKR            K                 +K KP++       +  G+  KN +
Sbjct: 294 RDMKR------------KRTDTGASTATPDIEKPTEKKKPISATAAMMLKLYGD--KNQM 339

Query: 440 PSFQPIRTGATPKLFQVSGNGGRIDSFELGTVEHFES--IGDDHRTVSGGSNAPNGGGKT 497
              +   +G+     Q   +  +I+  E+  ++H E+  + D+    S            
Sbjct: 340 EKEEKKSSGSYSYADQYEHSTSQINLREVKKIKHIENDFVEDNFGISSPKEIKIQHIDDV 399

Query: 498 TSMRANKXXXXXXXXXXXXGARYGEDDLVNVVLKWRDCIVDPKTCKISVISSDISAVLAL 557
            +   +              +    +D V VVLKWRD I +PK CKIS++S DIS+ +  
Sbjct: 400 KNAPPSSLSSSMSSSSFGPSSDEQTNDNVQVVLKWRDQIDNPKHCKISIVSDDISSAIPA 459

Query: 558 QSSK--KIPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNW 615
           +++K  K+PM +    K W+VPNL LPPG+Y+L+F ING+L HSNFLPTATDS GN VNW
Sbjct: 460 KATKAGKLPMLFNPMIKEWYVPNLLLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIVNW 519

Query: 616 FEVLPGYYEIEPLRDVPVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSS 675
           FEVLPGY  +EP RD  +++  + +    +++++               P  +    SSS
Sbjct: 520 FEVLPGYDTVEPYRDEIIETTFHTNGSQGTLRDN--------------NPTTIRSRRSSS 565

Query: 676 YRSSKYIERSTTPYSDYTGILSRSNSARPLLNQKKSS--------SYDVFAPLPPKKYEY 727
           + S+     S TPYSDYTGI SRSNSA   LN K++S          D+F P+ PKK EY
Sbjct: 566 FVSANGDLASMTPYSDYTGI-SRSNSA---LNSKRTSLVSLRGVGKLDLFTPMEPKKIEY 621

Query: 728 STDIPELFKVNXXXXXXXXXXXXXXSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQH 787
           S +IPELFK++                 +L   S  E+PSF  RV DCNQD+LFSDLQ++
Sbjct: 622 SNEIPELFKISNSIEDEDDDEGDYGHNETL---SPFEEPSFTNRVVDCNQDKLFSDLQKN 678

Query: 788 DRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNN----AGETKAV--VNPVI 841
             IDA+ AE  FL KY VPDLPIYLNSSYLNK+F Q QK +N    +  T +   +  +I
Sbjct: 679 GNIDAETAEMLFLNKYQVPDLPIYLNSSYLNKIFLQFQKQHNDPTPSANTASTIGITHII 738

Query: 842 PHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYEN 884
           PHVNLNHLLTSSIR+EIISV CTTRY+GKFIT V+YAPC Y N
Sbjct: 739 PHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNYGN 781

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  361 bits (926), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 244/370 (65%), Gaps = 36/370 (9%)

Query: 521 GEDDLVNVVLKWRDCIVDPKTCKISVISSDISAVLALQSSKKIPMEYETTEKSWFVPNLK 580
            E + V V++KWRDC++DP+  K+S++S DI++V+   S +K+ M +   E+ W  P+L+
Sbjct: 301 AEAEFVEVIIKWRDCLLDPQRTKLSIVSPDIASVIHKNSKRKVAMVFSKDEQFWVAPDLR 360

Query: 581 LPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNYGS 640
           LPPG+YKLQFLING LRHSNFLPTATDS  N VNWFEV+P Y   EP RD   +      
Sbjct: 361 LPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRDPAPEE----- 415

Query: 641 DLGVSM-KESVNGGSDFTITAPIP-RPPLLSQATSSSYRSSKYIERSTTPYSDYTGILSR 698
              V+M  ES        +TAP   RPPLL + TSSS R ++ +ERS TP SDYTGI SR
Sbjct: 416 ---VAMPPESPQ------LTAPAAGRPPLLKRGTSSSSR-ARVVERSNTPISDYTGI-SR 464

Query: 699 SNSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXXXXXXXXXSYSSLL 758
           S SARPLL   KS++    +P+P    +YST+IPELFK                      
Sbjct: 465 SGSARPLLAHHKSANSIELSPIPRCVLQYSTEIPELFKPEGCPPDPNTAPG--------- 515

Query: 759 KGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLN 818
                   SF+  +QDCNQD LF  LQ+  ++ AQ AEE  ++KYPVPDLP+YLNSSYLN
Sbjct: 516 --------SFNENIQDCNQDELFRFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLN 567

Query: 819 KVFNQLQKDNNAGETK-AVVNPVIPHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVY 877
           ++F +LQ+ +  G+ K +    +IPHVNLNHLLTSSIR+EIISVGCTTRYEGKFIT ++Y
Sbjct: 568 EIFTKLQRSSVTGDVKRSSFTHIIPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIMY 627

Query: 878 APCYYENTNR 887
           APCYYE++ +
Sbjct: 628 APCYYESSRK 637

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 88/192 (45%), Gaps = 62/192 (32%)

Query: 203 SPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSYLHRPSIVALKRSL--VEGR 260
           SPGP++ TVE T  EA + P                +  S  HRPSI ALK+SL  V+G+
Sbjct: 119 SPGPSTATVEHTNLEASMSP----------------ELASQTHRPSISALKQSLIQVQGQ 162

Query: 261 IGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPG 320
             S+   +                      D +    +PS              +IDIP 
Sbjct: 163 TNSRHRAE----------------------DIDTAQYVPSA-------------TIDIPC 187

Query: 321 RGHAA-TATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEGFLEDNDVLLNNAVLESAIR 379
              +  TA++      T  +DD  T  S  S  +Q D+ E ++E ++V+LN ++++S +R
Sbjct: 188 SNPSTNTASV------THRADDSSTRSSLLSLFTQ-DVEE-YIEASEVVLNESLVDSVVR 239

Query: 380 KDMKRKRQEKKR 391
           KD++RKRQ +++
Sbjct: 240 KDLRRKRQLQQQ 251

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  357 bits (917), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/456 (45%), Positives = 273/456 (59%), Gaps = 54/456 (11%)

Query: 451 PKLFQVSGNGGRIDSFELGTVEHFESIGDDHRTVSGGSNAPNGGGKTTSMRANKXXXXXX 510
           P++ Q  G    +DSFE G+VEH E + D +R  S  S +                    
Sbjct: 390 PEVLQQHGKFYSMDSFEKGSVEHRE-VEDRNRNSSLSSLS-------------------- 428

Query: 511 XXXXXXGARYGEDDLVNVVLKWRDCIVDPKTCKISVISSDISAVLALQSSKK-----IPM 565
                  +   +D  V+V +KWRD +    T ++S++S DI++ L+ +  K       PM
Sbjct: 429 ---SSPVSGSSQD--VHVAIKWRDHLPVDGTNRMSMVSEDIASTLSFERQKHGARNTFPM 483

Query: 566 EYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEI 625
            YE   K W VP+L LP GVY+LQFLINGEL HSN+LPTATDS GNFVNWFEV+PGY ++
Sbjct: 484 RYEEETKEWVVPDLVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEKV 543

Query: 626 EPLRD-VPVDS---MNYGSD-LGVSMKESVNGGSDFTI-TAPIP-----RPPLLSQATSS 674
           EP RD V +DS   +N G++ +  S+    N GS+ T+   P+P     RPPL     +S
Sbjct: 544 EPYRDEVELDSGQPLNAGNNGIAGSVLSLENQGSEGTVLMEPVPGKVNVRPPL-----AS 598

Query: 675 SYRSSKYIERSTTPYSDYTGILSRSNSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPEL 734
            + SS  + RS TPYSDYTGI   S++ R       +SS D+   L PKKY+YS +IPEL
Sbjct: 599 MHHSSNRVIRSNTPYSDYTGISRSSSALRKSPINCTTSSLDLHTALQPKKYKYSNEIPEL 658

Query: 735 FK------VNXXXXXXXXXXXXXXSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHD 788
           FK       N              +Y    +G  +    F  +V DCNQD LF++LQQ  
Sbjct: 659 FKTAPITKANDENEDFTFGHMEPPTYD-WARGHPSSNAGFGNQVVDCNQDELFTELQQGG 717

Query: 789 RIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNH 848
            +DA+ AE+ FL+KYPVPDLPIYLNS YLN++ ++ QK+N  G     +N +IPHVNLNH
Sbjct: 718 LLDAETAEQLFLEKYPVPDLPIYLNSYYLNRIISEFQKNNYPGGGSGGINHIIPHVNLNH 777

Query: 849 LLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYEN 884
           LLTSSIR+E+ISVGCTTRYEGKFIT V+YAPCYYEN
Sbjct: 778 LLTSSIRDEMISVGCTTRYEGKFITQVIYAPCYYEN 813

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 111/408 (27%), Positives = 155/408 (37%), Gaps = 137/408 (33%)

Query: 1   MGNTAS---------TVNLQEKRHHS-------HLLPRD--RQHSITSQLFPGRNTRNAQ 42
           MGNT S         + N QE  + S       +LL  D  RQ SITSQLFP R TR+A 
Sbjct: 1   MGNTPSAHQRVGRKGSENFQESNNSSNRYSQTKYLLEVDKGRQSSITSQLFPSRKTRHAP 60

Query: 43  DDSPVSXXXXXXXPGKWKRRLSLNHAPAVVSTPSPLFKPNYSMNESSNASIAGLGSNYTT 102
                         G  KR+        VV  P  LFK NYS+ E   AS    G N   
Sbjct: 61  SGL-----------GNLKRKTQ-----NVVPHPPSLFKKNYSLEE---ASAGAQGPNNNN 101

Query: 103 SSQEDLNKLQAVDSSRKNTLSSIESNSASSKPAPPLLNPTNVSADDSSQLRDHLAGLTIH 162
           +   ++  + A D  R                     N T  S +    +R+++AGL+I 
Sbjct: 102 NDNHNVTLMAADDDPRD-------------------FNDTKTSTE---SVRENMAGLSIK 139

Query: 163 SEGLXXXXXXXXXXXXYDSSATPNPATNYVSSPRVYPFPLSPGPASPTVEPTRHEAELLP 222
           S                              S    P   SPGPA+PTV+PT+ EA  +P
Sbjct: 140 S------------------------------SNETGPMFFSPGPATPTVQPTKEEA--IP 167

Query: 223 TRSEVDGEAENDRYRDQFPSYLHRPSIVALKRSLVEGRIGSKLHVQTSNGDTTNASSSTA 282
                          D    + +R S+VALK++L E    S     + +G + N  + T 
Sbjct: 168 PM-------------DDNMIFHNRQSVVALKKNLEESEQPS-----SRSGSSANMETRTT 209

Query: 283 GSLKNYILDDNNRIL-LPSQLIDDDRQDSGRTDSIDIPGRGHAATATIGSNRDTTALSDD 341
                    DN R+  LP Q +      +  T      GR    T    S+ D   +SDD
Sbjct: 210 PI-------DNRRLKPLPRQAVAAAITATATTAPATPNGRPSIDTDPESSDIDN--ISDD 260

Query: 342 QDTSLSPGSPVSQLDLSEGFLEDNDVLLNNAVLESAIRKDMKRKRQEK 389
                             G+L   D++LN ++L + I++DMKRKR ++
Sbjct: 261 ------------------GYLHSKDIVLNQSLLHNVIKRDMKRKRDKE 290

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  336 bits (862), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 220/325 (67%), Gaps = 20/325 (6%)

Query: 565 MEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYE 624
           M ++     W  P+L LP GVYK QFLINGELRHS FLPTATDSFGN VNWFEV+ G+  
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 625 IEPLRDVPVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSS--YRSSKYI 682
           IEP RDV  +     + + +S  +           +  PRPP+LS ++S S    S+K+I
Sbjct: 61  IEPSRDVISNDFT-ENQVAISANDP----------SASPRPPILSGSSSFSNWKNSAKHI 109

Query: 683 ERSTTPYSDYTGILSRSNSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXX 742
           ERS TPYSDYTG+ SR++ A+P L  K +SSYD+ AP+P   YEYS +IPELFK N    
Sbjct: 110 ERSGTPYSDYTGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGS 169

Query: 743 XXXXXXXXXXSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQK 802
                        + +K     QPSF  RVQDCNQD LF+DLQ++  ID+QAAEE FLQ+
Sbjct: 170 STPPPYQESVPSQNPVKN----QPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQ 225

Query: 803 YPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVG 862
           YP PDLP+YL+SS+LN VF   Q+ N   +TK+ +N ++PHVNLNHLLTSSIR+EIISVG
Sbjct: 226 YPTPDLPVYLDSSFLNAVFRGFQEKN---DTKSKLNHIVPHVNLNHLLTSSIRDEIISVG 282

Query: 863 CTTRYEGKFITHVVYAPCYYENTNR 887
           CTTRYEGKFIT ++Y PCYY N  +
Sbjct: 283 CTTRYEGKFITQIIYTPCYYGNKEK 307

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  334 bits (856), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/388 (46%), Positives = 236/388 (60%), Gaps = 44/388 (11%)

Query: 523 DDLVNVVLKWRDCIVDPKTCKISVISSDISAVLALQSSKK-----------IPMEYETTE 571
           +D V+VVLKWRD I +PK CKI++IS DI   L   SSK+           +PM +    
Sbjct: 474 NDNVHVVLKWRDQIDNPKKCKIAIISDDIVNALESSSSKRKSNTNNNDNNTLPMVFNPMI 533

Query: 572 KSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDV 631
           K W++PNL LPPG+Y+L+F IN ++ HSNFLPTATDS GN VNWFEVLPGY  +EP RD 
Sbjct: 534 KEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDE 593

Query: 632 PVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPYSD 691
            +++         +  +      D T         ++    SSS+ S+K    S TPYSD
Sbjct: 594 IIETT-----FHTAPSQGTLSVHDLT---------MIRSRRSSSFVSAKSDLSSFTPYSD 639

Query: 692 YTGILSRSNSA-------RPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXX 744
           Y GI SRS+S+         L++ + ++  D+F P+ PKK  YS +IPELFK+       
Sbjct: 640 YAGI-SRSSSSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTN 698

Query: 745 XXXXXXXXSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYP 804
                   S       S  E+PSF  +V DCNQD+LF+DLQ+   IDA+ AE  FL +YP
Sbjct: 699 KMEIDDDGS-------SPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYP 751

Query: 805 VPDLPIYLNSSYLNKVFNQLQKDNN----AGETKAVVNPVIPHVNLNHLLTSSIREEIIS 860
           +PDLPIYLNS+YLNK+F Q QK +N       +   +  +IPHVNLNHLLTSSIR+EIIS
Sbjct: 752 IPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIIS 811

Query: 861 VGCTTRYEGKFITHVVYAPCYYENTNRK 888
           V CTTRY+GKFIT V+YAPC Y +   K
Sbjct: 812 VACTTRYQGKFITQVMYAPCNYSSQENK 839

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 88/206 (42%), Gaps = 44/206 (21%)

Query: 204 PGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSYLHRPSIVALKRSLVEGRIGS 263
           PGP++PTV+PT+H+   L   ++V+   +N        S  HRPSIVALK +L E  I  
Sbjct: 130 PGPSTPTVQPTKHDITSLEGSTDVNTGIDNMNVAGDLNS--HRPSIVALKNTLAESSIHP 187

Query: 264 KLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPGRG- 322
              +  +   ++N  S +  S  + +                      +T+SIDIP R  
Sbjct: 188 PSDLSKTVSTSSNCQSFSTESSSSAL---------------------HKTESIDIPRRHS 226

Query: 323 -----------------HAATATIGSNRDTT---ALSDDQDTSLSPGSPVSQLDLSEGFL 362
                            H+      +N +T     L   ++         S  D   G L
Sbjct: 227 QGFNENYNETMLKHPTVHSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVL 286

Query: 363 EDNDVLLNNAVLESAIRKDMKRKRQE 388
           +  D+++N + L++A+++DMKRKR +
Sbjct: 287 QSADIVVNQSTLQNALKRDMKRKRTD 312

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score =  323 bits (827), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 184/376 (48%), Positives = 236/376 (62%), Gaps = 43/376 (11%)

Query: 528 VVLKWRDCIVDPKTCKISVISSDISAVL------------ALQSSK----KIPMEYETTE 571
           VVLKW+       T ++S++S+DI++ L            +L S K    +I M Y++  
Sbjct: 451 VVLKWKSDTNMTATTEVSIVSNDIASALKEQREVNLDDDASLDSEKPLNSRIRMIYDSVH 510

Query: 572 KSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDV 631
           + WFVP+L LP G+Y+LQF ING L HSNFLPTATDS GNFVNWFEVLPGY+ IEP RD 
Sbjct: 511 REWFVPDLFLPAGIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRD- 569

Query: 632 PVDSMNYGSDLGVSMKESVNGGSDFTITAPI-PRPPLLSQATSSSYRSSKYIERSTTPYS 690
                   +D+   M+ +++        API P P  LS +  SSY S+K  ER  TP+S
Sbjct: 570 -------EADMDFQMRSTLDE------EAPIRPEPKRLSSSRKSSYYSAKDGERPGTPFS 616

Query: 691 DYTGILSRSNSA--RPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXXXXX 748
           DY G LSRSNS   R    + K+SS D+ A + P+K EYS +IP LF +           
Sbjct: 617 DYRG-LSRSNSVFLRGSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIG--------EA 667

Query: 749 XXXXSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDL 808
               S     + S  ++PSF  +V DCNQD LF+ LQQ   IDA+ AE  FL +YP+PDL
Sbjct: 668 STTTSKDHFERLSPQDRPSFTHKVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPIPDL 727

Query: 809 PIYLNSSYLNKVFNQLQKDNNAGE-TKAVVNPVIPHVNLNHLLTSSIREEIISVGCTTRY 867
           PIYLNSSYLN++ NQ   ++   +  +  +N +IPHVNLNHLLTSSIR+EIISV CTTRY
Sbjct: 728 PIYLNSSYLNRILNQSNPNSEFHDGDEGGINHIIPHVNLNHLLTSSIRDEIISVACTTRY 787

Query: 868 EGKFITHVVYAPCYYE 883
           EGKFIT V+YAPCYY+
Sbjct: 788 EGKFITQVIYAPCYYK 803

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 87/195 (44%), Gaps = 42/195 (21%)

Query: 199 PFPLSPGPASPTVEPTRHEAELLPTR--SEVDGEAENDRYRDQFPSY-LHRPSIVALKRS 255
           P  LSPGP+  TV+ T+ + + L T   + VD   EN+  R   P +  HR SI+ALK++
Sbjct: 132 PSFLSPGPSMATVKQTKSDLDDLSTVNCTVVDETMENE--RSGHPHHERHRSSIIALKKT 189

Query: 256 LVEGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDS 315
           L+E          T++   T +SS  + SL                          +T S
Sbjct: 190 LMENS-------ATASPSPTRSSSVHSASLPPLT----------------------KTGS 220

Query: 316 IDIPGRGHAATATIGSNRDTTALSDDQDTSLSPGSPVSQ------LDLSEGFLEDNDVLL 369
           IDIP +   +            LS   D + S  S   +      +D   G L+  D++L
Sbjct: 221 IDIPVKQTYSKKPSVHAYQYQYLS--PDPTFSGNSHTGKEANGDNIDAEAGVLQSEDMVL 278

Query: 370 NNAVLESAIRKDMKR 384
           N ++L++A++KDM+R
Sbjct: 279 NQSLLQNALKKDMQR 293

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 48/101 (47%), Gaps = 17/101 (16%)

Query: 1   MGNTASTVN--LQEKRHHSHLLP----RDRQHSITSQLFPGRNTRNAQDDSPVSXXXXXX 54
           MGN+ ST +     KR+H + L     +DRQ SITSQLF  + + + +  S  S      
Sbjct: 1   MGNSPSTQDPSHSSKRNHGYHLHEAFNKDRQGSITSQLFNNKKSVHKRHTSHASSHKAAI 60

Query: 55  XPGKWKRRLS----------LNHAPAVVSTPSPLFKPNYSM 85
            P + +   S          +N+   +   PSPLFK +YS+
Sbjct: 61  -PHRMQLLASHDVASDCDSSVNNDTIIDKEPSPLFKKDYSL 100

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score =  322 bits (826), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 187/377 (49%), Positives = 231/377 (61%), Gaps = 47/377 (12%)

Query: 528 VVLKWRDCIVDPKTCKISVISSDISAVL------------ALQSSK----KIPMEYETTE 571
           V+LKW++    P T ++S+IS DI++ L            +L S K    +I M Y+   
Sbjct: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528

Query: 572 KSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDV 631
           K WFVP L LPPG+Y+LQF ING L HSNFLPTATDS G FVNWFEVLPGY+ IEP RD 
Sbjct: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588

Query: 632 PVDSMNYGSDLGVSMKESVNGGSDFTITAPI-PRP-PLLSQATSSSYRSSKYIERSTTPY 689
                  GS + V               API P P  L S +  SSY S+K +ER +TP+
Sbjct: 589 ADTESQVGSTIDVE--------------APIRPEPKRLSSSSRKSSYYSAKGVERPSTPF 634

Query: 690 SDYTGILSRSNSA--RPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXXXX 747
           SDY G LSRSNSA  R    + K+SS D+ A + P+  EYS +IP LF +          
Sbjct: 635 SDYRG-LSRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQE 693

Query: 748 XXXXXSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPD 807
                           + PSF  +V DCNQD LF+ LQQ   IDA+ AE  FL +YP+PD
Sbjct: 694 DLPSQ-----------DLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPD 742

Query: 808 LPIYLNSSYLNKVFNQLQKDNNAGET-KAVVNPVIPHVNLNHLLTSSIREEIISVGCTTR 866
           LPIYLNSSYLNK+ NQ   ++ +G+  +  +N +IPHVNLNHLLTSSIR+EIISV CTTR
Sbjct: 743 LPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTR 802

Query: 867 YEGKFITHVVYAPCYYE 883
           YEGKFIT V+YAPCYY+
Sbjct: 803 YEGKFITQVIYAPCYYK 819

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 105/400 (26%), Positives = 166/400 (41%), Gaps = 120/400 (30%)

Query: 1   MGNTASTVN--LQEKRHHSHLLP----RDRQHSITSQLFPGRNTRNAQDDSPVSXXXXXX 54
           MGN+ ST +     K+ HSH L     +DRQ SITSQLF  R + + +  S  +      
Sbjct: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAI 60

Query: 55  XPGKWKRRLSLNHAPAVVSTPSPLFKPNYSMNESSNASIAGLGSNYTTSSQEDLNKLQAV 114
            P     R+ L                              L S  +TSS  D       
Sbjct: 61  PP-----RMQL------------------------------LASQPSTSSTSD------C 79

Query: 115 DSSRKNTLSSIESNSASSKPAPPLLNPTNVS--ADDSSQLRDHLAGLTIHSEGLXXXXXX 172
           D S  N +S      A+S+P+P      +V+  ADD+      LA L+++          
Sbjct: 80  DDSTNNDVS------AASEPSPLFKKDYSVAKAADDNETT---LANLSLYDR-------- 122

Query: 173 XXXXXXYDSSATPNPATNYVSSPRVYPFPLSPGPASPTVEPTRHEAELLPT-RSEVDGEA 231
                 +D+SA        V SP      LSPGP+  TV+ T++  + L T  + +  E 
Sbjct: 123 ------HDASA----PEEQVKSPTF----LSPGPSMATVKQTKNYPDDLSTVNNTIVDET 168

Query: 232 ENDRYRDQFPSYLHRPSIVALKRSLVEGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILD 291
             D  +D      HR SI+ALK++L+E            N  T + S + + S+      
Sbjct: 169 IGDERKDHPHHERHRSSIIALKKTLLE------------NSATASPSPTRSSSI------ 210

Query: 292 DNNRILLPSQLIDDDRQDSGRTDSIDIP-GRGHAATATIGSNR------DTTALSDDQDT 344
            ++  LLP            +  SIDIP  + ++   ++ + +      D T LSDD  +
Sbjct: 211 -HSTSLLPL----------SKAGSIDIPIKQTYSKKPSVHAYQYQYLDPDPT-LSDD--S 256

Query: 345 SLSPGSPVSQLDLSEGFLEDNDVLLNNAVLESAIRKDMKR 384
            L   S    +D   G L+  D++LN ++L++A++KD++R
Sbjct: 257 QLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQR 296

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score =  320 bits (819), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 240/382 (62%), Gaps = 54/382 (14%)

Query: 528 VVLKWRDCIVDPKTCKISVISSDISAVL------------ALQSSK----KIPMEYETTE 571
           V+LKW++      T ++S++S+DI++ L            +L S K    +I M Y+   
Sbjct: 454 VILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVH 513

Query: 572 KSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDV 631
           K WF P+L LPPG+Y+LQF ING L HSN+LPTATDS GNFVNWFEVLPGY+ IEP R+ 
Sbjct: 514 KEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRN- 572

Query: 632 PVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPL---LSQATSSSYRSSKYIERSTTP 688
                   +DLG  ++  +   S      PI RP L    S +  SSY S+K +ER +TP
Sbjct: 573 -------EADLGSQVEPVLEEES------PI-RPELKRFSSSSRKSSYYSAKGVERPSTP 618

Query: 689 YSDYTGILSRSNSA--RPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXXX 746
           +SDY G LSRS+S   R    + K+SS D+ A + P+K EYS +IP LF +         
Sbjct: 619 FSDYRG-LSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNI--------- 668

Query: 747 XXXXXXSYSSLLKGSE----AEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQK 802
                   +S+++ S      EQPSF  +V DCNQD LF+ LQQ   IDA+ AE  FL +
Sbjct: 669 ---ADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSR 725

Query: 803 YPVPDLPIYLNSSYLNKVFNQLQKDNNAGE-TKAVVNPVIPHVNLNHLLTSSIREEIISV 861
           YP+PDLPIYLNSSYLNK+ NQ   ++   +  +  +N +IPHVNLNHLLTSSIR+EIISV
Sbjct: 726 YPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISV 785

Query: 862 GCTTRYEGKFITHVVYAPCYYE 883
            CTTRYEGKFIT V+YAPCYY+
Sbjct: 786 ACTTRYEGKFITQVIYAPCYYK 807

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 85/200 (42%), Gaps = 52/200 (26%)

Query: 199 PFPLSPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSY-LHRPSIVALKRSLV 257
           P  LSPGP+  TV+ T+ + E L T +    +   +  R   P +  HR SI+ALK++L+
Sbjct: 132 PSFLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHRSSIIALKKTLL 191

Query: 258 EGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSID 317
           E          T++   T +SS  + S+                          + DSID
Sbjct: 192 ENS-------ATASPSPTRSSSVHSASMPPLT----------------------KMDSID 222

Query: 318 IPGR-GHAATATIGSNRDTTALSDDQDTSLSPGSPVS------------QLDLSEGFLED 364
            P +  ++   +I +          Q   LSP    S             +D   G L+ 
Sbjct: 223 TPLKPAYSKKPSIHAY---------QYQYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQS 273

Query: 365 NDVLLNNAVLESAIRKDMKR 384
            D++LN ++L++A++KDM+R
Sbjct: 274 EDMVLNQSLLQNALKKDMQR 293

 Score = 32.3 bits (72), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 25/117 (21%)

Query: 1   MGNTASTVN-----LQEKRHHSH-LLPRDRQHSITSQLFPGRNTRNAQDDSPVSXXXXXX 54
           MGN+ ST +      +E  +H H    +DRQ SITSQLF  R + + +  S  S      
Sbjct: 1   MGNSPSTQDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHN--- 57

Query: 55  XPGKWKRRL--------------SLNHAPAVVSTPSPLFKPNYSMNESSNASIAGLG 97
             G    R+              S+N    +   PS LFK +YS+N +++ +   L 
Sbjct: 58  --GTIPSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLA 112

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score =  317 bits (813), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 181/384 (47%), Positives = 234/384 (60%), Gaps = 58/384 (15%)

Query: 528 VVLKWRDCIVDPKTCKISVISSDISAVL------------ALQSSK----KIPMEYETTE 571
           VVLKW+D      T ++ ++S+DI++ L            +L S K    +I M Y+   
Sbjct: 454 VVLKWKDDGTVAATTEVFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVYDDVH 513

Query: 572 KSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDV 631
           K WFVP+L LP G+Y+LQF ING L HSNFLPTATDS GNFVNWFEVLPGY+ IEP R+ 
Sbjct: 514 KEWFVPDLFLPAGIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRN- 572

Query: 632 PVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQ----ATSSSYRSSKYIERSTT 687
                          +  ++   + T+   +P+ P L +    +  SSY S+K +ER +T
Sbjct: 573 ---------------EADIDSQVEPTLDEELPKRPELKRFPSSSRKSSYYSAKGVERPST 617

Query: 688 PYSDYTGILSRSNS--ARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXX 745
           P+SDY G LSRS+S   R    + K+SS D+ A + P++  YS +IP LF +        
Sbjct: 618 PFSDYRG-LSRSSSINMRDSFVRLKASSLDLMAEVKPERLVYSNEIPNLFNIGDGSTIS- 675

Query: 746 XXXXXXXSYSSLLKGSE-----AEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFL 800
                       +KG        E PSF  RV DCNQD LF+ LQQ   IDA+ AE  FL
Sbjct: 676 ------------VKGDSDDVHPQEPPSFTHRVVDCNQDDLFATLQQGGNIDAETAEAVFL 723

Query: 801 QKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGE-TKAVVNPVIPHVNLNHLLTSSIREEII 859
            +YPVPDLPIYLNSSYLN++ NQ  +++ + E  +  +N +IPHVNLNHLLTSSIR+EII
Sbjct: 724 SRYPVPDLPIYLNSSYLNRILNQSNQNSESHERDEGAINHIIPHVNLNHLLTSSIRDEII 783

Query: 860 SVGCTTRYEGKFITHVVYAPCYYE 883
           SV CTTRYEGKFIT VVYAPCYY+
Sbjct: 784 SVACTTRYEGKFITQVVYAPCYYK 807

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 91/196 (46%), Gaps = 44/196 (22%)

Query: 199 PFPLSPGPASPTVEPTRHEAELLPT--RSEVDGEAENDRYRDQFPSYLHRPSIVALKRSL 256
           P  LSPGP+  TV+ T+ + + L T   + VD   EN+R  D+     HR SI+ALK++L
Sbjct: 132 PSFLSPGPSMATVKRTKSDLDDLSTLNYTMVDETTENER-NDKPHHERHRSSIIALKKNL 190

Query: 257 VEGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSI 316
           +E          T++   T +SS  + SL                          +TDSI
Sbjct: 191 LESSA-------TASPSPTRSSSVHSASLPALT----------------------KTDSI 221

Query: 317 DIPGRG--------HAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEGFLEDNDVL 368
           DIP R         HA      +N +T + +   D   +  S    +D   G L+  D++
Sbjct: 222 DIPVRQPYSKKPSIHAYQYQYLNNDETFSENSQMDKEGNSDS----VDAEAGVLQSEDMV 277

Query: 369 LNNAVLESAIRKDMKR 384
           LN ++L++A++KDM+R
Sbjct: 278 LNQSLLQNALKKDMQR 293

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 58/126 (46%), Gaps = 22/126 (17%)

Query: 1   MGNTASTVN-----LQEKRHHSH-LLPRDRQHSITSQLFPGRNTRNAQDDSPVSXXXXXX 54
           MGN+ ST +      +E  HH H    +DRQ SITSQLF  R + + +  S  S      
Sbjct: 1   MGNSPSTQDPSHSTKKEHGHHFHDAFNKDRQGSITSQLFNNRKSTHKRRASHTSEHNGAI 60

Query: 55  XPGKWKRRLSLNHAPA------------VVSTPSPLFKPNYSMNESSNASIAGLGSNYTT 102
            P   + +L  +H P+            +   PS LFK +YS++ +++ +   L  N T 
Sbjct: 61  PP---RMQLLASHDPSTDCDGRMSSDTTIDKGPSHLFKKDYSLSSAADVNDTTLA-NLTL 116

Query: 103 SSQEDL 108
           S   D+
Sbjct: 117 SDDHDV 122

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  305 bits (781), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 172/403 (42%), Positives = 238/403 (59%), Gaps = 43/403 (10%)

Query: 524 DLVNVVLKWRDCI--VDPKTCKISVISSDISA-------------VLALQSSK--KIPME 566
           D  NV+LKWRD     + K  K+ ++S++I A             +LA  +S+  KIP+ 
Sbjct: 348 DRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLS 407

Query: 567 YETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIE 626
           Y++    W+VP+L LP G+Y+LQFL+NG L HS+FLPTATD  GN +NWFEVL GY  IE
Sbjct: 408 YDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIE 467

Query: 627 PLRDVPVDSMNYGSDLGVSMKESVNGG----SDFTITA-----PI------PRPPLLSQA 671
           P RD      +Y S +  +++   N G    SD + T+     P+      P P     +
Sbjct: 468 PYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQAS 527

Query: 672 TSSSYRSSKYIERSTTPYSDYTGILSRSNS----ARPLLN-QKKSSSYDVFAPLPPKKYE 726
            +SSY S+K  E+S T +SDYTG+ SR+NS      P+ N   + +  + F P+ PK YE
Sbjct: 528 RNSSYYSAKSFEKSITQFSDYTGV-SRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYE 586

Query: 727 YSTDIPELFKVNXXXXXXXXXXXXXXSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQ 786
           YS +IP LF+++              +  +       ++PSF  RV DCNQD LF DLQ+
Sbjct: 587 YSNNIPALFRISCDMEDVDDDNGTENNPRAFY-----DRPSFTNRVVDCNQDALFGDLQK 641

Query: 787 HDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNL 846
             ++DA+ AE  FL+KY VPDLP+YLNS+YLNK+F++  +        + +N +IPHVNL
Sbjct: 642 GGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPHVNL 701

Query: 847 NHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYENTNRKE 889
            HLLTSSIR+ I+SV CTTRY GKFIT V+YAPC  +    KE
Sbjct: 702 KHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQLESKE 744

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 85/191 (44%), Gaps = 25/191 (13%)

Query: 203 SPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSYL--HRPSIVALKRSLVEGR 260
           SPGP++ TV+  + E     T  +   + ++D    Q    +  HRPSIVALK SL E  
Sbjct: 47  SPGPSNATVQTIKREV----THGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVA 102

Query: 261 IGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPG 320
             +    +     T N    +  S  +   D+      PS ++        RT SIDIP 
Sbjct: 103 EAAAAKRKNLPFRTINNVMDSQRSSISSSRDEIFVDASPSPVV-------TRTASIDIP- 154

Query: 321 RGHAATATIGSNRDTTA---LSDDQDTSLSPGSPVSQLDLSEGFLEDNDVLLNNAVLESA 377
              +      SNR   +   L + + + +  G P        G L+  DV+LN  +LE A
Sbjct: 155 --RSEDGRRSSNRLVNSKPYLYNYEPSGVPVGDP------DGGMLQGTDVVLNQELLEQA 206

Query: 378 IRKDMKRKRQE 388
           +++DMKRKR +
Sbjct: 207 LKRDMKRKRAD 217

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  280 bits (716), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 153/374 (40%), Positives = 219/374 (58%), Gaps = 40/374 (10%)

Query: 524  DLVNVVLKWRDCIVDPKT--CKISVISSDISAVL------ALQSSKKIPMEYETTEKSWF 575
            +L NV++K+RD + + +    KI +IS DI+  L       L  + K+ + Y   EK+W 
Sbjct: 660  ELQNVIIKYRDPMEESEIPETKIQLISKDINTTLHYDTTDLLTENNKMELVYNKDEKAWI 719

Query: 576  VPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDS 635
            +PNL LPPG+Y++QFL+N +L+HS+FLPTATD FGN VNWFEVL GY  IEP RD  + S
Sbjct: 720  LPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENISS 779

Query: 636  MNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTGI 695
             +                SD T+   I    L    T S  + +    + +TP S+YTG+
Sbjct: 780  AD---------------NSDGTLMQNIIPEKL---KTISMTKMAGNGSKGSTPRSNYTGV 821

Query: 696  LSRSNSARPLLNQKKSS-SYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXXXXXXXXXSY 754
               ++ +    +    S + ++F PL P K EYST+IPE+FK                S 
Sbjct: 822  SRSNSLSASSSSSVWKSVNVNLFTPLEPNKVEYSTEIPEIFK---------NTTENNTSN 872

Query: 755  SSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNS 814
            + +    E ++P     V DC+Q+ LF DL     +D + AE+ FL KYPVP+LPIYLNS
Sbjct: 873  APMQYHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNS 932

Query: 815  SYLNKVFNQLQKDNNAGETKAV----VNPVIPHVNLNHLLTSSIREEIISVGCTTRYEGK 870
             Y+ ++  ++ + + +G   ++    +N +IPHVNL HLLTSSIREE+ISV CTTRYEGK
Sbjct: 933  KYMTQIVGEINQPSGSGPPSSLNNNDLNHIIPHVNLQHLLTSSIREEMISVACTTRYEGK 992

Query: 871  FITHVVYAPCYYEN 884
            F+T ++Y PC+YEN
Sbjct: 993  FLTQILYTPCFYEN 1006

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 25/80 (31%)

Query: 202 LSPGPASPTVEPTRHEA------ELLPTRSEVDGEAENDRYRDQFPSY------------ 243
           LSPGP+ PTVE ++ +A      E+   ++ +     +  YR+  P+             
Sbjct: 139 LSPGPSHPTVEQSKQQANYNEDQEMF--KNGITQTKNSSSYRNTSPNIPSNTNNIINMNS 196

Query: 244 -----LHRPSIVALKRSLVE 258
                 HRPS+VALK+SL E
Sbjct: 197 HNYASSHRPSVVALKKSLEE 216

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  250 bits (639), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 162/398 (40%), Positives = 210/398 (52%), Gaps = 85/398 (21%)

Query: 522 EDDLVNVVLKWRDCIVDP-KTCKISVISSDISAVL-ALQSSKKIP----------MEYET 569
           E++ V V+LKWRD  + P +    ++ S DI + L A++S    P          ++Y+ 
Sbjct: 211 ENENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDA 270

Query: 570 TEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLR 629
            +K WFVP+L LPPG+Y+L+FLING L HSNFLPTATD+ G  VNWFEVLPGY  IEP R
Sbjct: 271 KKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYR 330

Query: 630 DVPVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPY 689
           D                 ES+ G  D +I              S  Y       +STT  
Sbjct: 331 D-----------------ESMIGQDDESI-------------DSQPY-------KSTTDV 353

Query: 690 SDYTGI--------------LSRSNSARPLLNQKKSSSYDV---------FAPLPPKKYE 726
           +DY GI              L   N     LN++ S+S +             LP  KYE
Sbjct: 354 TDYAGISRSSSVVSKHSKSNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYE 413

Query: 727 YSTDIPELFKVNXXXXXXXXXXXXXXSYSSLLKGSEAEQPSFH-CRVQDCNQDRLFSDLQ 785
           YST+IPELF+ +                S L       +  F   RV + NQD LF+ +Q
Sbjct: 414 YSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQ 473

Query: 786 QHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVN 845
           +  ++  + AEE+FL K+ V DLPIYLNS+YLNK F        +GE    VN +IPHVN
Sbjct: 474 KIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNF--------SGE----VNHIIPHVN 521

Query: 846 LNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYE 883
           L HLLT+SI+E+II VGCTTRY GKFIT V+YAPC Y+
Sbjct: 522 LRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCSYD 559

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (73%)

Query: 355 LDLSEGFLEDNDVLLNNAVLESAIRKDMKRKRQE 388
           LD   G +++ D +LN A+L+ AI+KDMKRKR +
Sbjct: 62  LDPDSGIVQNQDRVLNQAILQHAIKKDMKRKRND 95

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  235 bits (600), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 149/382 (39%), Positives = 206/382 (53%), Gaps = 45/382 (11%)

Query: 526 VNVVLKWRDCIVDPKTCKISVISSDISAVLAL-----QSSKKIPMEYETTEKSWFVPNLK 580
           V V LKWRD I D +   IS++S++I +V+ +     ++S    M Y      W    L 
Sbjct: 394 VRVFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTKYLF 453

Query: 581 LPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNYGS 640
           LPPG+YKLQF +NG LRHS++LPTATD+ GN VNWFEV  GY  IEP RD          
Sbjct: 454 LPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD---------- 503

Query: 641 DLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTGILSRSN 700
                +K  ++GG    I  PIP    +   +S     S +  R TTPYSD+ GI    N
Sbjct: 504 --NDYVKNEISGG----ILQPIPNTLGIPSVSSQLSSFSFHASRPTTPYSDFAGI----N 553

Query: 701 SARPL-LNQK----KSSSYDV-FA-PLPPKKYEYSTDIPELFKVNXXXXXXXXXXXXXXS 753
            + PL L +K    KS+++D+ F+  +P  KY+Y+T+IPE++K                 
Sbjct: 554 RSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVDLDLTTAKATETTTD 613

Query: 754 YSSLLK-----GSEAEQPSFHCRVQDCNQDRLFSDLQQH--DRIDAQAAEEFFLQKYPVP 806
              + K     G+     S    V  C+Q  LF  L ++    ++    E+ FL KYP+ 
Sbjct: 614 DEDITKPPLYLGTGGN--SIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPIT 671

Query: 807 DLPIYLNSSYLNKVFNQLQK----DNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVG 862
           DLPIYLN+ Y+NK   Q +     D+   E   VVN ++PHVN+ HLLT +I++ +I+V 
Sbjct: 672 DLPIYLNTDYMNKALEQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLLTHNIQDSVIAVA 731

Query: 863 CTTRYEGKFITHVVYAPCYYEN 884
           CT RY GKFIT VVY+PC  EN
Sbjct: 732 CTVRYGGKFITQVVYSPCSVEN 753

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  201 bits (512), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 183/365 (50%), Gaps = 76/365 (20%)

Query: 529 VLKWRDCIVDPKTCKISVISSDI------------SAVLALQSSKK--IPMEYETTEKSW 574
           +LKWR+ I       ++++S DI            S+++     KK  I + Y+     W
Sbjct: 157 ILKWREPI--DHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEW 214

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVD 634
           ++PNL LPPG+YKLQFLING L HSN+LPTAT++ GN VNWFEV+ GY  IEP RD    
Sbjct: 215 YLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRD---- 270

Query: 635 SMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTG 694
                                           ++ +  S++  S      S+   +DY G
Sbjct: 271 -----------------------------EERIIHREKSTANESI-----SSNSLTDYAG 296

Query: 695 ILSRSNSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXXXXXXXXXSY 754
           I   S+      +   SS       L   + +Y+ +IPE+FK +              S 
Sbjct: 297 ISRSSSIVSNKSSLISSSLKLTNLNLNDDEIKYTNEIPEIFKFDSTANSNVNNQAFDMSL 356

Query: 755 SSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNS 814
           S               +V D NQD +F+ LQ+  R++   AE +FL ++ + DLPIYLNS
Sbjct: 357 S---------------KVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNS 401

Query: 815 SYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTTRYEGKFITH 874
           ++LNK+F    +DNN   T   V    PHVNLNHLLT+SI+++ + V CTTRY GKFIT 
Sbjct: 402 NFLNKIF---IRDNNNETTNNTV----PHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQ 454

Query: 875 VVYAP 879
           ++YAP
Sbjct: 455 IMYAP 459

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  202 bits (515), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 131/372 (35%), Positives = 193/372 (51%), Gaps = 40/372 (10%)

Query: 526 VNVVLKWRDCIVDPKTCK-ISVISSDISAVLALQSS-----KKIPMEYETTEKSWFVPNL 579
           VNVVL+WRD  +  +TCK +S+IS DI   +  Q+S         M Y+  E +W +P+L
Sbjct: 310 VNVVLRWRDSYIQNETCKSVSIISEDILTSVQAQNSGVLLISNFSMTYDKNENNWVLPDL 369

Query: 580 KLPPGVYKLQFLING-ELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRD---VPVDS 635
            LPPG Y+L+FLI+  + R+SN+LP   D  G  +N  E+LPGY  +EP      + +  
Sbjct: 370 FLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEHNNHIMIQE 429

Query: 636 MNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTGI 695
               S+L ++            + +  P  P L +  SS   S   I         Y+ +
Sbjct: 430 NIINSELSLNNSRQ--------LQSEPPSYPELEENFSSPIES--IISEDELDNDQYSKV 479

Query: 696 LSRSNSARPLLNQKKSSSYDVFAPLPPKKYE--YSTDIPELFKVNXXXXXXXXXXXXXXS 753
             + N++   + Q K+S       + P   E  Y+ +IP+LFK+                
Sbjct: 480 YGKRNNS---IGQSKTS-----LSIKPCISEVTYTNEIPQLFKI---TDNNCIVNENYER 528

Query: 754 YSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLN 813
           Y  +   S  E P    RV DCNQD LF+  QQ+  +D + AE+ FL+KYPVPDLP++L+
Sbjct: 529 YGFVEPPSYGE-PGLENRVIDCNQDILFATFQQNGAVDVELAEQLFLEKYPVPDLPVFLD 587

Query: 814 SSYLNKVFNQLQKDNNA----GETKAVVN--PVIPHVNLNHLLTSSIREEIISVGCTTRY 867
           S +  K+F+      N     GE   + N    IPHVNLNH+LT+ I   +ISV CTTRY
Sbjct: 588 SHFSEKLFDNNDSSKNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACTTRY 647

Query: 868 EGKFITHVVYAP 879
           + KF+TH++Y+P
Sbjct: 648 KRKFVTHILYSP 659

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score =  138 bits (347), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 107/373 (28%), Positives = 170/373 (45%), Gaps = 63/373 (16%)

Query: 528 VVLKWRDCIVDPKTCK-ISVISSDISAVLALQSS-----KKIPMEYETTEKSWFVPNLKL 581
           V L+W D    P   + +S+IS DI  V+    S     K++P++Y++    W + +L L
Sbjct: 314 VTLRWIDSKFKPNNYQSVSIISEDIIDVINFYRSNNDKIKRLPLKYDSLTHEWKISDLFL 373

Query: 582 PPGVYKLQFLIN-GELRHSNFLPTATDSFGNFVNWFEVLPGYYE-IEPLRDVPVDSMNYG 639
           P G Y+  FLIN  ++ HS  + T  D FG  VN+FEV P Y    EPL+          
Sbjct: 374 PAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEV-PKYVRTFEPLQ---------- 422

Query: 640 SDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTGILSRS 699
             L  ++         +T+T    R               ++IE S T  S++  +L   
Sbjct: 423 --LSSAL---------YTVTQADDR---------------RHIECSKTS-SEFLNLLDNY 455

Query: 700 NSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXXXXXXXXXSYSSLLK 759
           +  R   N    S  +          +Y+  IPELFK +                 + L+
Sbjct: 456 D-IRTRYNANFYSHNESGTGNNFNNNKYTNQIPELFKFSEKNIRELSTETEI----TFLE 510

Query: 760 GSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNK 819
                +PSF+  + DC+Q++LF  LQQ+  +D+  AE+  LQ+YPV +LPI+  +  + K
Sbjct: 511 PPSYGEPSFYNNIVDCSQEKLFLSLQQNGAVDSYVAEQVILQRYPVSELPIFFENISMEK 570

Query: 820 VFNQLQKDNNAGETKAVVNPVI------------PHVNLNHLLTSSIREEIISVGCTTRY 867
           + +     N +   K  +  +             PHV LNHL+T  I   ++SV  TTRY
Sbjct: 571 LASHNNNLNKSHTNKHWLEGLTPNESDNITPKEPPHVILNHLVTQKISRNVVSVAVTTRY 630

Query: 868 EGKFITHVVYAPC 880
           + K+IT ++Y+P 
Sbjct: 631 KQKYITQILYSPI 643

>Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [contig
           192] PARTIAL
          Length = 377

 Score =  118 bits (296), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 160/570 (28%), Positives = 216/570 (37%), Gaps = 214/570 (37%)

Query: 1   MGNTASTVNLQEKRHHSHLL--PRDRQHSITSQLFPGRNT-RNAQDDSPVSXXXXXXXPG 57
           MGN  ST N+Q +R  S L+   R RQ SITSQLFP R T RN ++              
Sbjct: 1   MGNNPSTANMQNRRV-SQLVNDSRGRQDSITSQLFPSRTTGRNPEEKK------------ 47

Query: 58  KWKRRLSLNHAPAVVS---TPSPLFKPNYSMNESSNASIAGLGSNYTTSSQEDLNKLQAV 114
            WK R+         S    PSP F+ +YS++ +S                         
Sbjct: 48  GWKSRVLHGKRAGTTSPSSAPSP-FRKDYSLDSASE------------------------ 82

Query: 115 DSSRKNTLSSIESNSASSKPAPPLLNPTNVSADDSSQL--RDHLAGLTIHSEGLXXXXXX 172
                 T S     SAS  PAPP+    + SA+DSS L  RDHLA L++ +         
Sbjct: 83  ------TASYNFKKSASGNPAPPMCIAAHASAEDSSSLLLRDHLAELSLQNS-------- 128

Query: 173 XXXXXXYDSSATPNPATNYVSSPRVYPFPLSPGPASPTVEPTRHEAELLPTRSEVDGEAE 232
                  +S A      +  +SP   P   SPGP+SP V+ T+ EA              
Sbjct: 129 -------ESQA------HVAASP--APLLQSPGPSSPVVQSTKQEAL------------- 160

Query: 233 NDRYRDQFPSYLHRPSIVALKRSLVEGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILDD 292
                     +    S+ +LK+ LVEGRIG +++   S                      
Sbjct: 161 ----------FEQLSSMTSLKKMLVEGRIGDQINAPPS---------------------- 188

Query: 293 NNRILLPSQLIDDDRQDSGRTDSIDIPGRGHAATATIGSNRDTTALSDDQDTSLSPGSPV 352
                                 SIDIP R   A +        T +SDD D   S     
Sbjct: 189 ----------------------SIDIPRRPSVAVSD-------TYMSDDGDDEES----- 214

Query: 353 SQLDLSEGFLEDNDVLLNNAVLESAIRKDMKRKRQEKKRPEDQEKXXXXXXXXXXXXXXX 412
               L +G    NDV++NN++LE+A    MKRKR  +K      K               
Sbjct: 215 ----LLQGV---NDVVINNSMLENA----MKRKRSSRK-----NKALGASCSSRETMPHS 258

Query: 413 GVKKLKPLTPNEQERQRQVGEDYKNFLPSFQPIR-----------TGATPKLFQVSGNGG 461
           G+KKLKPL P           D  N LPSF  +            + A P+L  V     
Sbjct: 259 GLKKLKPLEP---------ASDRIN-LPSFSAMHARPTENDYDPDSAAVPRL--VPDTFD 306

Query: 462 RIDSFELGTVEHFESIGDDHRTVSGGSNAPNGGGKTTSMRANKXXXXXXXXXXXXGARYG 521
           RI SFE GTVEH+E           G+N  +   +  +   +                  
Sbjct: 307 RIGSFENGTVEHYE-----------GTNQSDFSSQGVNSSDSGSSDDTNSSIQD------ 349

Query: 522 EDDLVNVVLKWRDCIVDPKTCKISVISSDI 551
                +V+LKW+D IVDPK+CK+S++S DI
Sbjct: 350 ----THVILKWKDNIVDPKSCKMSIVSKDI 375

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 119/303 (39%), Gaps = 73/303 (24%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNY 638
           L+LPPG ++ +F+++ ELR S+FLPTATD  GNFVN+ EV      + P   V     N 
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEV------VAPPTTV---DENI 252

Query: 639 GSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATS-SSYRSSKYIERSTTPYSDYTGILS 697
           G +L     +S N   D     PI +    +Q     S RS    E    P  D     +
Sbjct: 253 GGNLPNQTADSSNYQQDMGAGKPIYKQDNQAQTKQPMSARSRIAFEIEKEP-DDLGDGFT 311

Query: 698 RSNSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNXXXXXXXXXXXXXXSYSSL 757
           R +  +PL                 +  EY+ DIP +F                      
Sbjct: 312 RFHEEKPL----------------KQDVEYTQDIPAVFT--------------------- 334

Query: 758 LKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYL 817
                   P+         Q  L  D QQ++  +        +     P LP +L     
Sbjct: 335 -------DPTV------MEQYYLTLDQQQNNHQN--------MAWLTPPQLPPHLE---- 369

Query: 818 NKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVY 877
           N + N      +  E  +   P+  HV LNHL TSSI+   + V    RY+ K++T ++Y
Sbjct: 370 NVILNSYSGSGSDNENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYVTQILY 429

Query: 878 APC 880
           AP 
Sbjct: 430 APL 432

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLP 620
           F   L+LPPG ++ +F+++ ELR S+FLPTATD  GNFVN+ E++P
Sbjct: 237 FHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIVP 282

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAG-ETKAVVNPVIPHVNLNHLLTSSIREEIISVGCT 864
           P LP  L     N + N   K+   G E  +   P+  HV LNHL TSSI+   + V   
Sbjct: 414 PQLPPQLE----NVILNNYNKNAEPGSENNSGALPIPNHVVLNHLATSSIKHNTLCVASI 469

Query: 865 TRYEGKFITHVVYAPC 880
            RY+ K+ T ++YAP 
Sbjct: 470 VRYKRKYATQILYAPL 485

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 2/69 (2%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNY 638
           LKLP G +K +F+++ ELR S+FLPTATD  GNFVN+ EV P    +E  +D+    M+ 
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKDIK--KMSL 250

Query: 639 GSDLGVSMK 647
            S L + ++
Sbjct: 251 RSKLALKIR 259

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 843 HVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAP 879
           +V LNHLLTSSI+  ++ +GC+ RY  K++T V Y P
Sbjct: 351 YVTLNHLLTSSIKNNMLCLGCSVRYRQKYVTQVYYTP 387

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (80%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLP 620
           L+LPPG ++ +F+++ ELR S+FLPTATD  GNFVN+ E+ P
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAP 243

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN  ++  Q ++N   + A+  P+  HV LNHL TSSI+   + V    
Sbjct: 343 PQLPPHLENVILNS-YSNAQGESNENNSGAL--PIPNHVILNHLATSSIKHNTLCVASIV 399

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K++T ++YAP 
Sbjct: 400 RYKRKYVTQILYAPL 414

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 25/42 (59%), Positives = 34/42 (80%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLP 620
           L+LPPG +K +F+++ ELR S+FLPTATD  GNFVN+ E +P
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVP 224

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%)

Query: 839 PVIPHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPC 880
           P+  HV L+HL TSSI+   + V    RY+ K++T ++YAP 
Sbjct: 382 PIPNHVVLHHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 423

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 7/71 (9%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVL--PGYYEIEPLRDVP 632
           F   L+LPPG ++ +F+++ ELR S+FLPTATD  GNFVN+ E++  P   E +P  D  
Sbjct: 213 FHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIVASPPSQEQQPASD-- 270

Query: 633 VDSMNYGSDLG 643
              + Y SD G
Sbjct: 271 ---LQYVSDEG 278

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L    LN  +N+    + A E  +   P+  HV LNHL TSSI+   + V    
Sbjct: 378 PQLPPHLEHVILNH-YNK--SADGASENTSGALPIPNHVVLNHLATSSIKHNTLCVASIV 434

Query: 866 RYEGKFITHVVYAPCY 881
           RY+ K+ T ++YAP +
Sbjct: 435 RYKSKYATQILYAPLH 450

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV-LPGYYEIEPLRDVPVDSMN 637
           L+LPPG ++ +F+++ ELR S++LPTATD  GNFVN+ EV  P  +  EP +    +  N
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSSEPQQQGSDNKAN 263

Query: 638 YGSD 641
           Y  D
Sbjct: 264 YADD 267

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN  ++  Q DN +G       P+  HV LNHL TSSI+   + V    
Sbjct: 348 PQLPPHLENVILNS-YSNAQTDNTSGAL-----PIPNHVILNHLATSSIKHNTLCVASIV 401

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K++T ++Y P 
Sbjct: 402 RYKQKYVTQILYTPL 416

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 36/46 (78%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLP 620
           F   L+LPPG ++ +F+++ ELR S++LPTATD  GNFVN+ E++P
Sbjct: 249 FHIKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIVP 294

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 806 PDLPIYLNSSYLNKV-FNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCT 864
           P LP +L +  LN    N  Q + + GE  +   P+  HV LNHL TSSI+   + V   
Sbjct: 427 PQLPPHLENVILNNYSANSAQAEESGGENNSGALPIPNHVVLNHLATSSIKHNTLCVASI 486

Query: 865 TRYEGKFITHVVYAPC 880
            RY+ K+ T ++YAP 
Sbjct: 487 VRYKSKYATQILYAPL 502

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEI 625
           F   L+LPPG ++ +F+++ ELR S++LPTATD  GNFVN+ EV+    E+
Sbjct: 174 FYVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIAPATEV 224

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN   N  Q ++N   + A+  P+  HV LNHL TSSI+   + V    
Sbjct: 337 PQLPPHLENVILNSYSNS-QGESNENTSGAL--PIPNHVILNHLATSSIKHNTLCVASIV 393

Query: 866 RYEGKFITHVVYAPC 880
           RY  K++T ++YAP 
Sbjct: 394 RYRQKYVTQILYAPL 408

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 2/81 (2%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV-LPGYYEIEPLRDVPVDSMN 637
           L+LPPG ++ +F+++ ELR S++LPTATD  GNFVN+ EV  P  +  EP + V  D+  
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSAPPDWTNEPQQQV-TDNKA 263

Query: 638 YGSDLGVSMKESVNGGSDFTI 658
           Y +D   S K  ++  S   +
Sbjct: 264 YHADDNQSTKRPMSARSRIAL 284

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN  ++  Q DN +G       P+  HV LNHL TSSI+   + V    
Sbjct: 349 PQLPPHLENVILNS-YSNAQTDNTSGAL-----PIPNHVILNHLATSSIKHNTLCVASIV 402

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K++T ++Y P 
Sbjct: 403 RYKQKYVTQILYTPL 417

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 35/45 (77%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVL 619
           F   L+LPPG ++ +F+++ ELR S+FLPTATD  GNFVN+ E++
Sbjct: 164 FHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 208

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN   +Q +  ++  E  +   P+  HV LNHL TSSI+   + V    
Sbjct: 354 PQLPPHLENVILNNYSSQSEPGDSGSENNSGALPIPNHVVLNHLATSSIKHSTLCVASIV 413

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K+ T ++Y+P 
Sbjct: 414 RYKRKYATQILYSPL 428

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 34/41 (82%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVL 619
           L+LPPG +K +F+++ ELR S++LPTATD  GNFVN+ EV+
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVV 232

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN  ++ LQ ++N   + A+  P+  HV LNHL TSSI+   + V    
Sbjct: 351 PQLPPHLENVILNS-YSSLQGESNENNSGAL--PIPNHVILNHLATSSIKHNTLCVASIV 407

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K+ T ++YAP 
Sbjct: 408 RYKQKYATQILYAPL 422

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 33/41 (80%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVL 619
           L+LPPG +K +F+++ ELR S+FLPTATD  GNFVN+ E +
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 218

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 806 PDLPIYLNSSYLNKVFNQLQK--DNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGC 863
           P LP +L +  LN   +   +   NN+G       P+  HV LNHL TSSI+   + V  
Sbjct: 363 PQLPPHLENVILNSYSSNSPETGQNNSGSL-----PIPNHVVLNHLATSSIKHNTLCVAS 417

Query: 864 TTRYEGKFITHVVYAPC 880
             RY+ K++T ++YAP 
Sbjct: 418 IVRYKRKYVTQILYAPL 434

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV-LPGYYEIEPLRDVPVDSMN 637
           L+LPPG ++ +F+++ ELR S++LPTATD  GNFVN+ EV  P  +  EP +    +  N
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSNEPQQQASDNKSN 266

Query: 638 YGSD 641
           +  D
Sbjct: 267 HADD 270

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN  ++  Q DNN   + A+  P+  HV LNHL TSSI+   + V    
Sbjct: 351 PQLPPHLENVILNN-YSNAQTDNNENTSGAL--PIPNHVILNHLATSSIKHNTLCVASIV 407

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K++T ++Y P 
Sbjct: 408 RYKQKYVTQILYTPL 422

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 33/40 (82%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           L+LPPG ++ +F+++ ELR S++LPTATD  GNFVN+ EV
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 243

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN  ++  Q DN +G       P+  HV LNHL TSSI+   + V    
Sbjct: 348 PQLPPHLENVILNS-YSNAQTDNTSGAL-----PIPNHVILNHLATSSIKHNTLCVASIV 401

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K++T ++Y P 
Sbjct: 402 RYKQKYVTQILYTPL 416

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 33/40 (82%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           L+LPPG ++ +F+++ ELR S++LPTATD  GNFVN+ E+
Sbjct: 251 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 839 PVIPHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPC 880
           P+  HV LNHL TSSI+   + V    RY+ K++T ++YAP 
Sbjct: 461 PIPNHVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 33/40 (82%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           L+LPPG ++ +F+++ ELR S++LPTATD  GNFVN+ E+
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN   N  Q  NN   + A+  P+  HV LNHL TSSI+   + V    
Sbjct: 360 PQLPPHLENVILNSYSNS-QGTNNENNSGAL--PIPNHVILNHLATSSIKHNTLCVASIV 416

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K++T ++YAP 
Sbjct: 417 RYKRKYVTQILYAPL 431

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 34/45 (75%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVL 619
           F   L+LPPG ++ +F+++ ELR S+FL TATD  GNFVN+ E++
Sbjct: 232 FQIKLQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIV 276

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L    LN  +N+    +   E  +   P+  HV LNHL TSSI+   + V    
Sbjct: 403 PQLPPHLEHVILNH-YNK--SADGVSENTSGALPIPNHVVLNHLATSSIKHNTLCVASIV 459

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K+ T ++YAP 
Sbjct: 460 RYKQKYATQILYAPL 474

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 33/44 (75%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           F   L+L PG ++ +F+++ ELR S+FLPTATD  GNFVN+ EV
Sbjct: 202 FHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 7/76 (9%)

Query: 806 PDLPIYLNSSYLNKVFNQLQK--DNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGC 863
           P LP  L +  LNK +    +  +NN+G       P+  HV LNHL+TSSI+   + V  
Sbjct: 341 PQLPPQLENVILNKYYATQDQFNENNSGAL-----PIPNHVVLNHLVTSSIKHNTLCVAS 395

Query: 864 TTRYEGKFITHVVYAP 879
             RY+ K++T ++Y P
Sbjct: 396 IVRYKQKYVTQILYTP 411

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (73%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLP 620
           F   L+LPPG ++ +F+++ ELR S++L TATD  GNFVN+ E+ P
Sbjct: 164 FHIKLQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEISP 209

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN   N      +  E  +   P+  HV LNHL TSSI+   + V    
Sbjct: 341 PQLPPHLENVILNNYSNSSDPGGSGSENNSGALPIPNHVVLNHLATSSIKHNTLCVASIV 400

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K+ T ++Y+P 
Sbjct: 401 RYKRKYATQILYSPL 415

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 561 KKIPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLP 620
           K I +    T   W    LKLPPG ++ +F+++ ELR S+ +P+ATDS GN VN+ EV P
Sbjct: 130 KMIALVEHPTNPDWARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEVKP 189

Query: 621 GYYEIE 626
              + E
Sbjct: 190 SKRQYE 195

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 8/77 (10%)

Query: 806 PDLPIYLNSSYLNKVFNQLQK--DNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGC 863
           P +P + +   LN   N LQ   D+NAG       P+  HV LNHL+ +S++  ++++  
Sbjct: 277 PQIPPHFDVVILNDQ-NSLQHTDDSNAGFL-----PIPNHVVLNHLIVNSVKSNMLAIST 330

Query: 864 TTRYEGKFITHVVYAPC 880
           TTRY+ KFIT V Y+P 
Sbjct: 331 TTRYKEKFITQVCYSPI 347

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 33/44 (75%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           F   L+L PG ++ +F+++ ELR S+FLPTATD  GNFVN+ EV
Sbjct: 202 FHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 10/72 (13%)

Query: 810 IYLNSSYLNK-VFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTTRYE 868
           + LN  Y+ +  FN+    NN+G       P+  HV LNHL+TSSI+   + V    RY+
Sbjct: 350 VILNKYYMTQDQFNE----NNSGAL-----PIPNHVVLNHLITSSIKHNTLCVASIVRYK 400

Query: 869 GKFITHVVYAPC 880
            K++T ++YAP 
Sbjct: 401 QKYVTQILYAPI 412

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 33/41 (80%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVL 619
           L+LP G ++ +F+++ ELR S++LPTATD  GNFVN+ EV+
Sbjct: 187 LQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 227

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L +  LN   N  Q D+N   + A+  P+  HV LNHL TSSI+   + V    
Sbjct: 332 PQLPPHLENVPLNSYTNS-QNDSNENNSGAL--PIPNHVVLNHLATSSIKHNTLCVASIV 388

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K++T ++YAP 
Sbjct: 389 RYKRKYVTQILYAPL 403

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 33/44 (75%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           F   L+L PG ++ +F+++ ELR S+FLPTATD  GNFVN+ EV
Sbjct: 201 FHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 244

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP  L +  LNK +   Q   N   + A+  P+  HV LNHL+TSSI+   + V    
Sbjct: 340 PQLPPQLENVILNK-YCTTQDQVNENNSGAL--PIPNHVVLNHLITSSIKHNTLCVSSIV 396

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K++T ++Y P 
Sbjct: 397 RYKQKYVTQILYTPI 411

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 33/44 (75%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           F   L+L PG ++ +F+++ ELR S+FLPTATD  GNFVN+ EV
Sbjct: 228 FHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 271

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 806 PDLPIYLNSSYLNKVFNQLQK--DNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGC 863
           P LP  L +  LNK +    +  +NN+G       P+  HV LNHL+TSSI+   + V  
Sbjct: 367 PQLPPQLENVILNKYYATQDQFNENNSGAL-----PIPNHVVLNHLVTSSIKHNTLCVAS 421

Query: 864 TTRYEGKFITHVVYAPC 880
             RY+ K++T ++Y P 
Sbjct: 422 IVRYKQKYVTQILYTPI 438

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 528 VVLKWRDCIVDP-KTCKISVISSDISAVL----ALQSSKKIPMEYETTEKSWFVPNLKLP 582
           V L++RD    P +   +++  +DI++ L     +   ++IP+++E     W  P+L LP
Sbjct: 72  VKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDSSEWVAPDLYLP 131

Query: 583 PGVYKLQFLINGEL-RHSNFLPTATDSFGNFVNWFEVLPGYYEIEP 627
           PG YK +F+IN     HS +LP  T   G   N+F V+     +EP
Sbjct: 132 PGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEP 177

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 14/88 (15%)

Query: 799 FLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSS---IR 855
           F ++Y VP +P Y  S  +    N L+           V   I   NLN  +  S   I 
Sbjct: 250 FCERYTVPIIPPYFYSIDITPQDNTLK-----------VPLPIQLANLNRTIFPSPEDIC 298

Query: 856 EEIISVGCTTRYEGKFITHVVYAPCYYE 883
            + + +GC   Y GK++ H+ Y P  +E
Sbjct: 299 NDYLCIGCVISYRGKYMAHLFYRPSPWE 326

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 3/56 (5%)

Query: 563 IPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           IP+E   +E   F   L+L PG ++ +F+++ +LR S+ LPTATD  GNFVN+ EV
Sbjct: 200 IPVE---SEPGHFKIKLQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV 252

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 7/76 (9%)

Query: 806 PDLPIYLNSSYLNKVFNQLQK--DNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGC 863
           P LP  L +  LNK    L +  +NNAG       P+  H  LNHL+T+SI+   + V  
Sbjct: 361 PQLPPQLENVILNKFGEPLSQSTENNAGAL-----PIPNHSVLNHLVTTSIKHNTLCVAT 415

Query: 864 TTRYEGKFITHVVYAP 879
             RY  K+++ + Y P
Sbjct: 416 NNRYRQKYVSQIYYVP 431

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           L+LP G ++ +F+++ ELR S++LPTATD  GNFVN+ EV
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 839 PVIPHVNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPC 880
           P+  HV LNHL+T+SI+   + V    RY+ K+ T ++Y P 
Sbjct: 540 PIPNHVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTPL 581

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%)

Query: 575 FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           F   L+LP G ++ +F+++ EL+ S+FLPTATD  GNFVN+ EV
Sbjct: 267 FHVKLQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 800 LQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEII 859
           LQ    P LP +L     N + N  Q  +N   + A+  P+  HV LNHL+T+SI+   +
Sbjct: 425 LQWLTPPQLPPHLE----NIILNSSQDTSNENTSGAL--PIPNHVVLNHLVTTSIKHNTL 478

Query: 860 SVGCTTRYEGKFITHVVYAPC 880
            V    RY+ K++T ++YAP 
Sbjct: 479 CVASIIRYKHKYVTQILYAPL 499

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 32/40 (80%)

Query: 579 LKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618
           L+LP G ++ +F+++ ELR S++LPTATD  GNFVN+ E+
Sbjct: 155 LQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 194

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 806 PDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIISVGCTT 865
           P LP +L    LN  +N +Q D+N  E  +   P+  HV LNHL TSSI+   + V    
Sbjct: 275 PTLPPHLEDVPLNS-YNGIQGDSN-NENNSGALPIPNHVVLNHLATSSIKHNTLCVASIV 332

Query: 866 RYEGKFITHVVYAPC 880
           RY+ K++T ++YAP 
Sbjct: 333 RYKRKYVTQILYAPL 347

>ZYRO0D13904g Chr4 complement(1174048..1174614) [567 bp, 188 aa]
           {ON} similar to uniprot|Q03705 Saccharomyces cerevisiae
           YML036W Hypothetical ORF
          Length = 188

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 41/62 (66%), Gaps = 4/62 (6%)

Query: 251 ALKRSLVEGRIGSKLHVQTSNGD---TTNASSSTAGSLKNYILDDNNRILLPSQLIDDDR 307
           A+ R+LVE + G KL  ++ + +   + +A+S+   + KN+ + D++++LL  Q++D D+
Sbjct: 74  AIYRALVESKYG-KLKTKSLHSECLYSLSATSNIGEAYKNFGIKDDSQMLLVIQIVDKDQ 132

Query: 308 QD 309
           QD
Sbjct: 133 QD 134

>KNAG0C02880 Chr3 (569230..571650) [2421 bp, 806 aa] {ON} Anc_4.100
           YGL021W
          Length = 806

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 54/104 (51%), Gaps = 11/104 (10%)

Query: 71  VVSTPSPLFKPN---YSMNESSNASIAGLGSNYTTSSQEDLNKLQAVDS-SR------KN 120
           V S  S L K N   +S   SSNASI   GSN  T  ++    +   +S SR      +N
Sbjct: 190 VTSENSELDKENQPLFSSTTSSNASIRTNGSNKGTKFKKSKPSITVTNSDSRQPLKPLRN 249

Query: 121 TLSSIESNSASSKPAPPLLNPTNVSADDSSQLRDHLAGLTIHSE 164
           TL+++E+ ++  +P+   +N TN S +  S L   +  L+IH++
Sbjct: 250 TLNTVETQNSFRRPSLSSMN-TNTSKNSMSMLNSSMDNLSIHTK 292

>Kwal_47.19191 s47 (1128688..1131060) [2373 bp, 790 aa] {ON} YFR040W
           (SAP155) - cell cycle protein, interacts with Sit4
           [contig 344] FULL
          Length = 790

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 813 NSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLT 851
           N+SYLNK+++ L++ N A E  A++ P+   +N N L T
Sbjct: 191 NASYLNKIWSILKQQNFASEKSALI-PIFLKINQNLLAT 228

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,324,624
Number of extensions: 4268620
Number of successful extensions: 15635
Number of sequences better than 10.0: 153
Number of HSP's gapped: 16275
Number of HSP's successfully gapped: 218
Length of query: 892
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 773
Effective length of database: 39,836,145
Effective search space: 30793340085
Effective search space used: 30793340085
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)