Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G04906g5.526ON60860827680.0
KLTH0G03740g5.526ON63159012671e-167
Kwal_47.186465.526ON63559711941e-156
KLLA0A01782g5.526ON5285286997e-84
ZYRO0D12540g5.526ON5485366684e-79
Skud_13.1485.526ON7793094641e-48
TDEL0A039005.526ON6712944573e-48
Smik_13.1455.526ON7743044595e-48
Suva_13.1565.526ON7723074552e-47
YML006C (GIS4)5.526ON7743034552e-47
KNAG0B037105.526ON7111294382e-45
NDAI0C010705.526ON7572314365e-45
NCAS0H025505.526ON7432894269e-44
CAGL0K07271g5.526ON7762144181e-42
TBLA0D016605.526ON8661404084e-41
KAFR0C053905.526ON4551453921e-40
Ecym_40615.526ON6633493442e-33
NCAS0F010805.526ON3793993307e-33
ADR198C5.526ON5491442901e-26
Kpol_1023.995.526ON5512072863e-26
TPHA0K005405.526ON6752192421e-20
NDAI0H015905.526ON371862051e-16
KNAG0C032405.526ON32455960.004
TBLA0G009405.526ON78270940.010
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G04906g
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...  1070   0.0  
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   492   e-167
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   464   e-156
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...   273   7e-84
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   261   4e-79
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   183   1e-48
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   180   3e-48
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   181   5e-48
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   179   2e-47
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   179   2e-47
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...   173   2e-45
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   172   5e-45
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   168   9e-44
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   165   1e-42
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...   161   4e-41
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...   155   1e-40
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...   137   2e-33
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...   131   7e-33
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...   116   1e-26
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...   114   3e-26
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    98   1e-20
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               84   1e-16
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      42   0.004
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    41   0.010

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score = 1070 bits (2768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/608 (86%), Positives = 528/608 (86%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFN 60
           MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFN
Sbjct: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFN 60

Query: 61  KKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNN 120
           KKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNN
Sbjct: 61  KKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNN 120

Query: 121 FHDRSFLGFGQKKHDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVEQCNGN 180
           FHDRSFLGFGQKKHDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVEQCNGN
Sbjct: 121 FHDRSFLGFGQKKHDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVEQCNGN 180

Query: 181 SPATPRDVTAVEPVKXXXXXXXXXXXXIVLNFPHKPPKNIINQREQEVVTTSEDVSINSE 240
           SPATPRDVTAVEPVK            IVLNFPHKPPKNIINQREQEVVTTSEDVSINSE
Sbjct: 181 SPATPRDVTAVEPVKSSEDEEDQESGEIVLNFPHKPPKNIINQREQEVVTTSEDVSINSE 240

Query: 241 DASSYDGEALIQTITRXXXXXXXXXXXXXXXXLSSVDHXXXXXXXXXXXXXXXXXMASIF 300
           DASSYDGEALIQTITR                LSSVDH                 MASIF
Sbjct: 241 DASSYDGEALIQTITRDEDASSADEDNSNISELSSVDHSLNSLSYNSDISSDDYSMASIF 300

Query: 301 PAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHN 360
           PAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHN
Sbjct: 301 PAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHN 360

Query: 361 LQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIASTSTLS 420
           LQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIASTSTLS
Sbjct: 361 LQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIASTSTLS 420

Query: 421 QNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQEVNGVMPLYAPT 480
           QNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQEVNGVMPLYAPT
Sbjct: 421 QNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQEVNGVMPLYAPT 480

Query: 481 RTNSNSTTAHRSILTVNSIGEWAFHHNEPYPQNNHSNISFADQNTSTAGKMKRVSSKGSS 540
           RTNSNSTTAHRSILTVNSIGEWAFHHNEPYPQNNHSNISFADQNTSTAGKMKRVSSKGSS
Sbjct: 481 RTNSNSTTAHRSILTVNSIGEWAFHHNEPYPQNNHSNISFADQNTSTAGKMKRVSSKGSS 540

Query: 541 KNTLQKTTTVGSLSAVERXXXXXXXXXXXXXXXXDDETMMWXXXXXXXXXXXXXXXXXXX 600
           KNTLQKTTTVGSLSAVER                DDETMMW                   
Sbjct: 541 KNTLQKTTTVGSLSAVERSKSTPLPTLLRTLSGLDDETMMWKRKVEKFKRKRRAKKEGKK 600

Query: 601 LDNNCVVM 608
           LDNNCVVM
Sbjct: 601 LDNNCVVM 608

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  492 bits (1267), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 284/590 (48%), Positives = 366/590 (62%), Gaps = 40/590 (6%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFN 60
           + S VKV DYF+ND NGLWSWYL NLR G+FEEL NN LKF LL+RFLNE L+ D V FN
Sbjct: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFN 61

Query: 61  KKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNN 120
           KK+LLVSIPD IH++  +LENFLR YF+LDDLQ+IQI+KLT  + YNHENHYLISD+L+N
Sbjct: 62  KKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLSN 121

Query: 121 FHDRSFLGFGQKKHDNVRP--------QLSYNGYSVLSGET----GYASLRTTEEQNGTH 168
           F+D+SFL FG K     RP        Q S N YS++SGET       +  ++E     H
Sbjct: 122 FNDKSFLEFGAKSR---RPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVH 178

Query: 169 RPSGVVEQCNGNSPATPRDVTAV--EPVKXXXXXXXXXXXXIVLNFPHK---------PP 217
               V E     +  +   +  V  +               +VL F H+         P 
Sbjct: 179 LSKVVQEDVPLRTHNSSSRLLIVDNQECASSTDESDDASTELVLKFEHRGMLGKQRLHPE 238

Query: 218 KNIINQREQEVVTTSEDVSINSEDASSYDGEALIQTITRXXXXXXXXXXXXXXXXLSSVD 277
              +   E+ + T S  VS+ S+D SSYDGE L QTITR                LSSVD
Sbjct: 239 VRKMASTEEAIDTPSTGVSLRSDDVSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVD 298

Query: 278 HXXXXXXXXXXXXXXXXXMASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSN 337
           H                 + SIFP+ISIS+ FG FRLVLQSIL+  PDTR++FTAVRQSN
Sbjct: 299 HSLKSLSYDSEYSQGSSSLTSIFPSISISEKFGRFRLVLQSILVHQPDTRQLFTAVRQSN 358

Query: 338 NDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAH 397
           NDP VAH+NDDWLLYD+KFSM+NLQ+L+LHDVLE+N+FFPKILFY++VM+ +EE+A +A 
Sbjct: 359 NDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMI-SEEVAADAQ 417

Query: 398 AYIPNDPHLPPPSQGIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYF 457
            Y P+ P   P  Q  AS ST+S+NTL++ PT T ++T T  N  L+  A ++  +  Y 
Sbjct: 418 DYYPSKPSKSP--QPTASNSTISENTLKVQPTLTHSLTNT--NSYLSTGAYNSSLSPFYS 473

Query: 458 P-EDNHDD-------EDDQEVNG-VMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFHHNE 508
             + NH+        +DD+   G V+PLY+ TRTNSN +TAHRSI T+ SIG+WAFHH+ 
Sbjct: 474 SVQHNHEQGEEDDYYDDDKNSEGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDS 533

Query: 509 PYPQNNHSNISFADQNTSTAGKMKRVSSKGSSKNTLQKTTTVGSLSAVER 558
              + + ++ +  D   S  G + +V SK S K+ L KT T+GSLS VER
Sbjct: 534 SSRKLSPNDSTLEDSYQSVEGNLMKVRSKSSVKSGLTKTLTLGSLSTVER 583

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  464 bits (1194), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 275/597 (46%), Positives = 354/597 (59%), Gaps = 58/597 (9%)

Query: 5   VKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKML 64
           VKV DYF ND NGLWSWYL NLR G+FEEL NN LK  LL+RFLNE LM + V FNKK+L
Sbjct: 6   VKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNKKLL 65

Query: 65  LVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNNFHDR 124
           LVSIPD IH++  +LENFLR YFHLDDLQYIQI+KLT  + YNHENHYLI DNL+NF+D+
Sbjct: 66  LVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLSNFNDK 125

Query: 125 SFLGFGQKK-----HDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTH---RPSGVVEQ 176
           SFL FG K+      + +  + S N YS++SGET     +++ E   +    R S V ++
Sbjct: 126 SFLEFGIKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDSKVTQE 185

Query: 177 CNGNSPATPRDVTAVEPVK-------XXXXXXXXXXXXIVLNFPHKPPKNIINQRE---- 225
                PA     T+   ++                   IVL F    P+  + +R+    
Sbjct: 186 ----DPALQTQSTSSRSLRIENSGSLNSSDESDDTESEIVLRFK---PRGTVGKRQLYSE 238

Query: 226 --------QEVVTTSEDVSINSEDASSYDGEALIQTITRXXXXXXXXXXXXXXXXLSSVD 277
                     + T S  +S+ SED SSYDGE L    +R                LSSVD
Sbjct: 239 VKRSPLANDYIDTPSTGMSLRSEDVSSYDGEELAHIASRDEDSASLSADEDNISELSSVD 298

Query: 278 HXXXXXXXXXXXXXXXXXMASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSN 337
           H                 M SIFP+ISIS+ FG FRLVLQSILIQ  DTR+++TAVRQSN
Sbjct: 299 HSLNSLSYDSECTPGSSSMTSIFPSISISEKFGRFRLVLQSILIQQTDTRQLYTAVRQSN 358

Query: 338 NDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAH 397
           NDP VAH+NDDWLLYD+KFSM+NLQ+L+LHDVLEIN+FFPK+LFY+++++ T+E+A +A 
Sbjct: 359 NDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVV-TDEVAIDAQ 417

Query: 398 AYIPNDPHLPPPSQGIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATS-------- 449
            Y P+  H  P  +   STS LS+NTL+L  T T ++T T  N  L+    S        
Sbjct: 418 EYYPSASHQSP--ERTVSTSLLSENTLKLQTTLTPSLTNT--NSFLSMGVNSSSLTPFYA 473

Query: 450 --------AQDAENYFPEDNHDDEDDQEVNGVMPLYAPTRTNSNSTTAHRSILTVNSIGE 501
                   A D ++YF ++     DD E   V  LY+ TRTNSN +TAHRSI T+ SIG+
Sbjct: 474 TAQGSPDRANDEDDYFDDERDGKTDDGE---VFQLYSATRTNSNKSTAHRSIRTIKSIGD 530

Query: 502 WAFHHNEPYPQNNHSNISFADQNTSTAGKMKRVSSKGSSKNTLQKTTTVGSLSAVER 558
           WAFHH+    + + +     D      G + ++ SK S K+ L KT T+GSLS VER
Sbjct: 531 WAFHHDSTSRRTSSAASFLEDPRLDDEGNLMKIKSKSSVKSGLTKTFTLGSLSTVER 587

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score =  273 bits (699), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 201/528 (38%), Positives = 261/528 (49%), Gaps = 94/528 (17%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFN 60
           MP+ V+VKDY+ENDYNGLWSWYLSNLR+G FEELT N LK  LLKRFL +   Q     N
Sbjct: 1   MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQF-QATGPLN 59

Query: 61  KKMLLVSIPDNIHQDITILENFLRSYFHL-DDLQYIQIKKLTDSQIYNHENHYLISDNLN 119
           KK+LLVSIPD IHQDI +LE FL  YFHL DD   I I KLT   +Y HENHYLI D L 
Sbjct: 60  KKLLLVSIPDEIHQDIKVLEEFLSEYFHLKDDHTNIVIDKLTRGTVYKHENHYLIQDKLT 119

Query: 120 NFHDRSFLGFGQKKHDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVEQCNG 179
           NF+D  FL         ++  +S +G                   N +   +   E C  
Sbjct: 120 NFNDEWFL--------EMKKDVSISG-------------------NSSKDATDSAENCGQ 152

Query: 180 NSPATPRDVTAVEPVKXXXXXX---XXXXXXIVLNFPH-----KPPKNIINQREQEVVTT 231
                     +                    IVLNF H     KP    I +  Q +V  
Sbjct: 153 EMEDDSPRRDSDSSDSYSILTGDTFDTESHSIVLNFKHPEVMVKP----ITKTTQRIVRI 208

Query: 232 SEDVSINS------------EDASSYDGEALIQTITRX-XXXXXXXXXXXXXXXLSSVDH 278
           S   +I S            +D  SY GEAL+QT+TR                 + S D 
Sbjct: 209 SPGNNIGSPAESQVSIVTHGDDLESYRGEALVQTVTRAIDEDEEDEDDDDHHHDVESADD 268

Query: 279 XXXXXXXXXXXXXXXXXMASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNN 338
                              SI P+ISISD FGTFRLVLQSILI N +T +IFT +RQS N
Sbjct: 269 MKSKD-------------ISIPPSISISDNFGTFRLVLQSILITNKETEQIFTGIRQSEN 315

Query: 339 DPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHA 398
           D + A INDDWLLYD  F++ NLQMLSL+D+L+ ++F PKILFY+M+ +  + + D    
Sbjct: 316 DRSNADINDDWLLYDTDFNLGNLQMLSLYDILDFSKFLPKILFYSMIHV-KDSVDDNTEL 374

Query: 399 YIPNDPHLPPPSQGIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFP 458
            +                    Q+ + +  T T+   Y+ H    + +  S+ ++   + 
Sbjct: 375 SL--------------------QHLITVNNTLTNGNMYSPHEVDDSMSELSSDNSIECYT 414

Query: 459 EDNHDDEDDQEVNGVMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFHH 506
            +++D   D+ V G   LY+P    + +T  HRSI TV SIG WA + 
Sbjct: 415 GNSNDSIADEPVIG---LYSPA---TAATAGHRSIRTVESIGAWALNR 456

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  261 bits (668), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 189/536 (35%), Positives = 259/536 (48%), Gaps = 106/536 (19%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDI-VQF 59
           M   V+V DYF ND NGLWSWYL+N+R+G FEELT N LK +L KRFL  +L   +  + 
Sbjct: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK 60

Query: 60  NKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLN 119
           + K+L+VSIP+++ +DIT+LE FL  Y +LD++   +I KLT S+IYNHENHY++ D  N
Sbjct: 61  DTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNM---EITKLTTSRIYNHENHYVVMDKEN 117

Query: 120 NFHDRSFLGFGQKKHDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVEQCNG 179
           NF + +FL F      N++    + G     GE    ++    E+N +   S       G
Sbjct: 118 NFKNSNFLHFAST---NIQTGKGFTG-----GELAGTTVAAQAEKNISPTESAKFRAGQG 169

Query: 180 NSPATPRDVTAVEPVKXXXXXXXXXXXXIVLNFPHKP-----PKNIINQREQEVVTTS-- 232
             P+   D    E               +V NF H+      P     + ++E V  S  
Sbjct: 170 LEPSD--DTEGDE-------------ESLVFNFTHRDHHLTHPLRANGKEQEEAVGVSPS 214

Query: 233 ----------EDVSINSEDAS---------------SYDGEALIQTITRXXXXXXXXXXX 267
                     E  + N E AS               S+ GE L  T+TR           
Sbjct: 215 WNPQQQQRLQEHNASNDEMASIDSYNLGSNSSRVVESFKGEPLTLTMTRTEDFSSSDEYD 274

Query: 268 XXXXXLSSVDHXXXXXXXXXXXXXXXXXMASIFPAISISDTFGTFRLVLQSILIQNPDTR 327
                 SS D                  + SI P+ISI+D+FG FRLVLQS+L  NP + 
Sbjct: 275 SLASSPSSSD--------TDLSSFESCSLMSILPSISIADSFGHFRLVLQSVLFINPTSN 326

Query: 328 EIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVML 387
           EIFTA+RQSNN P  A ++DDWLLYD +FSMHNLQML+L D+ E+N+  PK+LFY++V  
Sbjct: 327 EIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLSELNKGCPKVLFYSLV-- 384

Query: 388 DTEEIADEAHAYIPNDPHLPPPSQGIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAA 447
              E+ D         P L       A+ S  +  +L   PT+TS     R         
Sbjct: 385 ---EVVDT--------PSLEDADTECATISNTASTSLSSAPTSTSVSCEPRV-------- 425

Query: 448 TSAQDAENYFPEDNHDDEDDQEVNGVMPLYAPTRTNSNSTT-AHRSILTVNSIGEW 502
                   +FP +         VNG        + N+NS+T  HRSI+T NS  +W
Sbjct: 426 --------FFPSN---------VNGDNSGCRLAKGNTNSSTLGHRSIVTTNSAADW 464

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  183 bits (464), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 160/309 (51%), Gaps = 76/309 (24%)

Query: 298 SIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFS 357
           SI P+ISI D+ G FRLVLQSILIQ+PDT+EIFTA+RQSNN P +A + DDWLLYD  FS
Sbjct: 442 SILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFS 501

Query: 358 MHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIASTS 417
           M+NLQ+L+L D+L+I R FPKILFYTMV+     + D  H  I  + H     +G   TS
Sbjct: 502 MNNLQILTLQDLLDIKRSFPKILFYTMVI-----VTDSGHQQIE-EEHKSSSHRGTVDTS 555

Query: 418 TLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFP-------------EDNHDD 464
                                  E LN+  + + D + YFP             ED  DD
Sbjct: 556 K---------------------EEPLNSELSLSHDPQQYFPTAYNIDYDEYTDDEDEGDD 594

Query: 465 EDDQEVNGVMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFH-HN---------------- 507
               E +G   +Y PTR  SN TTAHRSI TVNSIGEWAF+ HN                
Sbjct: 595 ASLSEQSGPQ-MYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNS 653

Query: 508 ----------EPYPQNNHSNISFADQNTSTAGKMKRVSSKGS-------SKNTLQK-TTT 549
                     EPYP    SN S    N +   K K     GS       SKN L+K  T+
Sbjct: 654 KEGVNRNSLGEPYPMAQLSNSSTTTSNFNHLLKKKNSYKLGSRDKNGSNSKNELKKIKTS 713

Query: 550 VGSLSAVER 558
           + ++SAVER
Sbjct: 714 INAMSAVER 722

 Score =  178 bits (451), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 85/133 (63%), Positives = 102/133 (76%), Gaps = 3/133 (2%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDI---V 57
           M   V+V DYF+ND NGLWSWYL+NLR G FEEL  N LK+TLLKRFLN H   D     
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60

Query: 58  QFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDN 117
           + NKK+LLVSIP+N+H+DI+ILE FL+ YFHL+ L++IQI KLT S  YNHENHYL++DN
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 118 LNNFHDRSFLGFG 130
           LNNF D +FL F 
Sbjct: 121 LNNFQDPTFLEFA 133

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  180 bits (457), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 163/294 (55%), Gaps = 42/294 (14%)

Query: 299 IFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSM 358
           I P+ISISD  G +RLV+QS L+Q+P+T+EI+TA+RQSNN P VA ++DDWLLYD +FSM
Sbjct: 386 ILPSISISDARGHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSM 445

Query: 359 HNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIASTST 418
           +NLQML+L ++L++NR FPKI+FY+M++     ++DE    +     +        ++S+
Sbjct: 446 NNLQMLTLQELLDMNRSFPKIIFYSMIV-----VSDEQQELLQWSNGMTQKEDTADASSS 500

Query: 419 LSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQEVNGVMPLYA 478
                   +P A S  + +R             D + ++   + DD    E +G M +YA
Sbjct: 501 --------IPRADSYASMSR-------------DPQQFYANMDDDDTSLSEQSGPM-MYA 538

Query: 479 PTRTNSNSTTAHRSILTVNSIGEWAF-HHNEPYPQNNH---------SNISFADQNTSTA 528
           PTR  SN++TAHRSI TVNSIG+WAF H NE   Q +H         S + F   N +  
Sbjct: 539 PTRLQSNTSTAHRSIRTVNSIGDWAFVHKNETKRQGSHRGSTSQAGVSGVQFDSDNQNLQ 598

Query: 529 G-KMKRVSSKGSSKNTLQKTTTVGSLSAVERXXXXXXXXXXXXXXXXDDETMMW 581
               +RV     S+N L K +T+ SL+ VER                D E+  W
Sbjct: 599 FLHPERV----HSRNGLSKVSTMASLNPVERSKSTPLPVILISFSNLDGESKHW 648

 Score =  167 bits (422), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQF- 59
           M   +KV DYF+ND NGLWSWYLS++R G FEE + N LK TLL+RFLN H   +   + 
Sbjct: 1   MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRSHYG 60

Query: 60  -NKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNL 118
            N K+L VSIPD +H+D+++LENFLR YFHL+ L++I+I KLT S +YNHENHY++ D L
Sbjct: 61  QNTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPVYNHENHYILIDKL 120

Query: 119 NNFHDRSFLGFGQKK 133
           NNF D +FL F   +
Sbjct: 121 NNFDDPTFLQFASTR 135

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  181 bits (459), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 122/304 (40%), Positives = 162/304 (53%), Gaps = 67/304 (22%)

Query: 298 SIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFS 357
           SI P+ISI D+ G FRLVLQSILIQ+PDT+EIFTA+RQSNN P +A + DDWLLYD  FS
Sbjct: 438 SILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFS 497

Query: 358 MHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPP--------P 409
           M+NLQ+L+L D+L+I R FPKILFYTMV      I  E+   I  +P  P          
Sbjct: 498 MNNLQILTLQDLLDIKRSFPKILFYTMV------IVTESGQQIEEEPKNPNYGTREDMLK 551

Query: 410 SQGIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQE 469
            Q + S   LS +  +  P A +N      ++  +    S   +E   P+          
Sbjct: 552 EQPLNSDLLLSHDPKQYFPNAYNNDYDEYIDDEDDDDDASL--SEQSGPQ---------- 599

Query: 470 VNGVMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFH-HN--------------------- 507
                 +Y PTR  SN TTAHRSI TVNSIGEWAF+ HN                     
Sbjct: 600 ------MYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSNSNESDDSENNDD 653

Query: 508 -----EPYPQNNHSNISFADQNTSTAGKMK-------RVSSKGSSKNTLQK-TTTVGSLS 554
                EPYP    SN + +  N S + K K       +++++ +SK+ L+K   ++ ++S
Sbjct: 654 RLSSDEPYPMTQISNFNTSSSNFSHSLKKKNTSKVNSKINNESNSKSELKKIKNSINAMS 713

Query: 555 AVER 558
           AVER
Sbjct: 714 AVER 717

 Score =  181 bits (458), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 86/133 (64%), Positives = 103/133 (77%), Gaps = 3/133 (2%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQD---IV 57
           M   V+V DYF+ND NGLWSWYL+NLR G FEEL  N LK+TLLKRFLN H   D    V
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60

Query: 58  QFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDN 117
           + NKK+LLVSIP+N+H+DI+ILE FL+ YFHL+ L++IQI KLT S  YNHENHYL++DN
Sbjct: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 118 LNNFHDRSFLGFG 130
           LNNF D +FL F 
Sbjct: 121 LNNFQDPTFLEFA 133

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  179 bits (455), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 164/307 (53%), Gaps = 67/307 (21%)

Query: 296 MASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEK 355
           + SI P+ISI D+ G FRLVLQSILIQNPDT+EIFTA+RQSNN+P VA + DDWLLYD  
Sbjct: 432 ILSILPSISICDSLGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSN 491

Query: 356 FSMHNLQMLSLHDVLEINRFFPKILFYTMVML---DTEEIADE------AHAYIPNDPHL 406
           FSM+NLQ+L+L D+L+I R FPKIL YTMV++     ++I +E       H  +      
Sbjct: 492 FSMNNLQILTLQDLLDIKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHREVDLTEEK 551

Query: 407 PPPSQGIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDED 466
           PP S+      +LS +  R  P+   +      ++       S   +E   P+       
Sbjct: 552 PPNSE-----LSLSNDPQRYFPSTFDDDYDEYIDDDDGGDDASL--SEQSGPQ------- 597

Query: 467 DQEVNGVMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFH-HN------------------ 507
                    +Y PTR  SN TTAHRSI TVNSIGEWAF+ HN                  
Sbjct: 598 ---------MYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKE 648

Query: 508 --------EPYPQNNHSNISFADQNTSTAGKMK---RVSSKG----SSKNTLQK-TTTVG 551
                   EPYP    SN +    N S   K K   + +SKG    +SKN L+K  T++ 
Sbjct: 649 CGDRISPVEPYPMTQLSNSNTVTSNFSHLLKNKNSYKRTSKGNNESNSKNELKKIKTSIN 708

Query: 552 SLSAVER 558
           ++SAVER
Sbjct: 709 AMSAVER 715

 Score =  177 bits (449), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/133 (63%), Positives = 102/133 (76%), Gaps = 3/133 (2%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQD---IV 57
           M   V+V DYF+ND NGLWSWYL+NLR G FEEL  N LK+TLLKRFLN H   D    +
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60

Query: 58  QFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDN 117
           + NKK+LLVSIP+N+H+DI+ILE FL+ YFHL+ L++IQI KLT S  YNHENHYL++D 
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120

Query: 118 LNNFHDRSFLGFG 130
           LNNF D SFL F 
Sbjct: 121 LNNFQDPSFLEFA 133

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  179 bits (455), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 165/303 (54%), Gaps = 62/303 (20%)

Query: 298 SIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFS 357
           SI P+ISI D+ G FRLVLQSILIQ+PDT+EIFTA+RQSNN P +A + DDWLLYD  FS
Sbjct: 435 SILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFS 494

Query: 358 MHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPS--QGIAS 415
           M+NLQ+L+L D+L+I R FPKILFYTMV++       E     PN  +    S  Q + S
Sbjct: 495 MNNLQILTLQDLLDIKRSFPKILFYTMVIVTNSGKQVEEEFKNPNYDNREGISKEQPLDS 554

Query: 416 TSTLSQNTLRLLPTATSN-----VTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQEV 470
             +L+ +  +  PTA +N     +      +  + A+ S Q      P+           
Sbjct: 555 ELSLTNDPQQYFPTAYNNGYNDYIDDEDDEDDGDDASLSEQSG----PQ----------- 599

Query: 471 NGVMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFH-HN---------------------- 507
                +Y PTR  SN TTAHRSI TVNSIGEWAF+ HN                      
Sbjct: 600 -----MYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGEST 654

Query: 508 ----EPYPQNNHSNISFADQNTSTAGKMK---RVSSKG----SSKNTLQK-TTTVGSLSA 555
               EP+P    SN +    N S + K K   + +SKG    +SKN L+K  +++ ++SA
Sbjct: 655 VLSSEPHPMTQLSNSNTTSSNFSHSLKTKNSHKPNSKGNNESNSKNELKKIKSSINAMSA 714

Query: 556 VER 558
           VER
Sbjct: 715 VER 717

 Score =  178 bits (452), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 85/133 (63%), Positives = 102/133 (76%), Gaps = 3/133 (2%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQD---IV 57
           M   V+V DYF+ND NGLWSWYL+NLR G FEEL  N LK+TLLKRFLN H   D     
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISA 60

Query: 58  QFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDN 117
           + NKK+LLVSIP+N+H+DI+ILE FL+ YFHL+ L++IQI KLT S  YNHENHYL++DN
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 118 LNNFHDRSFLGFG 130
           LNNF D +FL F 
Sbjct: 121 LNNFQDPTFLEFA 133

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score =  173 bits (438), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 98/129 (75%), Gaps = 1/129 (0%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFN 60
           M   ++V DY++ND NGLWSWYL N+R G FEELT+N LK+TLLKRFL  H    +   N
Sbjct: 1   MQKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHFTS-LEGIN 59

Query: 61  KKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNN 120
            K+L +SIPD +H DI++LE FL+ YFHL+DLQ I+I+KLT S  YNHENHYL++D LNN
Sbjct: 60  SKILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNCYNHENHYLLTDTLNN 119

Query: 121 FHDRSFLGF 129
           F+DR FL +
Sbjct: 120 FNDRKFLRY 128

 Score =  138 bits (347), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/230 (36%), Positives = 117/230 (50%), Gaps = 48/230 (20%)

Query: 298 SIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFS 357
           SI P+I+I DT G FRLVLQS+L+Q  D + IFTA+RQSNN  + A + DDW+LYD  FS
Sbjct: 460 SILPSITIKDTEGHFRLVLQSVLLQRED-KAIFTAIRQSNNKVDRATVQDDWILYDSDFS 518

Query: 358 MHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIASTS 417
           M+NL M++L  +   +    KILFY+M+++D  E AD                       
Sbjct: 519 MNNLMMMTLRGLFNFSENMSKILFYSMIIVDDAETAD----------------------- 555

Query: 418 TLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQEVNGVMPLY 477
                                  ++L+  AT + D  +  P+   D+ED         +Y
Sbjct: 556 -----------------------DMLDEEATHSGDVSDTQPQLMFDEEDSDSGVQEPQMY 592

Query: 478 APTRTNSNSTTAHRSILTVNSIGEWAFHHNEPYPQNNHSNISFADQNTST 527
            P +T S++TTAHRSI TVNSIGEWA+   +    +NH   S   Q  ST
Sbjct: 593 LPQKTASHATTAHRSIRTVNSIGEWAY-KKKSNATSNHDAASVGSQGNST 641

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  172 bits (436), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 137/231 (59%), Gaps = 31/231 (13%)

Query: 298 SIFPAISISD-TFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKF 356
           SI P+ISISD   G FRLVLQS LIQNP T+EIFTA+RQSNN+P +AHI DDWLLYD KF
Sbjct: 460 SILPSISISDRNEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKF 519

Query: 357 SMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEE--IADEAHAY----IPNDPHLPPPS 410
           +M NLQ+L+L D+L+ NR FPKILFY+MV+++     I D+ H Y      N  +L    
Sbjct: 520 AMDNLQILTLQDLLDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYLSNKL 579

Query: 411 QGIASTST---LSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDD 467
           + +  TS+    S N  +  PT        ++ E++      A   E +FP    DDE+ 
Sbjct: 580 ESLEKTSSEEGKSINRYKYYPTLPKAGITAKNGEMI------ADVPEQFFPGPPSDDENG 633

Query: 468 Q--------------EVNGVMPLYAPTRTNSNSTTAHRSILTVNSIGEWAF 504
           +              E +G   +Y PTR  +N TTAHRSI T NSIGEWAF
Sbjct: 634 KGEDYDDDYDDESLMEQHGP-EMYLPTRMQTNVTTAHRSIRTANSIGEWAF 683

 Score =  165 bits (417), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 105/168 (62%), Gaps = 20/168 (11%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHL-------- 52
           M + V+V+DY+ ND NGLWSWYL N+R G FEELT N LK+TLLKRFLN H         
Sbjct: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTD 60

Query: 53  -----------MQDIVQFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLT 101
                      + DI    KK+LLVSIPD +H DI++LE FLR YFHL+DL+ IQI KLT
Sbjct: 61  TAIDDNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120

Query: 102 DSQIYNHENHYLISDNLNNFHDRSFLGFGQKKHDNVRPQLSYNGYSVL 149
            S+ YNHENHYL++D +NNF D  FL F        RP L  N    L
Sbjct: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQG-RPNLHLNNLDSL 167

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  168 bits (426), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 161/289 (55%), Gaps = 41/289 (14%)

Query: 298 SIFPAISISDTF-GTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKF 356
           SI P+ISISD   G FRLVLQSILIQ+P T+EI+TA+RQSNN+P +A I DDWLLYD +F
Sbjct: 421 SILPSISISDAIEGHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQF 480

Query: 357 SMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIAST 416
           SM NLQ+L+L D+L+ NR FPKILFY+MV+     + D  H  I      P  + G   T
Sbjct: 481 SMDNLQILTLQDLLDTNRSFPKILFYSMVI-----VTDAHHQPIQG----PTSTAGPDLT 531

Query: 417 STLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDA-ENYFPEDNHDDEDDQE------ 469
           ++   N L  +    +N  +   N     A    +D  + +FP+++  D+D+        
Sbjct: 532 TSYLSNKLESIAGDETNQRF--ENRYYPMADDQVEDQPQQFFPQEDDHDDDNMYDTDDSL 589

Query: 470 VNGVMP-LYAPTRTNSNSTTAHRSILTVNSIGEWAFHHN-------------------EP 509
           +    P +Y PTR  +N+TTAHRSI TVNSIGEWAF+ N                   E 
Sbjct: 590 MEEAGPEMYLPTRMETNNTTAHRSIRTVNSIGEWAFNRNNTNGSSSKSAIGREDEDGDEE 649

Query: 510 YPQNNHSNISFADQNTSTAGKMKRVSSKGSSKNTLQKTTTVGSLSAVER 558
              N+H++    D N     K  +  S G +KN  +++  + ++ AVER
Sbjct: 650 EETNHHNDGQTHDNNHHHNKKTGKKGSYGGAKN--KRSGNIEAMKAVER 696

 Score =  165 bits (418), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 118/303 (38%), Positives = 152/303 (50%), Gaps = 55/303 (18%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHL-------- 52
           M   V+V DYF+ND NGLWSWYL+N+R G FEE+T N LK+TLLKRFLN H         
Sbjct: 1   MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTA 60

Query: 53  -----------------MQDIVQFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYI 95
                             Q +    +K+LLVSIPD +H+D++ILE FLR YFHL+ L+ I
Sbjct: 61  TESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGI 120

Query: 96  QIKKLTDSQIYNHENHYLISDNLNNFHDRSFLGFGQKKHDNVRPQLSYNGYSVLSGETGY 155
           QI++LT S+ YNHENHYL++D +NNF D  FL F        R  L  N +     +   
Sbjct: 121 QIQRLTQSKCYNHENHYLLTDTINNFDDPVFLEFAGSNW-QARKNLHLNNHLDHRDDD-- 177

Query: 156 ASLRTTEEQNGTHRPSGVVEQCNGNSPATPRDVTAVEP---VKXXXXXXXXXXXXIVLNF 212
              R + +   TH  S + +  +      P D T V P    K            IVLNF
Sbjct: 178 ---RISPQSIDTH--SALNKNDDQILVTQPIDSTLVTPETREKENLDDIDVGGSSIVLNF 232

Query: 213 PH-------KPPKNIINQREQE---------VVTTSEDVSINS---EDASSYDGEALIQT 253
            H       K P N++ Q EQ              SE VSINS    D+ +Y+G  L  T
Sbjct: 233 SHTREHRKDKDPLNMVKQEEQSNKFSPNMMFTPPQSELVSINSFDDGDSMNYNGHPLKLT 292

Query: 254 ITR 256
           +TR
Sbjct: 293 LTR 295

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  165 bits (418), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 124/214 (57%), Gaps = 30/214 (14%)

Query: 296 MASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEK 355
           + SI P+ISI DT G FRLVLQSILIQ+P T+E+FTAVRQSNN P +A I DDWLLYD +
Sbjct: 451 LLSILPSISIFDTLGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAE 510

Query: 356 FSMHNLQMLSLHDVLEINRFFPKILFYTMVML-DTEEIADEAHAYIPNDPHLPPPSQGIA 414
           FSMHNLQ+L+L D++ I + +PKILFYTMV++ D  EIA E             P  G  
Sbjct: 511 FSMHNLQILTLQDIMTIKKDYPKILFYTMVVINDRSEIACEF------------PYNGAQ 558

Query: 415 STSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQEVNG-- 472
            T           P+  +N ++    E L+       + + YFP +    +D  + N   
Sbjct: 559 FTKA---------PSPITNKSHEVEKEELDQPT----EVQAYFPGNGQAIKDSIKPNNRD 605

Query: 473 --VMPLYAPTRTNSNSTTAHRSILTVNSIGEWAF 504
                L    RT SN TT HRSI TVNSIG+W+ 
Sbjct: 606 SLTFDLCQAERTKSNMTTTHRSIRTVNSIGDWSI 639

 Score =  162 bits (409), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/137 (56%), Positives = 99/137 (72%), Gaps = 6/137 (4%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDI---- 56
           M   V+V DY+ ND NG+WSWYLSNLR G FEE+  N LK+TLLKRFLN +L+ +     
Sbjct: 1   MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPES 60

Query: 57  -VQF-NKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLI 114
             +F NKK++ VSIP+++HQDI+ILE FLR YFHL  L   QI KLT  ++Y+HENHY +
Sbjct: 61  PTRFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKVYHHENHYFL 120

Query: 115 SDNLNNFHDRSFLGFGQ 131
            D LNNF D +FL FG+
Sbjct: 121 MDELNNFEDPTFLEFGK 137

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score =  161 bits (408), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/140 (57%), Positives = 100/140 (71%), Gaps = 9/140 (6%)

Query: 2   PSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNK 61
           P  V+V DY++ND NGLWSWYLSN+R+G FEELT N+LK TLLKRFL E+  QDI   ++
Sbjct: 6   PKPVQVNDYYDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQ 65

Query: 62  ------KMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLIS 115
                 K+L  SIPDNIHQD+ ILEN L+ YF LD+L  IQI KLT ++ YNHENHY++ 
Sbjct: 66  HSTNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILK 125

Query: 116 DNLNNFHDRSFL---GFGQK 132
           D L+NF + SF    G  QK
Sbjct: 126 DILDNFGNTSFFIHDGTKQK 145

 Score =  146 bits (368), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 136/239 (56%), Gaps = 31/239 (12%)

Query: 299 IFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSM 358
           I P+ISISD+ G FRLVLQ ILI +P   + +TA+RQS+++ +VA I DDWLLYD KFSM
Sbjct: 499 ILPSISISDSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSM 558

Query: 359 HNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIASTST 418
            NL++L+L ++L+ NR +PKILFYT+V +      ++  +YI  +       + I+  + 
Sbjct: 559 DNLEILTLQELLDFNRDYPKILFYTLVAI------NDNSSYIRTN-------KNISEINE 605

Query: 419 LSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDED-----------D 467
           L+ N   L    + +    + N+ +N    + +   N+   D+   ED           D
Sbjct: 606 LTNNLKNLNCKPSGDDRNKKDNQKINTEFNTTRIHSNHLI-DHSSSEDIPRQLYTTLSSD 664

Query: 468 QEVNGV-----MPLYAPTRTNSNSTT-AHRSILTVNSIGEWAFHHNEPYPQNNHSNISF 520
           +E   +     + +Y P++  SN+TT AHRSI TVNSIGEWAFH  +     +  NIS 
Sbjct: 665 EEYGEIEYPEGLEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHRTDTRGTKDTKNISI 723

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score =  155 bits (392), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/145 (56%), Positives = 102/145 (70%), Gaps = 9/145 (6%)

Query: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFN 60
           MP+ V++ DYF+ND NGLWSWYL+NLR G+FEEL NN LK +LLKRFL   +  DI    
Sbjct: 1   MPNSVQIHDYFDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQV--DINDQI 58

Query: 61  KKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNN 120
           KK+LL+SIPD+I  DI +LE FL  YFHL+DL  I+I KLT   +YNHENHYL+ D++NN
Sbjct: 59  KKILLISIPDHIFSDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLLIDSVNN 118

Query: 121 FHDRSFLGFGQKKHDNVRPQLSYNG 145
           F D +FL +       V PQ S N 
Sbjct: 119 FKDETFLNY-------VNPQPSTNA 136

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 2/91 (2%)

Query: 297 ASIFPAISIS-DTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEK 355
            SI P +SI+ +  G +RLVLQS+LI N +  ++ T VRQSNN  N A+INDDW+LYDEK
Sbjct: 250 CSILPCVSINNEAIGHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEK 309

Query: 356 FSMHNLQMLSLHDVLEI-NRFFPKILFYTMV 385
           FSM NL +LSL D+  I N    KILFY+M+
Sbjct: 310 FSMRNLNILSLKDLSIIGNVDSIKILFYSMI 340

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score =  137 bits (344), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 121/349 (34%), Positives = 159/349 (45%), Gaps = 33/349 (9%)

Query: 232 SEDVSI-NSEDASSYDGEALIQTITRXXXXXXXXXXXXXXXXLSSVDHXXXXXXXXXXXX 290
           SE+VSI +SE   SYDGE L +T+TR                   + +            
Sbjct: 262 SEEVSIRSSESYQSYDGEVLARTLTREEHIQGSCCPTEHRHE--ELYNEGDSTSELSSAC 319

Query: 291 XXXXXMASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWL 350
                  SIFP+ISIS   G FR+VLQSILI N    ++ TAVRQSNND  VA INDDWL
Sbjct: 320 NSVSSDCSIFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWL 379

Query: 351 LYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPS 410
           LYDE+FSM+N+QM+SL D+ E+N  FPKILFY++V +     A +              +
Sbjct: 380 LYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNNTASKEANSCAEIGKKNASN 439

Query: 411 QGIASTSTLSQNTL-RLLPTATSNVTYT--RHNELLNAAATSAQDAENYFPEDNHDDEDD 467
                 S +SQNTL +   TA S   +   RH          + + E + P     D   
Sbjct: 440 ISNWIYSCISQNTLSQQATTADSAFVFGGPRHYRW------HSSEREEHEPLAGDGDSVH 493

Query: 468 QEVNGVMPLYA---------------PTRTNSNSTTAHRSILT---VNSIGEWAFHHNEP 509
           +E N   PL +               P  + + S T   S  T   VNS  E   H  E 
Sbjct: 494 REGNRASPLTSGAEIVTNNIPMLSTLPVHSKAFSRTGSVSEPTKTRVNSNRE--IHKCES 551

Query: 510 YPQNNHSNISFADQNTSTAGKMKRVSSKGSSKNTLQKTTTVGSLSAVER 558
           +     S    +D N     + K + SK  SKN L K +++GSLS   R
Sbjct: 552 HSSITESRRKLSDDNEDMF-RSKYIISKNPSKNGLTKISSLGSLSLAHR 599

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 72/106 (67%), Gaps = 3/106 (2%)

Query: 13  NDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKMLLVSIPDNI 72
           +D NGLWSWYL NLR G FEEL+++++K  L+KR + E+    +   N ++LLVS+PD+I
Sbjct: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASN-RVLLVSVPDDI 68

Query: 73  HQDITILENFLRSYF-HLDDLQYIQIKKLTDSQ-IYNHENHYLISD 116
            Q  +ILE FLRS    + +++   I KLT  + + N E+HYLI+D
Sbjct: 69  RQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score =  131 bits (330), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 102/399 (25%), Positives = 171/399 (42%), Gaps = 52/399 (13%)

Query: 11  FENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKMLLVSIPD 70
           + +D + +WSWYLSNL+ G+FE L N  ++   L+ +              K +L+S+P 
Sbjct: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSG--NEGSKKILLSVPS 66

Query: 71  NIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNNFHDRSFLGFG 130
            + Q+++I   FL S F+ + LQYI + + + S     + HYL++D L+ F++ +F+   
Sbjct: 67  MLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI--- 123

Query: 131 QKKHDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVEQCNGNSPATPRDVTA 190
                     + +N              +T E +   +     + +   +    P++ T 
Sbjct: 124 --------ESMEFN--------------QTEENEQSVYIEGMEINKSISSICLWPQEETN 161

Query: 191 VEPV----KXXXXXXXXXXXXIVLNFP-----HKPPKNIINQREQEVVTTSEDVSINSED 241
           ++                   I+L FP     H    N ++ R      TSED+SI+SE 
Sbjct: 162 MDLFYASNSMDHTMENEEEGAIILAFPSLLNNHSKLHNYVSHR---TPATSEDISIDSEK 218

Query: 242 ASSYDGEALIQTITRXXXXXXXXXXXXXXXXLSSVDHXXXXXXXXXXXXXXXXXMA---- 297
               D      ++ R                  S+D                  +     
Sbjct: 219 YDDVDSYIHAMSLMRVNANCANQIQSPSEMMDESIDSLTESIISSDEIKEDDSKLTREEN 278

Query: 298 ---------SIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDD 348
                    S  P  + S   G  R VL S+LIQN  ++E FTA+RQ ++DPN A+I D+
Sbjct: 279 LRSASCNFHSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDE 338

Query: 349 WLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVML 387
           WLLYD KFS+ NL+M +L D+L  N+    +L Y  +++
Sbjct: 339 WLLYDSKFSLDNLEMGTLQDILLSNKGNSMLLLYKTILI 377

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 2/144 (1%)

Query: 298 SIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFS 357
           S+FP++SI++ F  FR+VLQSIL+ + +   I TAVRQ NN+PN+A+ +DD LLYD K S
Sbjct: 235 SVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKIS 294

Query: 358 MHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPP--SQGIAS 415
           +   ++LSL D++E+NR  PK+LFY++  +        A        H  P    +   S
Sbjct: 295 LITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLLQRNSFS 354

Query: 416 TSTLSQNTLRLLPTATSNVTYTRH 439
            STLS+++LRLLPT TS  T  RH
Sbjct: 355 ASTLSRHSLRLLPTVTSANTIERH 378

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 57/104 (54%), Gaps = 8/104 (7%)

Query: 14  DYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKMLLVSIPDNIH 73
           DY+GLWSWYL NLR G FE+L  +  +++ LK FL +       Q  +++ L+S P ++ 
Sbjct: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQ-ERRLQLLSFPASVP 62

Query: 74  QDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDN 117
            D  ILE F+R   ++     + I ++  +     E HYL+  N
Sbjct: 63  CDYKILEEFIRQQGNIS----VAIPRVHAT---GTEKHYLVDGN 99

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score =  114 bits (286), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 116/207 (56%), Gaps = 26/207 (12%)

Query: 298 SIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFS 357
           ++ P +++ D +  F+LVLQSILI N D+ E+ TA+RQSNN+ + A I+DDWLLYD KFS
Sbjct: 246 TVLPTVNLPDPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFS 305

Query: 358 MHNLQMLSLHDVLEINRFFPKILFYTMVMLD--TEEIADEAHAYIPNDPHLPPPSQGIAS 415
           M NLQ+LSL+++L IN+ +PKILFY++V +   T  I++  ++   ++PHL         
Sbjct: 306 MTNLQILSLNELLHINKDYPKILFYSLVSIPNVTVNISNYENS---SNPHLEDYINHSDD 362

Query: 416 TSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQD------AENYFPEDNHDDEDDQE 469
           + ++     +  P   ++     +    N    S+ D       + ++P+D         
Sbjct: 363 SLSIHDTPQQFYPMIVNDNNNNININNHNNTRRSSVDYYDDSIPQQFYPDD--------- 413

Query: 470 VNGVMPLYAPTRTNSNSTTAHRSILTV 496
                 +  PT+ N+N+T AHRS  T+
Sbjct: 414 ------MNIPTKVNTNTTIAHRSYRTI 434

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 18 LWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKMLLVSI 68
          +W+WYL ++R+G FEE+  N   + LLK  L + +  +I + NK   L+SI
Sbjct: 15 VWTWYLCHVRNGSFEEILGNEDYYKLLKNNLVDDVF-NIDKGNKIFKLISI 64

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 117/219 (53%), Gaps = 17/219 (7%)

Query: 296 MASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEK 355
           + S+ P+I + +++G F+LVLQS+++ N ++ E FTAVRQSN+  + A  +D+WLLYD K
Sbjct: 323 LLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSK 382

Query: 356 FSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTE---EIADEAHAYIPND-PHLPPPSQ 411
           FSM NL++++L+ +++I   F KI FY+MV+++ E    I      +I N+  +    S 
Sbjct: 383 FSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQAITFATDKHINNNLINSDGSSA 442

Query: 412 GIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAEN-------YFPEDNHDD 464
            ++  S +S      L      V  +  N LL     S  +  N         P  N DD
Sbjct: 443 NLSLDSNISPLASNFLSVNDKEVAVSVRNPLLPYIPNSDDNQHNNNNKTTFEKPSSNRDD 502

Query: 465 EDDQEVNGVM-----PLYAPTRTNSNSTTAHRSILTVNS 498
           E D + + V+      +++P    SN  TA RS+ T NS
Sbjct: 503 E-DSDCDSVLEYPIPEIFSPDTIASNKATALRSVTTNNS 540

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 64/124 (51%), Gaps = 16/124 (12%)

Query: 12  ENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLM----------QDIVQFNK 61
           ++ Y+ LW+WYL+ +R+G FEEL     K+  +   + E L           +D    + 
Sbjct: 9   DDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDG 68

Query: 62  KMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQI------YNHENHYLIS 115
            +L +S+   + +D  I+++FL   F   DL  I I+++ ++ I       +HE +Y++ 
Sbjct: 69  NILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVI 128

Query: 116 DNLN 119
           D+LN
Sbjct: 129 DSLN 132

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 59/86 (68%)

Query: 299 IFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSM 358
           + P+IS    +G  R VLQSI+ ++  T E+ TA+RQS+ D  VA  +D+WLLYD  FS+
Sbjct: 282 VVPSISCHHPYGQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSL 341

Query: 359 HNLQMLSLHDVLEINRFFPKILFYTM 384
           +NL++ +L D+L  N   P+ILFYTM
Sbjct: 342 NNLEISTLQDILYPNYENPRILFYTM 367

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 64/116 (55%)

Query: 8   KDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKMLLVS 67
           +D  + D N + SWYL NLR+G FE +  +  K   L   L+  L  +        +LVS
Sbjct: 3   EDNIKKDDNEVLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLFDNKQYGATNKILVS 62

Query: 68  IPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNNFHD 123
              +I + ++I + FL   F  + LQYI++++L   +  N E HY ++D+LN+F+D
Sbjct: 63  TLTSIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFLTDHLNSFND 118

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 16 NGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHL-MQDIVQFNKKMLLVSIP 69
          N  W WY+ NL  G+FEEL +N++K   L  FL  +   +   +  +++LLV+ P
Sbjct: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSP 72

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 8/53 (15%)

Query: 318 SILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVL 370
           S+L ++  + +++ AVRQ  +D        DW++YD  FS++NL+   L D+L
Sbjct: 263 SLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDIL 307

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 314 LVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEIN 373
           ++L+ I   N D    FTA+++ N       +   WL++D  F     Q++S   +LEI 
Sbjct: 570 IILKKIGNTNGD---FFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIA 620

Query: 374 RFFPKILFYT 383
           + F KI FY+
Sbjct: 621 KSFSKIFFYS 630

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,938,305
Number of extensions: 2827239
Number of successful extensions: 14669
Number of sequences better than 10.0: 118
Number of HSP's gapped: 15228
Number of HSP's successfully gapped: 145
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)