Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G04884g5.525ON93093049590.0
KLLA0A01804g5.525ON94580324690.0
KLTH0G03718g5.525ON85792223000.0
KAFR0E033105.525ON93896822980.0
NCAS0F010705.525ON90492322810.0
ZYRO0D12518g5.525ON88191122540.0
TDEL0A038905.525ON83191922110.0
NDAI0H015805.525ON90993521830.0
Suva_2.5985.525ON96598321690.0
Skud_4.6955.525ON95497021630.0
YDR421W (ARO80)5.525ON95095921450.0
Smik_4.6965.525ON94995221170.0
Kpol_1028.825.525ON92594121050.0
ADR199C5.525ON94495519620.0
TPHA0L003505.525ON85992418540.0
KNAG0C032505.525ON93696317730.0
TBLA0D016705.525ON101881616480.0
CAGL0F03025g5.525ON92896115890.0
KLLA0E02663gna 1ON1109611192e-05
SAKL0D00264g8.879ON848501183e-05
Kpol_1039.112.231ON992701183e-05
NCAS0A035804.113ON11131121112e-04
KLTH0F18392g7.512ON8733351102e-04
SAKL0E08998g2.231ON823521103e-04
NCAS0C002208.879ON839471093e-04
TBLA0E034803.109ON1046521093e-04
KAFR0A03060singletonON860981084e-04
NDAI0C002602.654ON1041561076e-04
Suva_9.592.231ON926941067e-04
TDEL0C044802.231ON852721067e-04
CAGL0H06875g8.879ON702391058e-04
ZYRO0E00572g2.654ON838701058e-04
KLLA0C14212gna 2ON10401991050.001
KNAG0J002108.879ON861431050.001
KNAG0G021308.283ON632821040.001
Suva_2.3818.423ON9181601040.001
KLTH0E16500g8.879ON833701040.001
KAFR0J017102.231ON8481051030.001
TBLA0A007302.654ON1037671030.002
KNAG0D052407.512ON8693351030.002
KNAG0E041004.344ON903951030.002
NDAI0K001508.879ON953431030.002
NDAI0G041403.109ON1001551030.002
Kwal_27.96888.879ON841391020.002
KLTH0D16852g4.344ON811441020.002
Kpol_1071.107.56ON6981711010.002
KLTH0D00594gna 3ON6311001010.002
Ecym_53972.231ON826611010.003
TPHA0B004104.344ON945671000.003
YIL130W (ASG1)2.231ON964831000.004
TBLA0E047504.344ON12831021000.004
KNAG0A025508.423ON73047990.004
NDAI0B038502.231ON93065990.005
NCAS0C047803.109ON91477980.006
YGL013C (PDR1)4.113ON106863980.006
Kwal_23.47542.231ON81250980.007
Kwal_55.218847.512ON882336980.007
Smik_9.392.231ON101272980.007
KLTH0G09108g2.231ON78250970.007
KAFR0C013203.109ON100644970.007
TDEL0B004808.879ON83550970.007
TPHA0N004407.56ON757161970.007
NDAI0I021906.61ON73571970.008
AAL175W8.879ON88339970.008
Smik_4.4608.423ON91849970.009
SAKL0G02992gna 1ON106161970.009
Skud_7.2744.113ON108063970.009
Kpol_455.108.879ON83039960.009
NCAS0B065502.231ON90650960.009
Ecym_1146na 4ON665272960.010
TBLA0C062306.60ON79545960.010
KLLA0A02585gna 5ON37050950.010
Suva_13.1862.565ON894120960.011
TBLA0D054201.277ON75754950.012
KAFR0F010406.279ON834330950.013
Skud_9.372.231ON95453950.013
CAGL0H04367g4.344ON94542950.013
Ecym_81598.879ON90839950.013
KAFR0L021308.879ON88239950.013
Skud_4.4758.423ON91355950.013
NCAS0A061904.344ON894115950.014
NDAI0A034204.113ON110845950.014
SAKL0A02860g6.279ON745335950.015
Smik_7.2774.113ON106963950.015
Kwal_47.168624.344ON74342940.017
KLLA0F04609g2.231ON91650940.017
KNAG0E017602.231ON90250940.017
ZYRO0C18150g1.128ON57165940.018
TBLA0A04280singletonON89244940.018
NDAI0E038507.56ON76889940.019
Kwal_26.7095na 6ON83861940.019
KLLA0B04620g4.344ON919100940.020
TBLA0H006808.423ON88078930.021
Kpol_1008.137.512ON90271930.021
Kpol_538.528.879ON90735930.022
CAGL0G08844g2.231ON84753930.023
AGL091W8.423ON86647930.023
CAGL0F07909g3.109ON104949930.024
Kwal_55.20722singletonON82759930.025
ZYRO0G17512gsingletonON52343920.025
TBLA0F012003.109ON108669930.026
TBLA0G026102.231ON100092930.027
Kpol_1001.34.344ON85686920.027
Smik_13.1832.565ON911183920.027
TDEL0D051503.109ON99667920.029
NCAS0A150207.512ON80974920.030
Suva_7.2684.113ON100085920.030
NDAI0F00110singletonON50839910.031
TBLA0G011308.879ON113239920.031
TPHA0A045403.109ON117855920.033
CAGL0H00396g7.512ON94069910.036
SAKL0G17908g4.344ON809105910.036
SAKL0H13024g8.423ON75447910.037
KAFR0C039002.654ON81850910.037
NDAI0F012206.279ON960165910.038
TBLA0I025408.423ON125941910.039
Kpol_1042.66.60ON78045910.039
ZYRO0A00440g8.879ON850115910.039
Ecym_4635na 1ON85652910.042
Smik_16.15singletonON46360900.042
YDR213W (UPC2)8.423ON913160910.044
KLLA0F19602g8.283ON60348900.044
TBLA0C040504.113ON120744910.047
KAFR0C03660singletonON84785900.048
KAFR0I002804.344ON936104900.053
NCAS0H00780singletonON90937900.053
TDEL0G04890singletonON584177900.054
KLLA0C17050gna 7ON955111900.054
TPHA0L010608.423ON97342900.055
KLLA0E18129g2.654ON86566900.060
KAFR0B063408.423ON86441900.060
NDAI0A03410na 8ON98096900.062
TPHA0H019806.279ON99357900.062
TDEL0F023304.113ON1086227900.063
TDEL0B074902.654ON86560890.066
Kwal_23.31228.423ON78848890.067
KLLA0A06039g1.199ON65746890.069
Smik_17.27singletonON68841890.069
Suva_2.1873.264ON78463890.073
KNAG0E041507.17ON113650890.078
Skud_13.438.879ON88039890.079
NCAS0B051108.283ON62788880.081
NDAI0I007406.279ON103355890.082
Kwal_34.15751na 9ON62857880.082
TPHA0B015854.344ON81253880.083
KLLA0D10197g8.879ON85647880.086
KNAG0K008203.109ON105072880.087
TDEL0F054708.423ON81042880.091
KLTH0D16456gna 4ON66146880.093
Kpol_1061.113.264ON733198880.094
CAGL0F07865g8.423ON84442880.099
Smik_13.368.879ON88039880.099
YML099C (ARG81)8.879ON88039880.099
Ecym_51871.203ON365106870.10
NDAI0J004407.512ON82355880.10
CAGL0I07755g3.109ON105349880.10
YML076C (WAR1)4.344ON94449880.10
Smik_15.673.109ON1030102880.11
SAKL0G19470g2.654ON83150870.11
AFR096W1.277ON85261870.12
Skud_15.3346.61ON79047870.12
Smik_16.20na 10ON47375860.12
Ecym_41448.423ON84048870.12
Suva_13.498.879ON88239870.12
SAKL0G17622gna 4ON67649870.12
KLTH0D01804g7.56ON65285870.12
Ecym_7440na 11ON89856870.13
ABR174W7.512ON86453870.13
Suva_10.3238.423ON81342870.13
KLTH0F07854g8.423ON78843870.13
YLR098C (CHA4)8.283ON64849860.13
Smik_13.644.344ON94449870.14
Skud_20.3singletonON47073860.14
ZYRO0B14718g4.344ON103544870.14
NCAS0G011006.279ON93557870.14
KLTH0C07480g3.264ON77588860.14
TPHA0C049808.879ON85239860.14
KNAG0A044808.423ON101341870.14
KNAG0G030008.751ON22993840.14
SAKL0D03586g3.264ON80174860.14
KLLA0A04169g8.423ON77548860.15
NCAS0I002707.17ON944106860.15
YMR019W (STB4)2.565ON94973860.15
KLTH0E14454gna 11ON90264860.15
ZYRO0A10956g5.235ON85541860.16
KLLA0F00572gna 3ON59765860.16
NCAS0D027206.60ON75755860.16
KAFR0A014801.277ON72550860.17
Skud_4.2873.264ON78463860.17
Ecym_72037.512ON88460860.17
TPHA0F013802.231ON89095860.17
Skud_13.1732.565ON92039860.17
AFL160C6.279ON64855850.18
Kwal_26.81092.547ON97041860.18
TBLA0G00490singletonON91853860.18
Smik_12.1578.283ON64449850.18
KLLA0F04213g3.264ON76844850.18
SAKL0A00704gna 12ON71847850.19
Kpol_2002.261.26ON805186850.19
KLLA0A10329gna 13ON63956850.19
SAKL0C09944g3.109ON106159850.19
KLLA0D10593g7.512ON925335850.19
KNAG0M010406.60ON84162850.19
ZYRO0D08316gna 14ON68050850.20
ACL096W2.654ON83566850.20
ZYRO0G12584gna 15ON68648850.20
KLLA0E19603g7.360ON68199850.21
ZYRO0A03058g3.264ON73678850.21
Kpol_495.213.109ON108542850.22
Smik_6.4526.279ON87855850.22
Kwal_56.226053.109ON86542850.22
Skud_15.643.109ON103289850.22
ZYRO0A09350g8.423ON79347850.23
KLLA0F09559gsingletonON65848840.23
TPHA0F025506.61ON79953850.23
YKL015W (PUT3)2.654ON97954850.23
KNAG0E004507.56ON71043840.24
Kwal_33.131181.26ON779141840.25
NCAS0D041906.279ON89047840.26
CAGL0L03377g1.277ON120951840.26
KAFR0A066904.113ON99782840.26
TPHA0I008601.260ON49691840.27
Skud_13.664.344ON93949840.27
AER370W2.231ON80146840.28
TDEL0H039507.56ON66278840.28
Ecym_63401.277ON95261840.28
Skud_12.2968.423ON81442840.28
Kpol_1018.306.279ON88157840.29
SAKL0D02596gna 15ON75043840.29
YPL248C (GAL4)6.279ON88155840.30
NCAS0A067105.322ON76938840.30
NDAI0B015402.565ON80353830.31
KLTH0E05786gna 16ON81742830.31
NDAI0D00900singletonON86550830.31
Kwal_56.230583.264ON77553830.31
NCAS0H034202.654ON90271830.31
YLR228C (ECM22)8.423ON81442830.32
KNAG0F037207.512ON76659830.32
YDR034C (LYS14)3.264ON79070830.33
SAKL0C03938g1.128ON78086830.33
Suva_16.25singletonON14378780.33
Smik_12.2898.423ON81242830.34
NDAI0K018002.547ON121044830.34
Smik_15.3506.61ON78447830.34
KAFR0B028208.283ON66457830.35
KLLA0D05038gna 17ON67349830.35
SAKL0B10538g7.56ON70147830.35
SAKL0H25146gna 17ON64562830.36
ABL099W3.264ON80056830.36
TBLA0C019105.577ON1148101830.37
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G04884g
         (930 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...  1914   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   955   0.0  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   890   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   889   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   883   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   872   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   856   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   845   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...   840   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...   837   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...   830   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...   820   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   815   0.0  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   760   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     718   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   687   0.0  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   639   0.0  
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   616   0.0  
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    50   2e-05
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    50   3e-05
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    50   3e-05
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    47   2e-04
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    47   2e-04
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    47   3e-04
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       47   3e-04
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    47   3e-04
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    46   4e-04
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    46   6e-04
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    45   7e-04
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    45   7e-04
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    45   8e-04
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    45   8e-04
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    45   0.001
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    45   0.001
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    45   0.001
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    45   0.001
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    45   0.001
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    44   0.001
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    44   0.002
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    44   0.002
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    44   0.002
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    44   0.002
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    44   0.002
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    44   0.002
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    44   0.002
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    44   0.002
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    44   0.002
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    44   0.003
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    43   0.003
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    43   0.004
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    43   0.004
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    43   0.004
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    43   0.005
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               42   0.006
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    42   0.006
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    42   0.007
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    42   0.007
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    42   0.007
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    42   0.007
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    42   0.007
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    42   0.007
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    42   0.007
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    42   0.008
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    42   0.008
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    42   0.009
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    42   0.009
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    42   0.009
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    42   0.009
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    42   0.009
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    42   0.010
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    42   0.010
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    41   0.010
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    42   0.011
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    41   0.012
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    41   0.013
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    41   0.013
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    41   0.013
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    41   0.013
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    41   0.013
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    41   0.013
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    41   0.014
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    41   0.014
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    41   0.015
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    41   0.015
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    41   0.017
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    41   0.017
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    41   0.017
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    41   0.018
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    41   0.018
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      41   0.019
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    41   0.019
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    41   0.020
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    40   0.021
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    40   0.021
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    40   0.022
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    40   0.023
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    40   0.023
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    40   0.024
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    40   0.025
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    40   0.025
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    40   0.026
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    40   0.027
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    40   0.027
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    40   0.027
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    40   0.029
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    40   0.030
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    40   0.030
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 40   0.031
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    40   0.031
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    40   0.033
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    40   0.036
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    40   0.036
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    40   0.037
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    40   0.037
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    40   0.038
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    40   0.039
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    40   0.039
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    40   0.039
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    40   0.042
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    39   0.042
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    40   0.044
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    39   0.044
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    40   0.047
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    39   0.048
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    39   0.053
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    39   0.053
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    39   0.054
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    39   0.054
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    39   0.055
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    39   0.060
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    39   0.060
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    39   0.062
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    39   0.062
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    39   0.063
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    39   0.066
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    39   0.067
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    39   0.069
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    39   0.069
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    39   0.073
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    39   0.078
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    39   0.079
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    39   0.081
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    39   0.082
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    39   0.082
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     39   0.083
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    39   0.086
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    39   0.087
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    39   0.091
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    39   0.093
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    39   0.094
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    39   0.099
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    39   0.099
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    39   0.099
Ecym_5187 Chr5 complement(393102..394199) [1098 bp, 365 aa] {ON}...    38   0.10 
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    39   0.10 
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    39   0.10 
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    39   0.10 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    39   0.11 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    38   0.11 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    38   0.12 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    38   0.12 
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    38   0.12 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    38   0.12 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    38   0.12 
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    38   0.12 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    38   0.12 
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    38   0.13 
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    38   0.13 
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    38   0.13 
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    38   0.13 
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    38   0.13 
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    38   0.14 
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     38   0.14 
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    38   0.14 
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    38   0.14 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    38   0.14 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    38   0.14 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    38   0.14 
KNAG0G03000 Chr7 (651063..651752) [690 bp, 229 aa] {ON} Anc_8.75...    37   0.14 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    38   0.14 
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    38   0.15 
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    38   0.15 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    38   0.15 
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    38   0.15 
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    38   0.16 
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    38   0.16 
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    38   0.16 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    38   0.17 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    38   0.17 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    38   0.17 
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    38   0.17 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    38   0.17 
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    37   0.18 
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    38   0.18 
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                38   0.18 
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    37   0.18 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    37   0.18 
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    37   0.19 
Kpol_2002.26 s2002 (52403..54820) [2418 bp, 805 aa] {ON} (52403....    37   0.19 
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    37   0.19 
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    37   0.19 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    37   0.19 
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    37   0.19 
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    37   0.20 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    37   0.20 
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    37   0.20 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    37   0.21 
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    37   0.21 
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    37   0.22 
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    37   0.22 
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    37   0.22 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    37   0.22 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    37   0.23 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    37   0.23 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    37   0.23 
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    37   0.23 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    37   0.24 
Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C ...    37   0.25 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     37   0.26 
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    37   0.26 
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    37   0.26 
TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa] {O...    37   0.27 
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    37   0.27 
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    37   0.28 
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    37   0.28 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    37   0.28 
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    37   0.28 
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    37   0.29 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    37   0.29 
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    37   0.30 
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    37   0.30 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    37   0.31 
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    37   0.31 
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               37   0.31 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    37   0.31 
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    37   0.31 
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    37   0.32 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    37   0.32 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    37   0.33 
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    37   0.33 
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    35   0.33 
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    37   0.34 
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    37   0.34 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    37   0.34 
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    37   0.35 
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    37   0.35 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    37   0.35 
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    37   0.36 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    37   0.36 
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    37   0.37 
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    37   0.38 
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             37   0.38 
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    37   0.38 
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    36   0.39 
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      37   0.39 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    37   0.39 
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    36   0.39 
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    36   0.42 
Skud_4.795 Chr4 complement(1401165..1403492) [2328 bp, 775 aa] {...    36   0.45 
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    36   0.45 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    36   0.46 
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    36   0.46 
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    36   0.47 
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    36   0.47 
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    36   0.48 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    36   0.48 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    36   0.49 
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    36   0.49 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    36   0.49 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    36   0.49 
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    36   0.50 
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    36   0.50 
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    36   0.51 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    36   0.52 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    36   0.52 
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    36   0.53 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    36   0.54 
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    36   0.56 
Kwal_14.2619 s14 (835443..838946) [3504 bp, 1167 aa] {ON} YLR256...    36   0.57 
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    36   0.57 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    36   0.57 
KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa] ...    36   0.57 
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    36   0.58 
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    36   0.58 
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    36   0.58 
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    35   0.59 
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    36   0.59 
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    36   0.60 
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    36   0.60 
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    36   0.60 
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    36   0.60 
KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON}                   36   0.61 
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    36   0.61 
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    36   0.61 
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               36   0.61 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    36   0.62 
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    36   0.63 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    36   0.67 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    36   0.68 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    36   0.68 
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    36   0.70 
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            36   0.70 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    35   0.71 
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    35   0.72 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    35   0.74 
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    35   0.74 
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    35   0.76 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    35   0.77 
Suva_14.85 Chr14 complement(155326..159018) [3693 bp, 1230 aa] {...    35   0.80 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    35   0.80 
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    35   0.81 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    35   0.82 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    35   0.82 
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    35   0.82 
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    35   0.83 
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    35   0.84 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      35   0.84 
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    35   0.86 
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    35   0.89 
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    35   0.90 
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    35   0.90 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    35   0.93 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 35   0.93 
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    35   0.94 
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    35   0.95 
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    35   0.96 
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    35   0.97 
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    35   0.98 
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    35   0.98 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     35   0.98 
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     35   0.99 
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    35   0.99 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    35   1.0  
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    35   1.0  
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    35   1.1  
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    35   1.1  
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    35   1.1  
SAKL0F00418g Chr6 (34751..36430) [1680 bp, 559 aa] {ON} conserve...    35   1.1  
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    35   1.1  
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    35   1.1  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    35   1.1  
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    35   1.1  
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    35   1.2  
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    35   1.2  
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     35   1.2  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    35   1.2  
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               35   1.2  
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    35   1.2  
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    35   1.3  
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    35   1.3  
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    35   1.3  
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    35   1.3  
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    35   1.3  
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    35   1.3  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.3  
Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}...    35   1.3  
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    35   1.3  
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    35   1.4  
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    35   1.4  
KLLA0C01023g Chr3 (76863..78773) [1911 bp, 636 aa] {ON} similar ...    35   1.4  
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    35   1.4  
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    35   1.4  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    35   1.4  
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    35   1.4  
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    35   1.4  
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    35   1.5  
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    35   1.5  
Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451...    35   1.5  
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    35   1.5  
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    35   1.5  
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    34   1.5  
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    34   1.5  
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    35   1.5  
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    34   1.5  
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    34   1.6  
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    35   1.6  
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    34   1.6  
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    34   1.6  
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    34   1.6  
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    34   1.6  
Smik_9.227 Chr9 (373211..376084) [2874 bp, 957 aa] {ON} YIR023W ...    34   1.6  
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    34   1.7  
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    34   1.7  
KAFR0G01220 Chr7 (276857..279406) [2550 bp, 849 aa] {ON} Anc_1.2...    34   1.7  
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    34   1.7  
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    34   1.7  
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    34   1.7  
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     34   1.8  
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    34   1.8  
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    34   1.8  
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    34   1.8  
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       34   1.8  
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    34   1.8  
SAKL0F11198g Chr6 complement(873587..875866) [2280 bp, 759 aa] {...    34   1.8  
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    34   1.8  
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    34   1.9  
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    34   1.9  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    34   1.9  
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    34   1.9  
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      34   2.0  
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    34   2.0  
TBLA0E03050 Chr5 complement(764239..766578) [2340 bp, 779 aa] {O...    34   2.0  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    34   2.0  
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    34   2.1  
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    34   2.1  
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    34   2.2  
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    34   2.4  
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    34   2.4  
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    34   2.4  
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    34   2.4  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    34   2.4  
TPHA0E03830 Chr5 complement(805860..808328) [2469 bp, 822 aa] {O...    34   2.4  
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    34   2.4  
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    34   2.4  
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    34   2.5  
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    34   2.5  
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    34   2.6  
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    34   2.6  
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    33   2.6  
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    33   2.6  
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    33   2.7  
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    33   2.7  
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    34   2.7  
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    33   2.8  
KLTH0F00990g Chr6 (77084..79441) [2358 bp, 785 aa] {ON} similar ...    33   2.8  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    33   2.8  
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    33   2.8  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               33   2.9  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...    33   2.9  
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    33   2.9  
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    33   2.9  
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    33   3.0  
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    33   3.0  
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    33   3.1  
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    33   3.1  
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    33   3.2  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    33   3.2  
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    33   3.2  
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    33   3.2  
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    33   3.3  
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    33   3.3  
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    33   3.3  
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    33   3.5  
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    33   3.5  
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    33   3.5  
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    33   3.5  
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    33   3.5  
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    33   3.6  
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    33   3.6  
KLLA0C08657g Chr3 (757100..759268) [2169 bp, 722 aa] {ON} some s...    33   3.7  
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    33   3.7  
KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121     33   3.8  
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    33   3.8  
TBLA0A00280 Chr1 (45618..47912) [2295 bp, 764 aa] {ON}                 33   3.8  
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    33   3.9  
NCAS0B02930 Chr2 (504501..506606) [2106 bp, 701 aa] {ON} Anc_8.416     33   4.0  
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    33   4.1  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    33   4.1  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    33   4.1  
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    33   4.2  
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    33   4.2  
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    33   4.5  
TBLA0C00940 Chr3 (187969..190338) [2370 bp, 789 aa] {ON} Anc_2.6...    33   4.5  
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    33   4.5  
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    33   4.5  
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    33   4.6  
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    33   4.8  
KAFR0A08350 Chr1 (1672461..1677341) [4881 bp, 1626 aa] {ON} Anc_...    33   5.1  
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    33   5.7  
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    33   5.8  
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    33   5.9  
AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic ho...    33   6.0  
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    33   6.2  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    32   6.2  
ZYRO0A05324g Chr1 complement(434078..434983) [906 bp, 301 aa] {O...    32   6.4  
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    32   6.5  
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    32   6.7  
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    32   7.0  
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    32   7.1  
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    32   7.3  
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    32   7.5  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    32   7.6  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    32   7.8  
TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.2...    32   7.8  
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    32   7.9  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     32   7.9  
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    32   8.1  
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    32   8.1  
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    32   8.2  
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    32   8.2  
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    32   8.9  
TPHA0A05190 Chr1 complement(1167058..1167912) [855 bp, 284 aa] {...    32   9.3  
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    32   9.4  

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score = 1914 bits (4959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 915/930 (98%), Positives = 915/930 (98%)

Query: 1   MNNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECI 60
           MNNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECI
Sbjct: 1   MNNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECI 60

Query: 61  FTESNKRGGLRVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLP 120
           FTESNKRGGLRVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLP
Sbjct: 61  FTESNKRGGLRVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLP 120

Query: 121 INSELTTMQDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDS 180
           INSELTTMQDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDS
Sbjct: 121 INSELTTMQDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDS 180

Query: 181 TRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSE 240
           TRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSE
Sbjct: 181 TRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSE 240

Query: 241 EEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGE 300
           EEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGE
Sbjct: 241 EEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGE 300

Query: 301 SNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANN 360
           SNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANN
Sbjct: 301 SNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANN 360

Query: 361 PDLNDVSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDM 420
           PDLNDVSKRDL               QQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDM
Sbjct: 361 PDLNDVSKRDLSNVACSSSSSTACNSQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDM 420

Query: 421 GFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINLNGYEDDVENESYYLGQILKSD 480
           GFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINLNGYEDDVENESYYLGQILKSD
Sbjct: 421 GFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINLNGYEDDVENESYYLGQILKSD 480

Query: 481 GSKERWSKFLKKLGSSSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRK 540
           GSKERWSKFLKKLGSSSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRK
Sbjct: 481 GSKERWSKFLKKLGSSSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRK 540

Query: 541 KQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIYRGKLKLYSNSQYHNLALLSILSPLIE 600
           KQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIYRGKLKLYSNSQYHNLALLSILSPLIE
Sbjct: 541 KQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIYRGKLKLYSNSQYHNLALLSILSPLIE 600

Query: 601 SWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVD 660
           SWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVD
Sbjct: 601 SWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVD 660

Query: 661 VGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVA 720
           VGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVA
Sbjct: 661 VGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVA 720

Query: 721 FVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYS 780
           FVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYS
Sbjct: 721 FVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYS 780

Query: 781 TILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPL 840
           TILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPL
Sbjct: 781 TILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPL 840

Query: 841 PPPRMNSLPETTNFAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQ 900
           PPPRMNSLPETTNFAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQ
Sbjct: 841 PPPRMNSLPETTNFAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQ 900

Query: 901 QFISNDNNKTFENLYNQATGLDFQTSQPDR 930
           QFISNDNNKTFENLYNQATGLDFQTSQPDR
Sbjct: 901 QFISNDNNKTFENLYNQATGLDFQTSQPDR 930

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/803 (59%), Positives = 596/803 (74%), Gaps = 38/803 (4%)

Query: 13  QIQPPK--WRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGL 70
           Q  P K  ++R Y+ACLNC+ RKVKCDLGP DNPH PPCVRCKRE +EC+FTE+ KRGG 
Sbjct: 9   QTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTET-KRGGF 67

Query: 71  RVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKR--ENSIDPLPINSELTTM 128
           RVA  S ++    +A  SM+  ITSV QG T +     D  R   ++ D + IN++  T+
Sbjct: 68  RVAKQSLVSLKEESAGKSMADVITSVIQGQTLKKELDTDLDRLQTHTKDDISINTDPPTL 127

Query: 129 QDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSAN 188
           Q+A  FLAKAAGSVAKED RD VDA+TKY+E+E          +SS   + +T +   ++
Sbjct: 128 QNAFYFLAKAAGSVAKEDLRDQVDAATKYDEIEPTDAVSRQPSVSSYGNKQATGSMEPSS 187

Query: 189 IPD---EACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVK 245
           IP    ++ +   + P G    TIPLIEKLSSVRPKPS +L DIEYIG  ++L+E EA K
Sbjct: 188 IPKMLTDSYVTSFVEPEGQKPGTIPLIEKLSSVRPKPSMKLGDIEYIGPYQLLTEAEARK 247

Query: 246 LIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRN 305
            ID FFLTMHPF P++PLQLQ+ DELA+YP+LLC ILTIS+RYH+  ++ + N   N  +
Sbjct: 248 RIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTILTISARYHTLHDLGL-NEIDNTVH 306

Query: 306 VEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLND 365
           VE+HERLWIYCQRL+SQTVWAEASTRSIGT+LAFL+FTEWNPRAIHW+ SDYAN PD++D
Sbjct: 307 VELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLIFTEWNPRAIHWKGSDYANYPDISD 366

Query: 366 VSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNT 425
           + KR                  Q  D LTGL+AMRRSDRM+W+LTG AVRLAQD+  +  
Sbjct: 367 LPKR----------PSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTGNAVRLAQDLNVIEF 416

Query: 426 SSKIFTATHISETHTAMNMNQRSILSQSLAEINLNGYED-DVENESYYLGQILKSDGSKE 484
           SSKIF  THI ETHTAMN+N+RS LS+SL+E+ LNG+ED D++NE ++L +IL++D SKE
Sbjct: 417 SSKIFVMTHICETHTAMNLNKRSSLSESLSEVRLNGFEDNDLDNEQFFLERILQNDKSKE 476

Query: 485 RWSKFLKKLGSSSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRKKQIE 544
           RW++FL+++G  S +G + DIEREF+NDEY+LY+ + +     +D               
Sbjct: 477 RWARFLERVGERSKKGSLTDIEREFLNDEYLLYHYNTENPNTQSDP-------------- 522

Query: 545 EEPYNLKFSFGQRAKIELLRIMSIGYETIYRGKLKLYSNSQYHNLALLSILSPLIESWYN 604
              + LKFS  QR K+ELL+I+S+GYE +Y GKL   S+ ++  L++LS+LSPLIE WYN
Sbjct: 523 --EFRLKFSKIQRGKVELLKIVSLGYENVYNGKLS--SHDRHQRLSMLSVLSPLIEGWYN 578

Query: 605 TYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVDVGTP 664
            YK++L PC GAAC+ A  S K ++FE+TEKV+ ESLISDYYYCQLYIYSLALQ D    
Sbjct: 579 IYKSLLVPCGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIYSLALQWDHQDT 638

Query: 665 KDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVAFVVK 724
              KLR+NEITK ARYVELAYNAAKEILNSA RVHKLKMLKYMPVRWV RIVRS+ F++K
Sbjct: 639 STSKLRLNEITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVMRIVRSIVFMIK 698

Query: 725 CYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYSTILM 784
           CYLTLTG+GI  NPEANTILT+SV+PT+EIIQTIQR AI LR A+PDELHLC+RYSTILM
Sbjct: 699 CYLTLTGNGITQNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDELHLCSRYSTILM 758

Query: 785 YLCTEMKLRSRPNPQPPVPRSIS 807
           YLCTEMK R +PN QPPVPRSIS
Sbjct: 759 YLCTEMKHRCKPNMQPPVPRSIS 781

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 39/46 (84%)

Query: 871 HLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFISNDNNKTFENLYN 916
           +LP Q+VDWF+ ++EIGLDFV PWTEM+E+QF++  ++ ++EN +N
Sbjct: 893 YLPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFVNKVDDSSYENWFN 938

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/922 (50%), Positives = 598/922 (64%), Gaps = 82/922 (8%)

Query: 13  QIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRV 72
           ++   K+RR Y+ACLNCR+RK +CDLGP D+P DPPCVRCKRERKEC+F E++KRGG + 
Sbjct: 11  EVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKR 70

Query: 73  ANVSAIAENTANATASMSKAITSVFQGNTSEGSQQP--DFKRENSIDPLPINSELTTMQD 130
              +       NATA              +E    P    K   SI    +  EL +M +
Sbjct: 71  IEWTVDGNTDVNATARFE-----------AEDKYIPVATLKDTTSIKEGSLTPELNSMHN 119

Query: 131 ALEFLAKAAGSVAKEDSRDLVDASTKYEE-LESQSNSRTDTPISSGSAQDSTRNSNSANI 189
           ALEFLAKAAGS AKEDSR  + +  + ++ +  ++  R ++P  +  A  S R S     
Sbjct: 120 ALEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESP--NQHASGSKRAS----- 172

Query: 190 PDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDL 249
                         L  P   LIEKLS  +P     L D+EYIG  K+L+E+EA +LIDL
Sbjct: 173 --------------LATPG-KLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDL 217

Query: 250 FFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIH 309
           FFL MHPFFP++P QL+   EL +YPILLCAILTIS+RYH+F E  +  GE ++RN+E+H
Sbjct: 218 FFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVH 277

Query: 310 ERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSKR 369
           +RLWIYCQRLISQ+VWAEASTRS+GT+LAFLLFTEWNPRAIHW W+DYAN+  L+D+S+R
Sbjct: 278 DRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRR 337

Query: 370 DLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKI 429
           D                +     LTG+ AMRRSDRMAWMLTGTAVRLAQDMGFMN S KI
Sbjct: 338 DYHSEAK----------RSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKI 387

Query: 430 FTATHISETHTAMNMNQRSILSQSLAEINLNGYEDDVENESYYLGQILKSDGSKERWSKF 489
           FTA HI+ET TAMNMNQRSILSQSLAE++LNG++ D    S  + +I +++ SK RW  +
Sbjct: 388 FTALHITETQTAMNMNQRSILSQSLAEVSLNGHDGDSGLSSACIEEIFRNEDSKRRWKSY 447

Query: 490 LKKLGSSSTRG-RMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRKKQIEEEPY 548
            ++  S   +     D E+EF+ DEY  ++++   + A+ D   +   +  K    ++  
Sbjct: 448 TQQRDSVEGKSVGFCDNEKEFLIDEYAFFHNED--SDAYRDLSNLGTHEKSKLSAADK-- 503

Query: 549 NLKFSFGQRAKIELLRIMSIGYETIYRGKLKLYSNSQYHNLALLSILSPLIESWYNTYKT 608
            L F+  QRAK+ELLRIMSIGYE IY    KL      H LA+L IL+P+I+ W+NTYK 
Sbjct: 504 -LLFTPRQRAKVELLRIMSIGYEAIYYKDTKLTLIDHKHKLAVLGILAPMIKGWHNTYKH 562

Query: 609 ILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVDVGTPKDKK 668
           +L P +G  C       K   ++   K+D ESLISDY+YCQLYIYSLALQ++ GT KDKK
Sbjct: 563 LLVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKK 622

Query: 669 LRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLT 728
             +NE+TK A+YVELAYNAAKE+L+SAIRVHKL+ LKYMPVRW  RI+R+VAFVV+CY+T
Sbjct: 623 PNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPVRWAARIIRAVAFVVRCYMT 682

Query: 729 LTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYSTILMYLCT 788
           LTGSG+ ++P A TIL + VI  EEII+ IQ+AAITLREASPDELHLC+R+ST+LM+LCT
Sbjct: 683 LTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCT 742

Query: 789 EMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPLPPPRMNSL 848
           EMK +    PQ                         +E       S       P RM + 
Sbjct: 743 EMKRKQHSEPQ------------------------NSELRRSSSHSLHNPTDAPARMPTT 778

Query: 849 PETTNFAFNVDNFFSPQGAQT---HHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFISN 905
           P   N+A    +F  P   +T    HLP+++ DWF TSD++GLDFVEPW EM+EQQFI+N
Sbjct: 779 P-AENYA--ATDFAIPAFLETPHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINN 835

Query: 906 DNNKTFENLYNQATGLDFQTSQ 927
           D N TFENLYN+A G +    Q
Sbjct: 836 DKNMTFENLYNEAMGYEHLPKQ 857

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/968 (50%), Positives = 625/968 (64%), Gaps = 113/968 (11%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR------GGLR 71
           KWRR+Y+ACLNCR RKVKCDLGP DNPH PPCVRCKRE++EC+FT   K+      G + 
Sbjct: 15  KWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLFTSRRKKKDDVISGTVS 74

Query: 72  VANV-SAIAENTANATASMSKAITSVFQGNTSEG---SQQPDFKRENSIDPLPINSELTT 127
           + NV SAI +   N    ++          +S+G   S  P  K  N+ D       L +
Sbjct: 75  LTNVPSAITQEDDNDRIQLNSG--------SSKGALFSNSP--KNPNTQDQSKWKYGLGS 124

Query: 128 MQDALEFLAKAAGSVAKEDSRDLVDA--STKYEELESQSNSRTDTPISSGSAQDSTRNSN 185
           MQ+ LEFLA AAGSV+KE +R L  A  S +Y + E+  + R D    S   +D T  S 
Sbjct: 125 MQNTLEFLATAAGSVSKESNRRLTTARHSHQYAK-ETSEDFRVDDSSPSSERKDITDTS- 182

Query: 186 SANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVK 245
                +++ IAPLL+  G  R T+ LIE+LS VRPKP+++L DI+YIG   +LSE+EA +
Sbjct: 183 -----EQSVIAPLLKECGTQRATVSLIEELSRVRPKPNKKLADIDYIGPSNLLSEQEARE 237

Query: 246 LIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRN 305
           LID +FLTMHPFFP++PLQLQ+PDEL  YPILLCAILT+SSRYH F E   YNGE+N RN
Sbjct: 238 LIDAYFLTMHPFFPNIPLQLQDPDELVNYPILLCAILTMSSRYHPFSEFGFYNGENNKRN 297

Query: 306 VEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLN- 364
           +E+HE LW YCQRLISQTVWAEASTRSIGTVLAF++FTEWNPR IHWR +DYAN+ + + 
Sbjct: 298 IEVHETLWDYCQRLISQTVWAEASTRSIGTVLAFIIFTEWNPRQIHWRRTDYANSAEKDT 357

Query: 365 DVSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMN 424
           DV                    Q+  DGLTG+ A+RRSDRM+WMLTG+AVRLAQDMGF+ 
Sbjct: 358 DVPH-----------------SQKDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDMGFIE 400

Query: 425 TSSKIFTATHISETHTAMNMNQRSILSQSLAEINLN-GYE------------DDVENESY 471
           TS+KIF A+HIS+T  +MNMNQR  LS++ + +    G E            D+V NE +
Sbjct: 401 TSTKIFVASHISDTFASMNMNQRCALSETFSVVGFGAGRERASAIDSEQTDVDEVGNEKF 460

Query: 472 YLGQILKSDGSKERWSKFLKKLGSSSTR--GRMNDIEREFVNDEYVLYYSDKDGAPAHAD 529
           YL Q+L+++ S+ERW++ L++L  ++ +  G + D+EREF+NDEYVLYY++++      D
Sbjct: 461 YLEQMLQNEESRERWTRVLERLQHNNDKKNGPLTDLEREFLNDEYVLYYANRN------D 514

Query: 530 EYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKLKLYSNSQYH 587
           E          +Q  + P+ LKFSF QRAKIEL+RI+ I Y+TIY  +GK KL SN Q H
Sbjct: 515 EMV--------QQHLQLPFPLKFSFHQRAKIELIRIILIAYDTIYYDKGKRKLTSNDQVH 566

Query: 588 NLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYY 647
           NLA+L ILSPLIE WY TY+ +LK  SG   +  +   K+ + EL E+++RES++SDYYY
Sbjct: 567 NLAVLGILSPLIEGWYATYRNLLKISSGQPYSIEIRKNKRAVHELGEEINRESILSDYYY 626

Query: 648 CQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYM 707
           CQLYIYSLALQVDV  P   KLR+NE TK A+YVELAY AAKEIL S+ RVH+LKMLKYM
Sbjct: 627 CQLYIYSLALQVDVKGP---KLRINEATKSAKYVELAYVAAKEILISSTRVHRLKMLKYM 683

Query: 708 PVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLRE 767
           PVRWV RIVR+V+F+VKCYLTLTG G   N EA TIL L  I  +E I TI+ AA+ L+E
Sbjct: 684 PVRWVMRIVRAVSFLVKCYLTLTGGGGVPNSEAQTILKLCCISLDETIHTIRLAALILKE 743

Query: 768 ASPDELHLCTRYSTILMYLCTEMKLRSRPNPQPPVPRSI----------------SEQPE 811
           ASPDELHLC RYS IL+YLC EM L+S+ N +  V   I                + Q  
Sbjct: 744 ASPDELHLCVRYSAILLYLCKEMNLKSKRNQKLLVSHGILINESRNRQMGSRRTKATQDS 803

Query: 812 QI---SVETTFNFCGKNE------------THEKGQGSQQRGPLPPPRMNSLPETTNFAF 856
            I   S + + N    NE            T       + R   P  R+ +     N   
Sbjct: 804 DIDLGSTDDSKNIQSNNELLPNNISTTNGLTTSLFNTEEMRSETPNQRIPTSAVADNTPN 863

Query: 857 NVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFI-SNDNNKTFENLY 915
           N+DN  +        LP + +DWFS S +IGLDFVEPWTE++EQ+F+ S D N  FE LY
Sbjct: 864 NLDNDGTNNPTNFPSLPDEAIDWFSGSADIGLDFVEPWTELLEQRFLQSGDGNNIFEELY 923

Query: 916 NQATGLDF 923
           NQ    +F
Sbjct: 924 NQVNMPNF 931

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/923 (52%), Positives = 615/923 (66%), Gaps = 80/923 (8%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           KW+R+++AC++CR RKVKCDLGP++NPH PPCVRC+RE K CIF  S+   G+  AN+S 
Sbjct: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF--SSGGNGMSSANLST 83

Query: 78  IAENTANATASMSKAITSVFQGNTSEGSQQPDFK---RENSIDPLPINS---ELTTMQDA 131
           +      AT +  K   SV   N++  SQ    K    EN+   LP      EL +MQ++
Sbjct: 84  MNGKNNQATFTGIKRALSV-DANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNS 142

Query: 132 LEFLAKAAGSVAKEDSRDLVDASTKY-EELESQSNSRTDTPISSGSAQDSTRNSNSANIP 190
           LEFLAKAA SVA + + +    + K  +   S   S  DTP+     QDS         P
Sbjct: 143 LEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSENDTPVQQ---QDS---------P 190

Query: 191 DEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLF 250
           +E  + PL  PH   R  +P +EK  S+RPK S+ L+D+E+IG  K+LSEEEA +LIDLF
Sbjct: 191 NENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLF 250

Query: 251 FLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGE--SNNRNVEI 308
           FLTM+PFFPH+PLQLQ+ DEL +YPILLCAILTISSRYH FDE + YNG      RN+ +
Sbjct: 251 FLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHV 310

Query: 309 HERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSK 368
           HE+LWIYCQRLISQTVWAEASTRSIGT+ AF++FTEWNPRAIHW+WSDYANNP+  D++K
Sbjct: 311 HEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTK 370

Query: 369 RDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSK 428
           R+                 +  DGLTG++A+RRSDRMAWMLTGTAVRLAQD+G + TS+K
Sbjct: 371 RE----------SFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAK 420

Query: 429 IFTATHISETHTAMNMNQRSILSQSLAEINLNGYED--DVENESYYLGQILKSDGSKERW 486
           +F ATHISE++TA+NMNQ  ILSQS  E NL+G ++   V+NE  YL QIL++D SK RW
Sbjct: 421 VFVATHISESYTAINMNQGLILSQSFNERNLDGIDNLNGVDNERLYLEQILQNDESKARW 480

Query: 487 SKFLKKLGSSS--TRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRKKQIE 544
           +  LK L +    +   + D+EREF+NDEY LYY+D D            D +   +QI 
Sbjct: 481 NGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYADHD-----------EDTQQHTQQI- 528

Query: 545 EEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKLKLYSNSQYHNLALLSILSPLIESW 602
                LKF+  Q+AK+ELLRI+ +GYETIY  +G  +L S  Q HNLA+L+IL+PLIESW
Sbjct: 529 ---IPLKFTSTQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESW 585

Query: 603 YNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVDVG 662
           YN Y+++L+   G   +      K+  FE++ +++ E++ISDYYYCQLYIYSLALQVDV 
Sbjct: 586 YNNYRSLLEIREGEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDV- 644

Query: 663 TPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVAFV 722
             ++ KL++NEI +CA +VE AY AAKEIL SA RVHKL MLKYMPVRWV RIVRSVAF+
Sbjct: 645 --EENKLKLNEIRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFI 702

Query: 723 VKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYSTI 782
           VKCYLTLT S ++TNPEANTIL LS I  +E IQTIQ AAITL+EA+PDELHLCTRYS I
Sbjct: 703 VKCYLTLTCSDLSTNPEANTILRLSAISVDETIQTIQTAAITLKEAAPDELHLCTRYSAI 762

Query: 783 LMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPLPP 842
           LMYLC EMKLR +         +   + ++I +E +      N    +G  S   G +P 
Sbjct: 763 LMYLCREMKLRDK---TNNNNNTGENEEQKILIENS------NPDGVEGVAS-NFGNVP- 811

Query: 843 PRMNSLPETTNFAFNVDNFFSPQGAQTH-------HLPTQVVDWFSTSDEIGLDFVEPWT 895
              ++LP +           S  GA +         L   V DWF+   +IGLDFVEPWT
Sbjct: 812 ---STLPPSYAQKSTTKEQLSDDGAHSMSFMDEGPSLSNNVTDWFNVGGDIGLDFVEPWT 868

Query: 896 EMIEQQFI-SNDNNKTFENLYNQ 917
           EMIEQ+++ S D N +FE LY Q
Sbjct: 869 EMIEQRYLQSGDVNTSFEELYRQ 891

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/911 (50%), Positives = 609/911 (66%), Gaps = 63/911 (6%)

Query: 10  ETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG 69
           E+    P KWRR Y+AC++CR +K+KCD+GP+DNPH PPC+RC+RE KECI  E+ +RG 
Sbjct: 9   ESSGSNPTKWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILPENKRRGN 68

Query: 70  LRVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQ 129
                     EN      + S++  S+     +           + +DP     E+ TM 
Sbjct: 69  TDTEFKLGKIENGLVGVMNKSESEQSLLSQTRAPPPNGSTSNNLDLVDP-KWKFEIGTMY 127

Query: 130 DALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISS--GSAQDSTRNSNSA 187
           +ALEFLAKAAGSV+KE+            E++S  N R+D  + +   +A +   + N  
Sbjct: 128 NALEFLAKAAGSVSKEEPI----------EMKSPQN-RSDLGVGNMPDTALNGVMSDNIG 176

Query: 188 N--IPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVK 245
           N  I DE+ +APL   +G  R   PLIEKLSS+RPK S++L D++YIG  K+LSE+EA +
Sbjct: 177 NLDISDESFLAPLTTANGSQRAAAPLIEKLSSMRPKSSKKLIDVDYIGPSKLLSEDEATR 236

Query: 246 LIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRN 305
           LID+FFLTMHPFFPH+PLQLQ+PDEL +YPILLCAILTIS+RY+ F E+  Y+GE++NRN
Sbjct: 237 LIDIFFLTMHPFFPHIPLQLQDPDELVRYPILLCAILTISARYNPFGELGFYDGEAHNRN 296

Query: 306 VEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLND 365
           +E+HERLWIYCQRLISQT+WAEASTRSIGTVLAFLLFTEWNPRAIHW+WSDYANNP+LND
Sbjct: 297 IEVHERLWIYCQRLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANNPELND 356

Query: 366 VSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNT 425
           V+KR+                 +  +  TG++A+RRSDRMAWML G AVRLAQDM F++T
Sbjct: 357 VTKRE----------THGANTPRDTETFTGMAAVRRSDRMAWMLIGAAVRLAQDMSFIDT 406

Query: 426 SSKIFTATHISETHTAMNMNQRSILSQSLAEINLNGYE--DDVENESYYLGQILKSDGSK 483
           SSKIF ATHI+E HTAMN+NQ+SILS+SL+E+N    E  DD+ NE++YL  IL+ D SK
Sbjct: 407 SSKIFVATHIAEAHTAMNLNQKSILSESLSEVNREVLERLDDIGNENFYLEHILQKDESK 466

Query: 484 ERWSKFLKKLGS---SSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRK 540
           ERW+ FL+ +     +   G + D+EREF+NDEYVLYY +     +     T+       
Sbjct: 467 ERWTNFLQNVSEGRRAKGTGPLTDMEREFLNDEYVLYYVNARNDASSKSSLTL------- 519

Query: 541 KQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY----RGKLKLYSNSQYHNLALLSILS 596
                 P+ LKFS  QRAKIELLRI++IGYE+IY    + K +L + +   NLALL I+S
Sbjct: 520 ------PFPLKFSHPQRAKIELLRILTIGYESIYYESEKDKTQLINGNPKRNLALLEIIS 573

Query: 597 PLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLA 656
            LIE W+ TYK +L P +   C+  M   K+ + ELT+++DRESL  DY YCQLYIYSLA
Sbjct: 574 TLIEKWHATYKDLLIPANATPCSLDMARNKRAVHELTQQIDRESLSCDYNYCQLYIYSLA 633

Query: 657 LQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIV 716
           LQ DV   K+  L+M EI K ARYVELAY AA+ IL+SA R+H LKML+YMPVRWVTRIV
Sbjct: 634 LQNDV---KNMDLKMPEIRKSARYVELAYRAAEGILDSAERIHSLKMLRYMPVRWVTRIV 690

Query: 717 RSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLC 776
           R+VAF+VKCYL LT  G+A NP A TIL L+VIP+EE +  I+RAA+TL+EA+PDE+HL 
Sbjct: 691 RAVAFLVKCYLVLTKDGLAANPVAGTILRLTVIPSEETVPIIERAAVTLQEAAPDEVHLG 750

Query: 777 TRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQ 836
            RYS IL +LC E+K+R++ + +        +Q +Q+        C   +  E+ Q  Q 
Sbjct: 751 MRYSKILKFLCAEVKMRTQMSERDEEAEEERKQRQQLE-------CYHRQPRERRQ--QH 801

Query: 837 RGPLPPPRMNSLPETTNFAFNVDNFFSPQGAQTHHLPTQ-VVDWFSTSDEIGLDFVEPWT 895
             P+     +    +     ++D  +SP  A    LP +   D F+ SD+IGLDFV+ WT
Sbjct: 802 AQPVISQSHSPPSPSVMLNSSMDP-YSP-SAPPADLPFEDPFDLFAASDDIGLDFVDTWT 859

Query: 896 EMIEQQFISND 906
           EMIE +++ ++
Sbjct: 860 EMIENRYMQDE 870

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/919 (49%), Positives = 596/919 (64%), Gaps = 107/919 (11%)

Query: 10  ETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG 69
           E +  +  KWRR+Y+ACLNCR RK+KCD+GP+D PH+PPC RCKRE K C F +S K+  
Sbjct: 6   EVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65

Query: 70  LRVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQ 129
            +  + +    N       + K +    + +    S + +    N ID      E+++MQ
Sbjct: 66  FKRQHRT----NGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDG-KWRFEISSMQ 120

Query: 130 DALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANI 189
           +ALEFLAKAAGSVAKED++       + ++++    SR D+     S +D T  S  A+ 
Sbjct: 121 NALEFLAKAAGSVAKEDNQ-----LHEIKQIDPSQVSRDDS-----SWKDLTPTSFEAS- 169

Query: 190 PDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDL 249
                +APL    G  R  +PLI+KLSSVRPKP  +L+++E+IG    L+EEE +KL+D+
Sbjct: 170 -RAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDV 228

Query: 250 FFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIH 309
           FFLTM+PFFPH+PLQLQ+P+ELA+YP+LLC+I+T+S+RYHSF ++ + +   NNRN+E+H
Sbjct: 229 FFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVH 288

Query: 310 ERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSKR 369
           E+LWIYCQ+LISQT+WAEASTRSIGTVLAFLLFTEWNPRAIHW+WSDYAN+ D  D S  
Sbjct: 289 EQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSN- 347

Query: 370 DLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKI 429
                             +  + LTG++A+RRSDRMAWMLTG AVRLAQDMGF  TSSKI
Sbjct: 348 -------------DFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKI 394

Query: 430 FTATHISETHTAMNMNQRSILSQSLAEINLNGYE----DDVENESYYLGQILKSDGSKER 485
           FTATHISETHTAMN+ QRS L++SL EINL   +    + V NE +YL +IL++D SK+R
Sbjct: 395 FTATHISETHTAMNVGQRSTLTESLNEINLGSIKFPRNNSVGNEQFYLEKILENDDSKDR 454

Query: 486 WSKFLKKLG---SSSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRKKQ 542
           W++FL  +    +    G + DIEREF+NDEYVLYY+  DG   H D   +         
Sbjct: 455 WTRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYT-ADGDSKHRDSSNL--------- 504

Query: 543 IEEEPYNLKFSFGQRAKIELLRIMSIGYETIYRGKLKLYS--NSQYHNLALLSILSPLIE 600
               P+ L+FS  QRAKIELLRI+++G+E IY  K K  S  N    NL+LL ++SPLIE
Sbjct: 505 ---LPFPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIE 561

Query: 601 SWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVD 660
           SWY +Y  +L+P  G  C   +C  K+ +  +  K+DRESLI +YYYCQLYIYS ALQVD
Sbjct: 562 SWYKSYHDLLEPAEGKPCTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVD 621

Query: 661 VGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVA 720
           V   K+ +L+++EIT+ A+YVELAYNAAK +L SA R+H+L +LK MPVRWVTRIV+SVA
Sbjct: 622 V---KEGQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVA 678

Query: 721 FVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYS 780
           F+VKCYLTL G+ +  NP ANTIL L+VIP E+I++TI  AA+ L+EASPDELHLC RYS
Sbjct: 679 FIVKCYLTLMGNAVVNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYS 738

Query: 781 TILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPL 840
           TILM LC+EM+         P P             TTF               Q   P 
Sbjct: 739 TILMSLCSEMRESEDYTTDSPTP------------GTTFG--------------QDNDPS 772

Query: 841 P-PPRMNSLPETTNFAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIE 899
           P  P   ++P                      LP  VVDWFSTSDEIGL+FVE W EMIE
Sbjct: 773 PIQPLDTAIP----------------------LPNDVVDWFSTSDEIGLEFVESWAEMIE 810

Query: 900 QQFISNDNNKTFENLYNQA 918
           Q+++   +    +NL N A
Sbjct: 811 QRYLQGSSYS--QNLGNAA 827

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/935 (49%), Positives = 606/935 (64%), Gaps = 85/935 (9%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF-TESNKRGGLRVANVS 76
           KW+R Y+AC NC+ RKVKCD+GP++NPHDPPC RC+RE K C+F T   ++  L  + + 
Sbjct: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78

Query: 77  A----IAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDAL 132
           +    +  N+ N+ +   K + S          + P     N I P      LT+MQ++L
Sbjct: 79  STTPTLKPNSGNSVSK--KRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQNSL 136

Query: 133 EFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDE 192
           EFLAKAAG+V    +     A +  EEL    NS      +S   ++S  N  S+   D 
Sbjct: 137 EFLAKAAGNVGFLSAPS---AHSAREEL----NSAVVPKATSLPQEESLMNMTSSLHSDL 189

Query: 193 ACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFL 252
             I+P+ +   L   ++PLI+KL+ VRP P R+LTDI+YIG  ++LSE +A++LIDLFFL
Sbjct: 190 LNISPIGK---LQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFL 246

Query: 253 TMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEV--NMYNGESNNR-NVEIH 309
           TM PFFP++PLQLQNP ELAQYPILLCAILTISSRYHSFD    ++ NG++N R ++++H
Sbjct: 247 TMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVH 306

Query: 310 ERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSKR 369
           E+LWIYCQRLISQT+WAEASTRSIGT+LAF++FTEWNPRAIHW WSDYA++P LND+SKR
Sbjct: 307 EKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKR 366

Query: 370 DLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKI 429
           ++               ++  +GLTG+ A+RRSDRMAWML+GTAVRLAQD G + T++K+
Sbjct: 367 NMEPQII----------KREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKV 416

Query: 430 FTATHISETHTAMNMNQRSILSQS--------LAEINLNGYED-DVENESYYLGQILKSD 480
             ATHIS+THTAMNMNQRS LS S        L++    G +   V NE++YL QIL++ 
Sbjct: 417 AIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNK 476

Query: 481 GSKERWSKFLKKL--GSSSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKN 538
            SKERW K        +  T G+++D+E EF+NDEY LY+S +D           ND   
Sbjct: 477 ESKERWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKED-----------NDSSQ 525

Query: 539 RKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKLKLYSNSQYHNLALLSILS 596
           R       P  LKF+F QRAK+ELLRI+++GYETIY   G+ +L S+ Q  NLA+L+ILS
Sbjct: 526 RP------PLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILS 579

Query: 597 PLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLA 656
           PLI+SWY+ Y ++LK  +    +  M   K+  F++++ +  E++ISDYYYCQLYI+SLA
Sbjct: 580 PLIDSWYSNYNSLLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLA 639

Query: 657 LQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIV 716
           LQVDVG     KL++NEIT+CA YVE AY AAKEIL SA RVHKLKMLKYMPV+WV RIV
Sbjct: 640 LQVDVG---QNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIV 696

Query: 717 RSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLC 776
           RSVAF+VKCYLTLT    ++NPEA TIL+LS I  +E IQTIQ  AI L+EA+PDELHL 
Sbjct: 697 RSVAFIVKCYLTLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLS 756

Query: 777 TRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQ 836
           TRYS IL+YLC EMK +   + Q     S S     +S +   N  G   + +    S  
Sbjct: 757 TRYSAILLYLCREMKSKHESSQQSKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHA 816

Query: 837 RGPLPPPR---------MNSLPETTNFA----FNVDNFFSPQGAQTHHLPTQVVDWFSTS 883
                 PR         MN       FA    F  DN         + LP  V +WF+TS
Sbjct: 817 EVAAKDPRTSQENIELQMNKPNLDGKFASDMDFTTDNL--------NELPGDVANWFTTS 868

Query: 884 DEIGLDFVEPWTEMIEQQFI-SNDNNKTFENLYNQ 917
             IGL+FVEPWTEMIEQ ++ S D N TF++LY +
Sbjct: 869 GNIGLEFVEPWTEMIEQMYLQSGDANTTFDDLYKE 903

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/983 (46%), Positives = 618/983 (62%), Gaps = 87/983 (8%)

Query: 1   MNNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECI 60
           M+  KR   E      PK RRTYQAC+NCR+RKVKCDLGPVDNPH PPC RCKRE K C+
Sbjct: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70

Query: 61  FTESNKRGGLRVANVSAIAENTANATASMSKAITSVFQGNTSE----GSQQPDFKRENSI 116
           F  S+ R  +   + S I   + +A++   + + +    +T        +  D +     
Sbjct: 71  F--SSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKS 128

Query: 117 DPLPINSELTTMQDALEFLAKAAGSVAKEDSRDLV-DASTK----YEELESQSNSRTDTP 171
           + +    EL++MQ+ LEFLA+AAG+VAKE +++++ D ST        L S     TD  
Sbjct: 129 EGMKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEG 188

Query: 172 ISSGSAQDSTRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEY 231
           +   S   S   ++  N P E     L       R T  LIE++  VRP P+R++ D EY
Sbjct: 189 LKPLSRSLSA--ASDTNTPIENLTVALATTLNANRTTSQLIEEIGKVRPIPTRKIEDFEY 246

Query: 232 IGTLKMLSEEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSF 291
           IG   +L++EEA++LI+ FFLTMHPFFP++P QL +P ELAQYPIL CAILT+S+RYH F
Sbjct: 247 IGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPF 306

Query: 292 DEVNMYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIH 351
           D + + NGE+  R+VE+H++LW+YCQ+LISQT+WAEASTRSIGTVLAF++FTEWNPR+IH
Sbjct: 307 DTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIH 366

Query: 352 WRWSDYANNPDLNDVSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTG 411
            +WSDYAN+P+LN+V+ R                 ++  +GLTG+ A+RRSDRM+WMLTG
Sbjct: 367 CKWSDYANDPELNNVNVRG----------GKHINTRRDEEGLTGVGAIRRSDRMSWMLTG 416

Query: 412 TAVRLAQDMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINLN----------G 461
           +AVRLAQDMGF+  SS+IF  THISET +AMNMNQRS+L++S + +NLN           
Sbjct: 417 SAVRLAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFDNDGNEN 476

Query: 462 YEDDVENESYYLGQILKSDGSKERWSKFLKKLGSSSTRGR--MNDIEREFVNDEYVLYYS 519
            E+ + NE +YL +IL +D SKERW K L+ L + S   +  + D EREF+NDEYVLYYS
Sbjct: 477 NENYLGNERFYLDEILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYS 536

Query: 520 DKDGAPAHADEYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGK 577
           +K             DD N   Q    P+ L+FSF QRAKIE++RI+SI YETIY  + K
Sbjct: 537 NK------------KDDTNL-AQNHMPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNK 583

Query: 578 LKLYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVD 637
            KL +  Q HNL++LS+ SPL+E W + Y+ +L P S    + A    K+ +    ++++
Sbjct: 584 RKLATTDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSDVPFSLADRKNKRQVLNNIDRIN 643

Query: 638 RESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIR 697
            ES+I+D+ YCQLYI+SLALQVD    K  +L M+EI K A+YVELAY +AKEIL+SA R
Sbjct: 644 GESIITDFNYCQLYIFSLALQVD---GKISRLNMSEIVKSAKYVELAYKSAKEILSSAKR 700

Query: 698 VHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQT 757
           V +  MLKYMPVRWV RI+RS+AF+VKCYLTLTGS IATNP+A  IL LS I  +E    
Sbjct: 701 VSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSEIATNPDARNILKLSAISVDETFDL 760

Query: 758 IQRAAITLREASPDELHLCTRYSTILMYLCTEMKLRSRPN-PQPPVPR-------SISEQ 809
           I+  A+TL+EA+PDELHLC RY+ ILMYLCTEMKLR + +  +PP  R       S  E 
Sbjct: 761 IRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSHLERPPTSRTGIAPLKSSDES 820

Query: 810 PEQIS----------------VETTFNFCGKNETHEKGQGSQQRGPLP-PPRMNSLPETT 852
           P + +                 E  F+  GK    E          LP    +NS  E T
Sbjct: 821 PLEGANLVKGPTFDKTAGTSNAECIFDPVGKTSAEETSNNLNNSTELPFKTGLNSFVEQT 880

Query: 853 NFAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFI--SNDNNKT 910
           N    +    + +  Q   L  +V DWFS S++IGL+FVEPWTE+IEQ+++   + +N  
Sbjct: 881 NDITAM--LLNNELIQGPSLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNN 938

Query: 911 FENLYN-----QATGLDFQTSQP 928
           FENLYN       T +D  +S+P
Sbjct: 939 FENLYNLFANSNDTDIDTDSSRP 961

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/970 (47%), Positives = 621/970 (64%), Gaps = 98/970 (10%)

Query: 5   KRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTES 64
           KR   E +  + PK RRTYQAC+NCR+RKVKCDLGPVDNPH PPC RCKRE K+C F  S
Sbjct: 4   KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF--S 61

Query: 65  NKRGGLRVANVSAIAENTANATASMSKA-----------ITSVFQGNTSEGSQQPDFKRE 113
           + RG     + + I   TA +   +SK+           IT+    +  E   +  FK E
Sbjct: 62  STRGETNGTSPNMI---TAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSE 118

Query: 114 NSIDPLPINSELTTMQDALEFLAKAAGSVAKEDSRDLVDASTK-----YEELESQSNSRT 168
                +    EL++MQ+ALEFLA+AAG+VAKE ++++++  +       + L++   S T
Sbjct: 119 G----VKWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSAT 174

Query: 169 DTPISSGSAQDSTRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTD 228
           D  +   S  DS   +++   P E   A L       R T  LI ++S VRP P+R++ D
Sbjct: 175 DGGLKRLSRGDSA--ASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIED 232

Query: 229 IEYIGTLKMLSEEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRY 288
            +YIG   +L++EEA++LI+ FFLTMHPFFP++PLQL +P ELA+YPIL CAILT+S+RY
Sbjct: 233 FDYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARY 292

Query: 289 HSFDEVNMYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPR 348
           H FD + +YNGE+  R++E+H++LW+YCQ+LISQT+WAEASTRSIGTVLAF++FTEWNPR
Sbjct: 293 HRFDTLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPR 352

Query: 349 AIHWRWSDYANNPDLNDVSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWM 408
           +IH++WSDYAN+P+LN+V+ R                 ++  +GLTG+ A+RRSDRM+WM
Sbjct: 353 SIHYKWSDYANDPELNNVNVRG----------SKNICTRKDEEGLTGVGAIRRSDRMSWM 402

Query: 409 LTGTAVRLAQDMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINLN-------G 461
           LTG+AVRLAQDMGF+  SSKIF  THISET +AMNMNQRS+L++S + +NLN       G
Sbjct: 403 LTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDG 462

Query: 462 YEDD---VENESYYLGQILKSDGSKERWSKFLKKLGSSSTRGR--MNDIEREFVNDEYVL 516
            E++     NE +YL +IL +D  K+RW    +    +S   +  + D EREF+NDEYVL
Sbjct: 463 KENNENYFGNEKFYLDEILPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVL 522

Query: 517 YYSDKDGAPAHADEYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY-- 574
           YYS+K            NDD N   Q    P+ L+FSF QRAKIE++RI+SI YETIY  
Sbjct: 523 YYSNK------------NDDTNLA-QNHTPPFPLRFSFAQRAKIEIIRILSIAYETIYCE 569

Query: 575 RGKLKLYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTE 634
           + K KL +  Q HNL++LSI SPL+E W + Y+ +L P S    + A    KK +F+  +
Sbjct: 570 KNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVPLSDVPFSLADRKNKKQVFDNID 629

Query: 635 KVDRESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNS 694
           +++ ES+I+D+ YCQLYI+SLALQVD    K  +L MNEI   ARYVELAY +AKEIL S
Sbjct: 630 RINGESIITDFNYCQLYIFSLALQVD---GKISRLNMNEIVTSARYVELAYRSAKEILGS 686

Query: 695 AIRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEI 754
           A RV +  MLK+MPVRWV RI+RS+AF+VKCYLTLTGS +ATNP+A  IL LS I  +E 
Sbjct: 687 AKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDET 746

Query: 755 IQTIQRAAITLREASPDELHLCTRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQP---- 810
              ++  A+TL+EA+PDELHLC RY+ ILMYLCTEMKLR   + + P     S  P    
Sbjct: 747 FDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKSSHLERPSLLRSSTTPLESN 806

Query: 811 -----EQISV---ETTFNFCGKNETHEKGQGSQQRGPLPPPRM-NSLPETTNFAFN-VDN 860
                E + V    T +   G N+T  K +  ++   LP   + ++L  + + +   + N
Sbjct: 807 HGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEK---LPVDEIGDNLNNSNDLSGKAIVN 863

Query: 861 FFSPQGA------------QTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFI--SND 906
            F  Q              Q   L  +V DWF  S++IGL+FVEPWTE+IEQ+++   + 
Sbjct: 864 SFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDG 923

Query: 907 NNKTFENLYN 916
           +N  FENLYN
Sbjct: 924 DNNNFENLYN 933

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/959 (47%), Positives = 617/959 (64%), Gaps = 104/959 (10%)

Query: 17  PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVS 76
           PK RRTYQAC++CR+RKVKCDLGPVDNPHDPPC RCKRE K+CIF+ SNK         +
Sbjct: 16  PKRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIFS-SNK------GTSN 68

Query: 77  AIAENTANATA--SMSKAITSVFQGNTS----------EG-SQQPDFKRENSIDPLPINS 123
            +  N+ NA +  S+ K+   +   +TS          +G S +  FK E     +    
Sbjct: 69  DLPPNSINAISLPSLGKSKQEIQNDSTSPILSDVPLSRKGISSEKSFKSEG----MKWKL 124

Query: 124 ELTTMQDALEFLAKAAGSVAKEDSRDLV-DASTKYEELESQSNSRTDTPISSGSAQDSTR 182
           EL++MQ+ALEFLA+AAG+VAKE +++++ + ST  + L+S  ++   +    G  + S  
Sbjct: 125 ELSSMQNALEFLAQAAGTVAKEGAKEIIKEKSTTPKPLKSSLDATNKSATDEGLKRLS-- 182

Query: 183 NSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEE 242
            S+S N   E     L       R T  L+E++  VRP P+R++ D +YIG   +L++EE
Sbjct: 183 KSDSTNTLYENTADMLNHTLNTNRKTSQLMEEIGKVRPPPTRKIDDFDYIGPDSLLTKEE 242

Query: 243 AVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESN 302
           A++LI+ FFLTMHPFFP++PLQL +P ELA+YPIL CAILT+S+RYH FD + + NGE  
Sbjct: 243 AIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHPFDTLGLDNGEDG 302

Query: 303 NRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPD 362
            R++E+H++LW+YCQ+LISQT+WAEASTRSIGTVLAF++FTEWNPR+IH++WSDYAN+P+
Sbjct: 303 MRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPE 362

Query: 363 LNDVSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGF 422
           LN+V+ R                 ++  +GLTG+ A+RRSDRM+WMLTG+AVRLAQDMGF
Sbjct: 363 LNNVNARG----------SKNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGF 412

Query: 423 MNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINLN----------GYEDDVENESYY 472
           +  SSK+F  THISET +AMNMNQRS+L++S + +NLN            ED + NE +Y
Sbjct: 413 IENSSKVFIVTHISETTSAMNMNQRSLLAESFSVLNLNLGKIENDGNESNEDYLGNEKFY 472

Query: 473 LGQILKSDGSKERWSKFLKKLGS--SSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADE 530
           L +IL  + SK RW +  +   +   + +  + D EREF+NDEYVLYYS+K         
Sbjct: 473 LNEILPDEESKLRWKRVFENSENDHDNEKNFLTDWEREFLNDEYVLYYSNK--------- 523

Query: 531 YTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKLKLYSNSQYHN 588
               DD N   Q    P+ L+FSF QRAKIE++RI+SI YETIY  + K KL +  Q HN
Sbjct: 524 ---KDDTNL-AQNHIPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHN 579

Query: 589 LALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYC 648
           L++LS+ SPLIE W + Y+ +L P S    + A    KK IF+  ++++ ES+I+D+ YC
Sbjct: 580 LSVLSVFSPLIEGWLSNYRELLVPLSDVPFSLADRKNKKQIFDNIDRINGESIITDFNYC 639

Query: 649 QLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMP 708
           QLYI+SLALQVD    K  +L MNEI   ARYVELAY +AKEIL+SA RV +  MLKYMP
Sbjct: 640 QLYIFSLALQVD---GKTSRLNMNEIVTSARYVELAYRSAKEILSSAKRVSRQGMLKYMP 696

Query: 709 VRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREA 768
           VRWV RI+RS+AF+VKCYLTLTGS +ATNP+A  IL LS I  +E    I+  A+TL+EA
Sbjct: 697 VRWVIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEA 756

Query: 769 SPDELHLCTRYSTILMYLCTEMKLRSRPN-PQPPVPR-----------------SISEQP 810
           +PDELHLC RY+ ILMYLCTEMKLR +    +PP+ R                  ++++P
Sbjct: 757 TPDELHLCQRYAAILMYLCTEMKLRKKSYLERPPLLRDGTTPLESNRESSLEGQDLTKKP 816

Query: 811 ---EQIS---VETTFNFCGKNETHEKGQGSQQRGP-----LPPPRMNSLPETTNFAFNVD 859
              ++I     ETTF    +  T E    SQ         +  P +    + T    N +
Sbjct: 817 IFSKRIGYNKTETTFEPSERPLTEEINSNSQNSNDTSSKGIVDPFVEQNNDITTALLNNE 876

Query: 860 NFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFI--SNDNNKTFENLYN 916
            F  P       L  +V DWF  S++IGL+FVEPWTE+IEQ+++   + +N  FENLYN
Sbjct: 877 LFQGPS------LSDEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYN 929

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/952 (46%), Positives = 598/952 (62%), Gaps = 91/952 (9%)

Query: 17  PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNK-RGGLRVANV 75
           PK RRTYQAC+NCR+RKVKCDLGPVDNPH+PPC RCKRE +EC+F+     +       V
Sbjct: 16  PKRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECLFSSQKVVKNSTSPHMV 75

Query: 76  SAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEFL 135
           + I ++         + I+S    +    + +  FK     D +    EL++MQ+ALEFL
Sbjct: 76  NTICQSKGEIPNHSRRLISSEMALSEKGTNDETLFKS----DGVKWKLELSSMQNALEFL 131

Query: 136 AKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQD------STRNSNSANI 189
           A+AAG+VAKE +++ +   +        S S  DTP  S + ++      S  ++++ N 
Sbjct: 132 AQAAGTVAKEGAKETIKDRSATPR---PSESSLDTPHQSAANKELKTLSISECDASATNT 188

Query: 190 PDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDL 249
           P E     L       +    LI+++S  RP P+RR+ D EYIG   +L++EEA++LI+ 
Sbjct: 189 PHENITDTLAAALNSNQKMSQLIKEISRARPMPTRRIDDFEYIGPDNLLTKEEAIELIEA 248

Query: 250 FFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIH 309
           FFLTMHPFFP++PLQL +P ELA+YPIL C+ILT+S+RYH FD + + NGE+  R++E+H
Sbjct: 249 FFLTMHPFFPNIPLQLHDPKELAEYPILFCSILTVSARYHPFDTLGLDNGENGIRHIEVH 308

Query: 310 ERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSKR 369
           ++LWIYCQ+LISQT+WAEASTRSIGTVLAF++FTEWNPR+IH++WSDYAN+P+LN+V  R
Sbjct: 309 DKLWIYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVGVR 368

Query: 370 DLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKI 429
           +                ++  +GLTG+ A+RRSDRM+WMLTG+AVRLAQDMGF+  SSKI
Sbjct: 369 E----------SKNISTKKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKI 418

Query: 430 FTATHISETHTAMNMNQRSILSQSLAEINLN----------GYEDDVENESYYLGQILKS 479
           F  THISET +AMNMNQR +L++S + +NLN          G E+ + NE +YL +IL  
Sbjct: 419 FIVTHISETTSAMNMNQRPLLAESFSVLNLNVRKFDDDGNKGNENYLGNEKFYLNEILPD 478

Query: 480 DGSKERWSKFLKKLGSSSTRGR--MNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDK 537
           D SK+RW K  K         +  + D EREF+NDEYVLYYS+K             DD 
Sbjct: 479 DESKKRWKKVFKDSEDDDDSEKNILTDWEREFLNDEYVLYYSNK------------KDDT 526

Query: 538 NRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKLKLYSNSQYHNLALLSIL 595
           N   Q    P  L+FSF QRAKIE++RI+SI YETIY  + K KL +  Q HNL++LS+ 
Sbjct: 527 NL-AQNPMPPSPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVF 585

Query: 596 SPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSL 655
           SPLIE W + Y+ +L P S  +   A    KK +F+   +++ E++I+D+ YCQLYI+SL
Sbjct: 586 SPLIEGWLSNYREVLVPISDVSFLLADRKNKKQVFDNINRLNGETIITDFNYCQLYIFSL 645

Query: 656 ALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRI 715
           ALQVD    K  +L MNEI   ARYVELAY +AKEIL+SA RV +  MLKYMPVRW  RI
Sbjct: 646 ALQVD---GKTSRLNMNEIMTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWAIRI 702

Query: 716 VRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHL 775
           +RS+AF+VKCYLTLTGS +ATNP+A  IL LS I  +E    I+  A+TL+EA+PDELHL
Sbjct: 703 IRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHL 762

Query: 776 CTRYSTILMYLCTEMKLRS-----RP----NPQPPVPRSISEQPEQISV--ETTFNFCGK 824
           C RY+ ILMYLCTEMKLR      RP    N   P+  +    PE +    + TF    +
Sbjct: 763 CQRYAAILMYLCTEMKLRKKSYTERPPLSTNGTTPLESNCESSPEGVDFTKKPTFPKNIR 822

Query: 825 NETHEKGQGSQQRGPLPP------------------PRMNSLPETTNFAFNVDNFFSPQG 866
           +   E    S ++ P+                    P +    +TT    N + F  P  
Sbjct: 823 SNKAECNSESSKKSPMEEIDSNLNNPNNLSSKVIFNPFVEQNNDTTTTLLNNELFQGPS- 881

Query: 867 AQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFI--SNDNNKTFENLYN 916
                L  +V DWF  S++IGL FVEPWTE+IEQ+++   + +   FENLYN
Sbjct: 882 -----LSEEVTDWFGASEDIGLGFVEPWTELIEQRYMQCGDGDINNFENLYN 928

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/941 (46%), Positives = 598/941 (63%), Gaps = 75/941 (7%)

Query: 1   MNNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECI 60
           M+  KR L E    Q  KWRR+Y+AC+NCR+RK+KCDLGP+DNPH PPCVRCKRE++ECI
Sbjct: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60

Query: 61  FTESNKRG-GLRVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPL 119
           F  + +R    ++ N+       +  ++ +         G  S GS   D K +N+I   
Sbjct: 61  FPVTKRRDVTAKINNMKGSELERSIISSILPDVDKKSLNGGGSAGS---DLK-QNNIRKK 116

Query: 120 PINS----ELTTMQDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSG 175
           P +S    +++TMQ ALEFLA A G ++K D+R L++ +     +E++     D+  ++ 
Sbjct: 117 PTDSNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIENED--ADDSNPNND 174

Query: 176 SAQDSTRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTL 235
           +++D +R S+S        I  L+      +   PL+  + S+RPKP+R L+DIEYIG  
Sbjct: 175 NSEDVSR-SDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPN 233

Query: 236 KMLSEEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVN 295
           K+L+E+EA  LI++FFLTMHP+FP++PLQL NPDEL +YPILLCAILT+SSRY+SF+E+ 
Sbjct: 234 KLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIF 293

Query: 296 MYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWS 355
           + N    +RN+ +HE+LW YCQRLIS T+WAEASTRSIGT+LAFLLFTEWNPRAIHW WS
Sbjct: 294 INNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWS 353

Query: 356 DYANNPDLNDVSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVR 415
           DY NNP+L   +K +                +  G+  TG  AMR SDRMAWM TG+AVR
Sbjct: 354 DYGNNPELTCFTKNN-----------ENNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVR 402

Query: 416 LAQDMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINL-----NGYEDDVE--- 467
           LAQDM F++ + KIF ATHISET  AMN+NQRS LS SL+ INL     +G  +D E   
Sbjct: 403 LAQDMHFIDNNYKIFMATHISETFNAMNVNQRSTLSDSLSNINLSITRSHGKNNDDEEGH 462

Query: 468 -------NESYYLGQILKSDGSKERWSKFLKKLG---SSSTRGRMNDIEREFVNDEYVLY 517
                  NE YYL QILK D SKE+W KFLK++    SS     + D ERE++NDEY+LY
Sbjct: 463 IFAENFGNEQYYLEQILKHDKSKEKWIKFLKEINSNKSSENSTVITDAEREYLNDEYILY 522

Query: 518 YSDKDGAPAHADEYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIYRGK 577
           Y + +         T     N        PY LKF+   +AKIE+LRIMSI YETIY  K
Sbjct: 523 YQNNNPE-------TQPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAK 575

Query: 578 LK--LYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEK 635
            K  L  N+Q  NLA+LSI SPLIESWY+ +  +LK    A C+ +   +K  + +L++ 
Sbjct: 576 NKRVLAFNNQRQNLAVLSIFSPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQA 635

Query: 636 VDRESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSA 695
           +++ESLI DYYYCQLYIYSLAL+VD+   KD  L ++EITK A+YV +AYNAAKEIL SA
Sbjct: 636 IEKESLIGDYYYCQLYIYSLALKVDI---KDNNLNLSEITKSAKYVYMAYNAAKEILTSA 692

Query: 696 IRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEII 755
           +RV+KLK+L+Y+PVRWVTRI+RSVAF+VKC+L LT S  + N E N I+ LS IP +E +
Sbjct: 693 VRVNKLKLLRYLPVRWVTRILRSVAFIVKCFLLLTESETSENSEINAIIRLSGIPVDEAL 752

Query: 756 QTIQRAAITLREASPDELHLCTRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISV 815
           + I+  ++TL +ASPDELHLC RYS+IL+Y+C E++ +++      +   ++ + E   V
Sbjct: 753 ELIETTSVTLNDASPDELHLCKRYSSILLYMCKELRNKTQ---NLYMNEGVAAKQENADV 809

Query: 816 ETTFNFCGKNETHEKGQGSQQRGPLPPPRMNSLPETTNFAFNVDNFFSPQGAQTHHLPT- 874
           +      G             + P+ P  MN  P+ T    N     +  G + H +   
Sbjct: 810 KV-----GNKSLENLSSIENSQEPIEPFIMNEHPQ-TELPINTTEQIAIVGNEHHGIEQT 863

Query: 875 ------------QVVDWFSTSDEIGLDFVEPWTEMIEQQFI 903
                       +V+DWFS+S +IGL+FVE WTEMIEQ ++
Sbjct: 864 PILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQMYL 904

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/955 (45%), Positives = 574/955 (60%), Gaps = 91/955 (9%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTE------------SN 65
           KWRR Y+ACLNCRTRKV+CDLGPVD P +PPCVRC RERKECIFTE             N
Sbjct: 24  KWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFTELRRGRNRRIRVAKN 83

Query: 66  KR-------GGLRVANVSAIAENTANATASMSKAITSVFQGNT----SEGSQQPDFKREN 114
            R       GG+ VAN      + ++AT   S   T++  G+     S  ++  D +  N
Sbjct: 84  DRAGHAEPDGGICVANAHG---DPSSATGRFSGEPTALSAGSDPSPDSASNRGRDDQSSN 140

Query: 115 SIDP-------LPINSELTTMQDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSR 167
           S +P       L ++SE TT+ + LEFL KAAGSVAK++ R L  ++   +   +   S 
Sbjct: 141 SDEPEFSERPELSLSSEFTTLHNTLEFLTKAAGSVAKDNGRLLSSSTAVGKHSAAICESI 200

Query: 168 T---DTPISSGS-AQDSTRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPS 223
           T     P+ +G  A   +   N   I D+A  +             P  E  S+  P   
Sbjct: 201 TLQLYNPLHNGQYASVVSGPRNPEAITDQAAAS-----------RTPQEEPESTKYPL-- 247

Query: 224 RRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILT 283
             L +IEY+G    L+ EE ++L +LFF+T +PFFPH+PL +Q+P+ELA+YPILLC +L+
Sbjct: 248 --LRNIEYVGPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELARYPILLCGVLS 305

Query: 284 ISSRYHSFDEVNMYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFT 343
           IS+RYH F+++ + N  S  RN+++HE LW YCQ++ISQTVW EASTRSIGTVL FL+FT
Sbjct: 306 ISARYHKFEDIGLSNRGSPTRNIDVHEYLWRYCQQMISQTVWTEASTRSIGTVLVFLIFT 365

Query: 344 EWNPRAIHWRWSDYANNPDLNDVSKRDLXXXXXXXXXXXXXXXQQHG--------DGLTG 395
           EWNPRAIH + +DYAN  D  +  +                  +++G         G +G
Sbjct: 366 EWNPRAIHRKCNDYANATDRQN-EQSHSEKANTAHCGSGIPATERNGPRRFVLADQGSSG 424

Query: 396 LSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLA 455
           LSAMRRS RMAWML G AVRLAQDM F+NTSSKIF ATH SET+ AMNM Q S LS SL 
Sbjct: 425 LSAMRRSKRMAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQNSTLSHSLM 484

Query: 456 EINLNGYEDDVENESYYLGQILKSDGSKERWSKFLKKLGSSSTRGR-MNDIEREFVNDEY 514
             N+ G E      S  +        ++ER+   L++LG    RGR ++ +  EF+ DE 
Sbjct: 485 NANIIGSES-----STAISNPPMPSETEERYKSVLQRLGKHVPRGRGLSQLYNEFLEDER 539

Query: 515 VLYYSDKDGAPAHADEYTMNDDKNRKKQIEEEPY----------NLKFSFGQRAKIELLR 564
           +LY     G   + + Y  + D+ +     E  Y           +  SF QRAKIELLR
Sbjct: 540 ILY--GLGGGSEYVEAYCDSLDQTKNNVSIETAYESSLLERGGQQVFLSFAQRAKIELLR 597

Query: 565 IMSIGYETIYRGKLKLYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCS 624
           IMS+GYETIY    KL    ++H L++L +LSP IE+WY  Y ++L P  GA  N     
Sbjct: 598 IMSVGYETIYSNHAKLVLREKHHILSVLGLLSPQIENWYTQYNSLLVPAGGAPFNPTADF 657

Query: 625 EKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVDVGTPKDKKLR-MNEITKCARYVEL 683
            +    +L  ++D ES+I DYYYCQLYIYSLAL VD   P+      ++ + K ARYVEL
Sbjct: 658 SRINPLDLVRRIDAESIICDYYYCQLYIYSLALTVDFRKPRHPNASWLDRLMKSARYVEL 717

Query: 684 AYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTI 743
           AYNAA+E+L SAIRVH+++MLKYMP RWV RIV +VAF+VKCYLT+     A++ EA+ I
Sbjct: 718 AYNAAREVLRSAIRVHRIRMLKYMPTRWVERIVGAVAFIVKCYLTMAAHLTASH-EASAI 776

Query: 744 LTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYSTILMYLCTEMKLRSRPNPQPPVP 803
           LTLS IP +E++ TIQRAAITLREASPD++HLC +YSTILMYLC+EMKLR+ P P PP+P
Sbjct: 777 LTLSAIPPDEVVNTIQRAAITLREASPDDVHLCNKYSTILMYLCSEMKLRNWPTPTPPLP 836

Query: 804 RSISEQPEQISV-ETTFNFCGK--NETHEKGQGSQQRGPLPPPRMNSLPETTNFAFNVDN 860
           RS+S +P ++ V E +     +  +  H   +     G  PPP    LP+ T  A + D 
Sbjct: 837 RSVSGEPIRVPVFECSATPAARIFSPPHHPAESQTTGGTDPPP----LPDHTLAAPSSD- 891

Query: 861 FFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFISNDNNKTFENLY 915
                   T HLP +++DW  TSDEIGLDFVEPWT++IE+   S  +N    +LY
Sbjct: 892 --PAPFDTTSHLPWELIDWLHTSDEIGLDFVEPWTDVIERLMESGPDNIDTNSLY 944

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/924 (43%), Positives = 581/924 (62%), Gaps = 109/924 (11%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTE-SNKRGGLRVANVS 76
           KW+R+++AC  CR RK+KC+LGP+DNPH PPC RCKRE++ECIF E S K   L   +++
Sbjct: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDIN 71

Query: 77  AIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEFLA 136
              +   N    +       +Q   ++G+   + +   +++     S++++MQ+ALE+LA
Sbjct: 72  YGDDGDDNKLKFIH------YQQGDNKGANNKEIQNM-ALEDSAWESDVSSMQNALEYLA 124

Query: 137 KAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIA 196
            AA SV++ ++               +  S+    ++S S  D T+         E  I 
Sbjct: 125 SAAKSVSQFENH--------------KPTSKLSDMVNSYSKDDMTQ---------ENIIK 161

Query: 197 PLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHP 256
            L     L  P   LI +LS +R KP ++L+DI YIG  K+L+EEEA +LI++FF  +HP
Sbjct: 162 ELFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHP 221

Query: 257 FFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIHERLWIYC 316
           FFP++PLQL NP++L +YPILLCA++TIS+RY++F ++++   ES + N+ IHE+LW+YC
Sbjct: 222 FFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYC 281

Query: 317 QRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPD---LNDVSKRDLXX 373
           QRLIS+T+WAEASTRSIGT+LAFLLFTEWNPRAIHW WSDYAN+ +    N++++ D   
Sbjct: 282 QRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFD--- 338

Query: 374 XXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKIFTAT 433
                           G+ +TG  AMR SDRMAWMLTG+AVRLAQDM F++TS+KIF AT
Sbjct: 339 ----------PINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLAT 388

Query: 434 HISETHTAMNMNQRSILSQSLAEINLNGYEDD-------------VENESYYLGQILKSD 480
           HI+ET+ AMN+N RS LS+SL+ +N++  + D               NE YYL QI K+ 
Sbjct: 389 HIAETYNAMNVNLRSSLSESLSNVNIHSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKNA 448

Query: 481 GSKERWSKFLKKLGSSSTRGRMN-----DIEREFVNDEYVLYYSDKDGAPAHADEYTMND 535
             +E     L+ +     R R N     D ER+F+NDEY+L+YS+ D A       T ND
Sbjct: 449 KDRESSYDLLENI----LRERRNAKAFPDNERDFLNDEYILFYSNPDDA-------TQND 497

Query: 536 DKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIYRGKLKLY--SNSQYHNLALLS 593
           + +           L F+  QRAKIELL+IMSIGYETIY  K + Y  +N+Q  NLA+L+
Sbjct: 498 ELDTP---------LDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLN 548

Query: 594 ILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIY 653
           I S LI+SWY  Y  +L P      +  + + K  +  +T+ ++ ESLI DYYYCQLYIY
Sbjct: 549 IFSALIDSWYVNYNELLSP--EETLDPVLNASKMGLQSMTQIIENESLICDYYYCQLYIY 606

Query: 654 SLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVT 713
           SL+LQV+    ++ KL++ E+++ A+YV +AY++AKEILNSA R+ +++MLK++PVRWV 
Sbjct: 607 SLSLQVE---DEESKLKLKELSQSAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVI 663

Query: 714 RIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDEL 773
           RIVR+++F+VKCY+T T        E N++L+LS IP +E ++ I  AA+ L+E++PDEL
Sbjct: 664 RIVRAISFIVKCYVTATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDEL 723

Query: 774 HLCTRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNE-THEKGQ 832
           HLCTRYS IL+ L  E+K+ +    Q     S+   PE+++ +TT     + E T     
Sbjct: 724 HLCTRYSKILLCLYRELKMDTLSTQQAHGNDSM---PERLTADTTLENAIRTEFTTTSNS 780

Query: 833 GSQQRGPLPPPRMNSLPETTNFAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVE 892
           GSQ        ++ +LP        +D   +P  A     PT+VVDWFSTS +IGL+FVE
Sbjct: 781 GSQVELTPLSNKLATLP--------IDRNTTPPYAS---FPTEVVDWFSTSADIGLEFVE 829

Query: 893 PWTEMIEQQFISNDN--NKTFENL 914
           PWTEMIEQ++I + N  NK F++L
Sbjct: 830 PWTEMIEQRYIKSGNTQNKDFDDL 853

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/963 (41%), Positives = 543/963 (56%), Gaps = 117/963 (12%)

Query: 19  WRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT-ESNKRGGLRVANVSA 77
           W R ++AC NCR +KV+CD GP DNPH PPC RCKRE K C FT ++ K   +     + 
Sbjct: 19  WIRGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTAKTGKEQDMVTGEATN 78

Query: 78  IAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDP-LPINSELTTMQDALEFLA 136
                       ++          S G  Q   +  N  +P      ELT+M + L FLA
Sbjct: 79  GIPTVDTVPVKKNELALPALAVTVSPGLIQNRSEMGNEANPNTGWKLELTSMHNTLAFLA 138

Query: 137 KAAGSVAKEDSRDLV------DASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIP 190
           +AAG+V+   ++ L+      D ST   E+ S+  S+T T  +S        N      P
Sbjct: 139 QAAGTVSNTLNKGLMKKTLPSDRSTPSLEI-SRLGSKTPTGFASSLGLGMPSN------P 191

Query: 191 DEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLF 250
            +  +  +   +      + LIEK  + + K  + L DI+ IG   +LSE+EA   ID F
Sbjct: 192 TKTLLQEIETQN-----KVQLIEKSKNTKSKVPKTLKDIKCIGENGLLSEQEATAFIDAF 246

Query: 251 FLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIHE 310
           F TMHPFFP++PLQLQ+P EL +YPILLCAILTIS+RYHSF E    NG+ N RN E+HE
Sbjct: 247 FCTMHPFFPYIPLQLQDPLELLEYPILLCAILTISTRYHSFSEFGFDNGDYNKRNFEVHE 306

Query: 311 RLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSKRD 370
           +LW  CQ ++S+T+W EASTRSIGTVLAF+LFTEWNPR IHW+ SDYAN+ D        
Sbjct: 307 KLWDNCQVMLSKTIWGEASTRSIGTVLAFILFTEWNPRQIHWKKSDYANDDD-------- 358

Query: 371 LXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKIF 430
                               + LTG  A+RRSDRMAWMLTG+AVRLAQDMGFM T++K+ 
Sbjct: 359 ---------EAVSELSNDEAEELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMETNAKVC 409

Query: 431 TATHISETHTAMNMNQRSILSQSLAEI--NLNGYEDDVEN-----------ESYYLGQIL 477
            ATHIS+   +MNMNQ+ +LS +   +    N Y  D  N           E  ++ Q+L
Sbjct: 410 VATHISDAFASMNMNQKPVLSGNFNVLQGGTNNYTSDPLNSSGSSHESTCSEQAFMKQML 469

Query: 478 KSDGSKERWSKFLKKLGSSSTRGR--------MNDIEREFVNDEYVLYYSDKDGAPAHAD 529
           ++  S  RW   L  L       R        ++D+EREF+NDE++LYYS          
Sbjct: 470 ENTNSHTRWRHILSSLQMEDLFQRQRNEYSNDLSDLEREFLNDEFILYYS---------- 519

Query: 530 EYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKLKLYSNSQYH 587
                  + R    E  P+ L+FS+ Q+AKIEL  IM +GY+TIY  RG+ KL SN+Q H
Sbjct: 520 ------LERRSDNQETPPFPLQFSYAQKAKIELTNIMLLGYDTIYYDRGRKKLASNNQLH 573

Query: 588 NLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYY 647
           NL++LSILSPL+E W+N YK +L   S     T    +K+ ++EL++ +D ES+I DY Y
Sbjct: 574 NLSVLSILSPLMEGWHNVYKNLLIAPSANPYTTTTRGDKRAMYELSKNIDSESIICDYRY 633

Query: 648 CQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYM 707
            QLYIYSLALQ D    K  +L ++EIT+ A+YVE+A+NAAKEI+ SA RVHKL +LKYM
Sbjct: 634 SQLYIYSLALQADF---KRAELTVSEITQNAKYVEIAFNAAKEIIFSAFRVHKLNLLKYM 690

Query: 708 PVRWVTRIVRSVAFVVKCYLTLT----GSGIATNPEANTILTLSVIPTEEIIQTIQRAAI 763
           PVRWV R+VR+V+F+VKC L L     G G ++  E  TIL L  I  ++   TI+ AA+
Sbjct: 691 PVRWVMRLVRAVSFLVKCCLILNATSIGGGGSSEAEVRTILKLCSISVKDTANTIKMAAM 750

Query: 764 TLREASPDELHLCTRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCG 823
           TL+EA+PDELHL  RYS IL+YLC E++     + + P P + +    + ++  T+    
Sbjct: 751 TLKEATPDELHLSMRYSAILLYLCRELESEKDSSKKIPFPNNAT---TKYAISPTYEGRD 807

Query: 824 KNETHEKGQGSQQRGPLPPPRMNSLP-----ETT-------------NFAFNVD--NFFS 863
                    G      +   R+ ++P     ETT             N + N D  +  +
Sbjct: 808 GEIAAGSAGGCANTAHITANRLRTVPLSDINETTGRNTEDTANNNIVNGSLNGDRNHLGT 867

Query: 864 PQGAQ----------THHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFI-SNDNNKTFE 912
            +G            T  LP +V +WFS + EIGL+FVEPWT+MIEQ+F+ S   N  FE
Sbjct: 868 TEGTGAASQSTTDRLTGSLPDEVTNWFSGNAEIGLEFVEPWTDMIEQRFLQSGTGNDVFE 927

Query: 913 NLY 915
            LY
Sbjct: 928 ELY 930

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/816 (43%), Positives = 500/816 (61%), Gaps = 67/816 (8%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           +WRR+Y+AC+NCR +KVKCDLGP++NPH PPCVRCKRE ++CIF E  K+ G       +
Sbjct: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDS 82

Query: 78  IAEN----------TANATASMSKAITSVFQGNTSE------GSQQPDFKRENSIDPLPI 121
           I +N              T  + + I+S+   N S        SQ+ + K + S     +
Sbjct: 83  IDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKPSERKSNL 142

Query: 122 NSELTTMQDALEFLAKAAGSVAKEDSRDLVDA-STKYEELESQSNSRTDTPISSGSAQDS 180
               T M++ALEFLA AAG  A+E   +  +  + K+E+  +  +   D+P +  +   S
Sbjct: 143 KVNFTNMRNALEFLANAAGQAAEERLSEEEEELNNKFEKELNDDHISIDSPATQSTT--S 200

Query: 181 TRNSNSANIPDEACIAPLLRPHGLGRPTI-PLIEKLSSVRPKPSRRLTDIEYIGTLKMLS 239
           T +    ++ DE+  +  L  +   R  +  LIE + + RP  +R+LTD +YIG  KM+S
Sbjct: 201 TDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTDYDYIGKSKMIS 260

Query: 240 EEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNG 299
           E EA++LI+ FFLTMHPF+P++P QLQ+P ELA+YPILLC ILTISSR+H F+E+  YNG
Sbjct: 261 EFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRHHKFNELGTYNG 320

Query: 300 ESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYAN 359
            ++ R++++HE+LW+YCQ++ISQTVWAEASTRS+GTVLAFLLFTEWNPRAIHW+W+DYAN
Sbjct: 321 VNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWNPRAIHWKWADYAN 380

Query: 360 NPDLNDVSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQD 419
           NP LND S  D                   G   TGL A+RRSDRMAWML GT+VR+AQD
Sbjct: 381 NPKLNDFSTSDTGINDYLKV----------GKRTTGLGAIRRSDRMAWMLCGTSVRIAQD 430

Query: 420 MGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINL---------NGYEDDVENES 470
           MGF+  SS +F ATH SET  AMN+ QRS L++SL +            N  +  ++NE 
Sbjct: 431 MGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQTLKNEI 490

Query: 471 YYLGQILKSD---GSKERWSKFLKKLGSSST----RGRMNDIEREFVNDEYVLYYSDKDG 523
           +Y+  I   +     +  W   L++   +      +  ++D  R F+NDE+ L+YS+   
Sbjct: 491 FYIENIFSENFKITERNYWKSQLQENIENKIDIDDKIALSDKVRGFLNDEFALFYSN--- 547

Query: 524 APAHADEYTMNDDKNRK--KQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKLK 579
                ++ T ++++N +        P  +  S  Q+A IELLRI S  Y+TIY      K
Sbjct: 548 ----GNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRNQNQK 603

Query: 580 LYSNSQYHNLALLSILSPLIESWYNTYKTILKP---CSGAACNTAMCSEKKYIFELTEKV 636
           L SN+Q HN++LL I +PL+ +W   +  +L+P   C     N    + K+ + E  + +
Sbjct: 604 LSSNNQSHNISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLNNR--NNKRVVKEFNKII 661

Query: 637 DRESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAI 696
           + ESLI DY YCQLYI+SLALQ+ +     + L +NEITK + Y+ LAY +AKE + S  
Sbjct: 662 EGESLICDYNYCQLYIFSLALQIGLD---GEILTVNEITKSSTYINLAYQSAKEYILSTE 718

Query: 697 RVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATN--PEANTILTLSVIPTEEI 754
           RV  LKMLKYMPVRW+TR++R+ AF+VKCYL++ G+    N   E N I  L      E+
Sbjct: 719 RVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEV 778

Query: 755 IQTIQRAAITLREASPDELHLCTRYSTILMYLCTEM 790
           ++ I+++AI L  +SPDELHLC+RYS+I+M    EM
Sbjct: 779 LELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 33/48 (68%)

Query: 866  GAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFISNDNNKTFEN 913
            G  T     + +DWFS S +IGL+FVE WTEM+EQ+++ +D+N  F N
Sbjct: 971  GEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNLLFNN 1018

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/961 (39%), Positives = 543/961 (56%), Gaps = 123/961 (12%)

Query: 15  QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF----TESNKRGGL 70
           Q  K + T+ ACL C+ +K+KCDLGP D P  PPC  C+R R  C F     +  K G +
Sbjct: 27  QGQKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNI 86

Query: 71  RVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQ----------PDFKRENSIDPLP 120
             +     +++T+  +ASM  AIT   Q + +    Q             K +N ++ + 
Sbjct: 87  LDSQGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQN-LEGVS 145

Query: 121 INS--------------------ELTTMQDALEFLAKAAGSVAKEDSRDLVDASTKYEEL 160
           +NS                    ELT+MQ ALEFLAKA   +  +   +    ST+ +  
Sbjct: 146 LNSPNTALIEACDRVKSDTAWKLELTSMQSALEFLAKAT-KLRNDYKNNEPFGSTRSDAA 204

Query: 161 ESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRP 220
            + S +R  +   +G+  DST NS S +                 R + P IE +    P
Sbjct: 205 STTSETRDLSEKDNGNESDSTTNSTSKDTS--------------TRSSYPSIEAIKPEVP 250

Query: 221 KPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCA 280
            PS    D+  +G  K+++ +EA  L+++FF  MHPF+P++PL LQ+ DEL +YP+LL  
Sbjct: 251 TPSNHNYDL--LGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHC 308

Query: 281 ILTISSRYHSFDEVNMYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFL 340
           IL IS+RY+ FD+V   NG   NRNV IH +LW +CQ+L+SQTVW++ASTRSIGT LAFL
Sbjct: 309 ILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFL 368

Query: 341 LFTEWNPRAIHWRWSDYANNPDLNDVSKRDLXXXXXXXXXXXXXXXQQHGDGLTGLSAMR 400
           LFTEWNPRAIHW  SD A+    N+VS                   ++  DGL G++ ++
Sbjct: 369 LFTEWNPRAIHWEVSDTAHYLSDNNVS-----------------SSKEDPDGLGGIATVK 411

Query: 401 RSDRMAWMLTGTAVRLAQDMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEIN-- 458
           RSDRMAWM TGTA+RLAQ+M  +  ++KI+TA +I+E   A NMN +  L +SL  I+  
Sbjct: 412 RSDRMAWMFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGG 471

Query: 459 LNGYE-------DDVENESY--YLGQILKSDGSKERWSKFLKKLGSSSTRGR----MNDI 505
           +  +E       DD+ENE    ++  + ++  S ++W+  + K  S   +      + D+
Sbjct: 472 MKEFEIDNPKSQDDIENEDLLKFVQLVAQNKESTKKWA--IHKAYSDKLKEENPDLIIDL 529

Query: 506 EREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRI 565
           E EF+NDEY + Y D++ +                    + P  + ++  Q+A++ELLRI
Sbjct: 530 ETEFLNDEYSINYLDENSS------------------FLKNP--IPYTTYQKAQLELLRI 569

Query: 566 MSIGYETIYRGKLK--LYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAACNTAMC 623
           ++I Y+TIY  K+K  + S  Q  NL +L +LSP++ +WY  Y  ++KP S       + 
Sbjct: 570 VTITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKP-VIIS 628

Query: 624 SEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVEL 683
            +    F+ T  +  ES ISDYYYCQLY +SLALQV+V   K+ KL +NE+ K AR+VE 
Sbjct: 629 LDDLSKFKRTANIRGESFISDYYYCQLYTFSLALQVEV---KESKLTLNEMIKSARFVEQ 685

Query: 684 AYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTI 743
           AY AAKEIL SAIRVHK+ MLKYMPVRWV RIVRS +F+VKCY+TL    +ATN EA +I
Sbjct: 686 AYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSI 745

Query: 744 LTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYSTILMYLCTEMKLRSRPNPQPPVP 803
           L LS I  ++ +  I++AA+ L+E++PDELHL +++STILM+LC E+  R R N      
Sbjct: 746 LKLSGILVDDTVHMIRQAAVILKESTPDELHLASKFSTILMFLCKEIDERKRDNENLMTG 805

Query: 804 RSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPLPPPRMNSLPETT-----NFAFNV 858
             ++  P  +  +TT     +   H+      Q    PP   +S  +TT     N    V
Sbjct: 806 NGLNNDP-SLESQTTHKESLEASNHDTISSDAQE---PPSENDSSHDTTTQGTANSTRKV 861

Query: 859 D-NFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFISN-DNNKTFENLYN 916
             N     G  T +LP  V+DWFS S+ IGLDFVEPWTE+IEQ++I N D  + F+ L++
Sbjct: 862 GPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDGFQDFDQLFD 921

Query: 917 Q 917
           +
Sbjct: 922 E 922

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPP--CVRCKRERKECIFTESNKRGGLRVANV 75
          K +   +ACL CR RK+KCD     +P   P  C  C R   EC+F  SN RGG RV + 
Sbjct: 19 KRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVFVASN-RGGRRVFDK 77

Query: 76 S 76
          S
Sbjct: 78 S 78

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query: 10 ETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          E   I+ P+  +T+  C  CR+RKVKCDLG       P C RC+R   EC
Sbjct: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 15 QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN 74
          Q PK RR  +AC  CR +KVKCD          PC+ C      C + + +KR    + +
Sbjct: 25 QQPKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYNCTYNQPSKRSNSNLQH 77

Query: 75 VSAIAENTAN 84
          +   +EN AN
Sbjct: 78 LKNSSENLAN 87

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (45%), Gaps = 16/112 (14%)

Query: 13  QIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRV 72
           +I+ P+ ++  +AC NCR RK+KC           PC  C   + ECIF +  +      
Sbjct: 25  KIKRPR-KKVSKACANCRRRKIKC-------TGTYPCSNCAAYQCECIFDDLKEDS---- 72

Query: 73  ANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDP--LPIN 122
           +N S +   T   T +  K+ T   + N    SQQ  F   NS+    LPIN
Sbjct: 73  SNPSTVGGTTQKVTKTKRKSHTK--KHNEEAASQQLKFDETNSVHVGILPIN 122

>KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} similar
           to uniprot|P08638 Saccharomyces cerevisiae YLR451W LEU3
           Zinc-finger transcription factor that regulates genes
           involved in branched chain amino acid biosynthesis and
           ammonia assimilation positively regulated by
           alpha-isopropylmalate an intermediate in leucine
           biosynthesis
          Length = 873

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 123/335 (36%), Gaps = 55/335 (16%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K RR   AC+ CR +K KCD           C RC ++  +C+  +  +R   RV N   
Sbjct: 23  KGRRKKLACVECRQQKSKCD---AHERAPESCTRCAKKNVQCVLQKDFRRTYKRVRN-EV 78

Query: 78  IAENTANATASMSKAITSVFQGNTSEGSQ----QPDFKRENSIDPLPINSELTTMQDALE 133
           I +     T S+S            E  Q    Q +F +E           +   QDA  
Sbjct: 79  IEKRFKELTKSLSNLGAEEILRRIEEEQQTLLDQNNFTKEKL---------MKLRQDAAS 129

Query: 134 FLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEA 193
            L KA+ +++     D   A               + PI S SA+D  R S  A +  E 
Sbjct: 130 GLDKASSTLSTSSVDDTPTA---------------EPPIESLSAEDRNRESEEAAVTIEV 174

Query: 194 CIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFLT 253
                        PT   +   + +   P + L D+        +S E+   L + F   
Sbjct: 175 -------------PTSANVFNSNIIHCSP-KSLGDV-------YMSSEDIRDLYEEFTAK 213

Query: 254 MHPFFPHVPLQLQNPDEL-AQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIHERL 312
            HPF P V +  + P+ + +  P L   I+ I  R  S     M    +  ++V     +
Sbjct: 214 YHPFLPVVDIS-KGPELIYSLSPCLFWVIMLIGLRRKSKSSDIMAKLSTLVKSVLAEITI 272

Query: 313 WIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNP 347
               +   S+      +  S+ +V AFLL+T W P
Sbjct: 273 SPIIRYAPSENDEPVLNVASVYSVQAFLLYTFWPP 307

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG 69
          K RR  +AC  CR +KVKCD          PC+ C     EC + +  KRGG
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRGG 51

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 6/47 (12%)

Query: 13 QIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          Q + P+  +T+  C  CR+RKVKCDL        P CVRC +   EC
Sbjct: 8  QTKRPRRAKTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 15  QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNK 66
           Q P  RR  +AC NCR RK+KCD   +D P    C  C +  K C F+E+++
Sbjct: 152 QHPYKRRVVKACYNCRRRKIKCD--AID-PSKNKCSNCLKLNKICSFSENDE 200

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {ON} 
          Length = 860

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 18/98 (18%)

Query: 12  QQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLR 71
           Q+ +  K R +Y  CL CR+RK+KCD         P C RCK++ K C +   N      
Sbjct: 2   QEKRQRKQRPSY-VCLECRSRKLKCDKAR------PYCNRCKKDGKVCAYESEN------ 48

Query: 72  VANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPD 109
            A+   I ++++N T  +S + T +    +++G+   D
Sbjct: 49  -ASQITIPDDSSNHTLKLSTSFTDI----STDGNSNID 81

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 8/56 (14%)

Query: 12 QQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          Q I PP  R++  AC+ CR R VKC       P+  PC+RC + + +C ++E +++
Sbjct: 27 QDIVPPIPRKS-NACIQCRRRHVKC-------PNGNPCLRCVKSKLQCEYSEPSRK 74

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 16/94 (17%)

Query: 12 QQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR---- 67
          Q  Q  K RR  +AC  CR +KVKCD          PC+ C     EC + +  KR    
Sbjct: 7  QGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQNS 59

Query: 68 ---GGLRVANVSAIAENTANATASM--SKAITSV 96
             G L + N    + +   ATA++  +K ++SV
Sbjct: 60 GNSGMLALGNAVGPSSSVVVATATLNPNKLLSSV 93

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 7/72 (9%)

Query: 10 ETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG 69
          + QQI   K RR  +AC  CR +KVKCD          PC+ C     EC + +  KR  
Sbjct: 4  QQQQILQNKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRSN 56

Query: 70 LRVANVSAIAEN 81
             +  S  + N
Sbjct: 57 TSASTQSPQSAN 68

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +TY  C  CR RKVKCDL        P C+RC+R + +C
Sbjct: 10 KTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 838

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 15 QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN 74
          +PP  RR+  AC+ CR + VKC       P   PC +C   R  C + E NK+  + +  
Sbjct: 33 KPP--RRSTLACVRCRRKHVKC-------PGGDPCSKCSAARIACEYLEPNKKLTVSMKY 83

Query: 75 VSAIAENTAN 84
          +  + EN A+
Sbjct: 84 LQQLQENLAD 93

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 81/199 (40%), Gaps = 39/199 (19%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K  R    C  CR RK +CD G        PC +C     EC+++ S    G +V+    
Sbjct: 67  KRNRVSYVCYACRRRKTRCDRGN-------PCSKCVALSTECVYSISEMNNGNKVSATQV 119

Query: 78  IAENTA----NATASM-SKAITSVFQGNTSEGSQ----QPDFKREN-SIDPLPINSEL-- 125
           +AE +     N+TA + + AI+     N     Q     P F++++ SI P P+ S +  
Sbjct: 120 LAETSGTALPNSTADIVATAISDPALSNLLPLQQLSAMLPHFQQQSKSIKP-PMGSAVPL 178

Query: 126 ----------TTMQDALEFLAKAAGSVA--KEDSRDLVDASTKYEELESQSNSRTDTPIS 173
                     T   DA+  + K    VA  K  +  +V        L S   S TD P+ 
Sbjct: 179 QPPEVDISSSTVHADAMR-IVKLEEEVAFWKNKANSMVPPGA----LNSLPRSYTDAPVD 233

Query: 174 S--GSAQDSTRNSNSANIP 190
           S   SA   +  SN A IP
Sbjct: 234 SPHSSAFTESSLSNPARIP 252

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
          YML099C
          Length = 861

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 17 PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          P+  +T+  C  CR+RKVKCDL        P C+RC++   EC
Sbjct: 14 PRRAKTFTGCWTCRSRKVKCDL------RRPGCLRCEKSSLEC 50

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 13/82 (15%)

Query: 12 QQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLR 71
          Q ++P +      ACL+CR ++ KC++         PC  C+R   +CIFT  + R   +
Sbjct: 12 QTVKPKRL-----ACLHCRHKRKKCNM-------KSPCSNCQRAGMKCIFTHEDLRSKRK 59

Query: 72 -VANVSAIAENTANATASMSKA 92
           V+ ++ + E+ A   +S+ KA
Sbjct: 60 SVSYLTTLEEHIATLESSIVKA 81

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
           (REAL)
          Length = 918

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 70/160 (43%), Gaps = 38/160 (23%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAE 80
           ++   C NC+ R+VKCD G       P C +C   + EC++T  + R G           
Sbjct: 46  KSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKG----------- 88

Query: 81  NTANATASMSKAITSVFQGNTSEGSQQPDFKRENSID-PLPINSELTTMQDALEFLAKAA 139
                 A++ K +T       ++GS +P    E+S+D P  +  E T   D    + KA+
Sbjct: 89  ----RGATVVKYVT-----RKADGSVEP----ESSVDLPTVVKKEQTPFNDVSSAI-KAS 134

Query: 140 GSVAKEDSRDLVDASTKYEELESQS----NSRTDTPISSG 175
           GS    DS     ++TK E  E  S    +  T TP+S G
Sbjct: 135 GS--SNDSYPSSASTTKSESEEKSSAPIEDKNTMTPLSMG 172

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 8/70 (11%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG--LRVANVSAI 78
          +T+  C  CR+RKVKCDLG       P C RC +   EC   +   R    +R  N   +
Sbjct: 18 KTFTGCWTCRSRKVKCDLGK------PTCQRCDKSGLECGGYDIKLRWSQPIRFDNFGQV 71

Query: 79 AENTANATAS 88
            NT+++  +
Sbjct: 72 DPNTSSSACA 81

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR------GGLR 71
           K RR  +AC  CR +KVKCD          PC+ C     EC + + +KR      G + 
Sbjct: 10  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKRTNSSVTGSMS 62

Query: 72  VANVSA---IAENTANATASMSKAITSVFQGNTSEGSQQPDFKRE 113
             N+S+   ++     + ++ S A T  +   +S+   Q D  R+
Sbjct: 63  ATNISSQNMLSTLNIQSGSAASSAGTRKYNTKSSKLQHQIDRYRQ 107

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 15  QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN 74
           Q  K R+  +AC+ CR R +KC       P + PC +C      C F+E NK+  + +  
Sbjct: 48  QLGKKRKITRACIRCRERHIKC-------PGNDPCQKCLEANHICKFSEPNKKVIVSINY 100

Query: 75  VSAIAEN 81
           ++ + +N
Sbjct: 101 LTKLHDN 107

>KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.512
           YLR451W
          Length = 869

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 119/335 (35%), Gaps = 83/335 (24%)

Query: 19  WRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAI 78
           +RR   AC+ CR +K +CD          PC +CK++   C+  +  +R   R  N  AI
Sbjct: 41  YRRKKFACVECRQQKSRCD---ASEKAPGPCTKCKQKGVTCVLKKDFRRTYKRARN-EAI 96

Query: 79  AENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEFLAKA 138
            +     TAS+S          +SE   Q             I  E   + D   F  K 
Sbjct: 97  EKRFKELTASLSNL--------SSEEILQ------------KIKEEQEALLDNRNFTRKK 136

Query: 139 AGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIAPL 198
              +  E          ++  L+S++ S T TP+S                         
Sbjct: 137 VKKLKLE---------AEHPSLDSRTASNT-TPVSY------------------------ 162

Query: 199 LRPHGLGRPTIPLIEKLSSVRPKPS-RRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHPF 257
                    T P ++K++  + K + + L DI        +S EE   +   F    H F
Sbjct: 163 ---------TFPTVQKMTEDQLKCTPKSLDDI-------CMSSEEIADIFQEFATHYHQF 206

Query: 258 FPHVPLQLQNPDELAQYPILLCAILTIS----SRYHSFDEVNMYNGESNNRNVEIHERLW 313
            P V L        A  P L   IL I     ++YH  D +N  +    N   EI     
Sbjct: 207 LPVVNLNNGAEKIYALSPCLFWVILLIGLRRCTKYHKDDIMNRLSMLVKNILAEITISPI 266

Query: 314 I-YCQRLISQTVWAEASTRSIGTVLAFLLFTEWNP 347
           I Y    + + +   AS  S   V AFLL+T W P
Sbjct: 267 IRYTPDPLDEPILNVASVYS---VQAFLLYTFWPP 298

>KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.344
           YML076C
          Length = 903

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K +R   AC+ C + K KC     ++ +  PCVRC R+RK+C F  S +    R  N ++
Sbjct: 51  KNKRNTFACVGCHSLKQKCVPSDFNDIYRKPCVRCFRQRKKCKFDLSKRTRKRRRGNSNS 110

Query: 78  IAENTANATASMSKAIT--SVFQGNTSEGSQQPDF 110
             E +  ++ S   + T  S+F   +   +Q P+F
Sbjct: 111 EREQSTLSSPSGPGSGTPPSLF---SQSSNQVPNF 142

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 17 PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          P+  +T+  C  CR+RKVKCDL        P C RC+R   +C
Sbjct: 3  PRRAKTFTGCWTCRSRKVKCDL------RRPNCSRCERSELQC 39

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 15  QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG 69
            PPK +R  +AC  CR RK+KCD     +     C  C +   EC F+  NKR G
Sbjct: 93  HPPK-KRASKACDLCRRRKIKCD---AFDDRLKKCSNCIKYHSECTFSNQNKRKG 143

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T+  C  CR+RKVKCDLG       P C RC++   EC
Sbjct: 18 KTFTGCWTCRSRKVKCDLGK------PNCQRCEKSGLEC 50

>KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 811

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
           K +R   AC NC ++K KC    V + +  PCVRC + RK C F
Sbjct: 104 KPKRNTFACTNCHSQKSKCVPSDVSDIYRKPCVRCHKRRKLCKF 147

>Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON}
           (22248..24344) [2097 nt, 699 aa]
          Length = 698

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 32/171 (18%)

Query: 25  ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN-VSAIAENTA 83
           AC NCR R+ KCDLG        PC  C+R +  C   + + R     A+ V ++    +
Sbjct: 10  ACSNCRRRRKKCDLG-------YPCGTCERLKLVCNVNDVDLRKKRYSASYVKSLESQVS 62

Query: 84  NATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEFLAKAAGSVA 143
           N  A++      ++          PDF +  + D +P+N  L+T+    E     +    
Sbjct: 63  NVEANVRNLSEKLY----------PDFAK--TFDNMPLNEVLSTLVTVHE---DQSEPNK 107

Query: 144 KEDSRDLVDASTKYEELESQSNSRTDT-PISSGSAQDSTRNS-NSANIPDE 192
            E  R+L+       ++E   NS ++  P+SS    +S +N  NS+  P+E
Sbjct: 108 YEQIRNLL-------QIEKSVNSNSNVGPLSSSLDGNSNQNKLNSSGNPNE 151

>KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserved
           hypothetical protein
          Length = 631

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 7/100 (7%)

Query: 17  PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVS 76
           PK +R+   CL CRTR+ KCD       + P C  C+R   +C + + +  G +R     
Sbjct: 5   PKRKRSVHGCLTCRTRRKKCD------ENKPVCGGCERNFVQCTWPQ-HTGGRVRRKRGE 57

Query: 77  AIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSI 116
           A    +  ++ S   A    F+ +   G + P F R  ++
Sbjct: 58  AAELTSDRSSTSADPAAGQGFEFHIICGPRTPVFNRSGTL 97

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 9  FETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRG 68
           E Q  +  K RR  +AC  CR +KVKC     DN H  PC+ C     EC + +  +R 
Sbjct: 5  LERQGSRIAKRRRITRACDECRKKKVKC-----DNRH--PCIHCTVYSYECTYNQPARRT 57

Query: 69 G 69
          G
Sbjct: 58 G 58

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)

Query: 8  LFETQQIQPPKW---RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTES 64
          L +   I P  W   +R   AC+ C + K KC    ++N    PC+RC + +++C F  S
Sbjct: 21 LLKPTAIDPDLWQKRKRNTVACITCHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTFDLS 80

Query: 65 NKRGGLR 71
           +    R
Sbjct: 81 KRTRNRR 87

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 14/83 (16%)

Query: 15 QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR------- 67
          Q  K RR  +AC  CR +KVKCD          PC+ C     EC + +  KR       
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQNSGNS 62

Query: 68 GGLRVANVSAIAENTANATASMS 90
          G L + NV+    ++    A+ S
Sbjct: 63 GVLTLGNVTTGPSSSTVVAAAAS 85

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 3/102 (2%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIA 79
           +R   AC++C + KVKC    +D+ +  PC RC +  K C F  S KR   R    S   
Sbjct: 116 KRNTFACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTFDLS-KRTKRRKQRNSNST 174

Query: 80  ENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPI 121
            +  + T S   ++      NT       D KR   ++P PI
Sbjct: 175 SSLVSMTGSFQSSVGMTNHTNTVNVPIPIDTKR--FMEPGPI 214

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          ++   C NC+ R+VKCD G       P C +C   R EC+FT    R
Sbjct: 29 KSKNGCDNCKRRRVKCDEG------KPFCQKCANMRLECVFTPPQPR 69

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 7/65 (10%)

Query: 4  KKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTE 63
          + R L +  Q    K RR  +AC  CR +KVKCD          PC+ C     EC + +
Sbjct: 17 QNRLLQDPAQQHMAKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQ 69

Query: 64 SNKRG 68
            KR 
Sbjct: 70 PTKRS 74

>NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON} 
          Length = 914

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIA 79
           +R  +AC +CR RK+KCD   VD P    C  C +    C F    KRG   V N    +
Sbjct: 100 KRVSKACDHCRKRKIKCD--KVD-PSTGKCSNCLKYNANCTF----KRGRDNVLNNRRTS 152

Query: 80  ENTANATASMSKAITSV 96
           ++T ++  S   A+ +V
Sbjct: 153 DDTTSSALSKGFALNNV 169

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 10/63 (15%)

Query: 13 QIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRV 72
          +I+ P+  +  +AC NCR RK+KC+ G        PC  C+    EC F  S ++GG R+
Sbjct: 34 KIRKPR-SKVSKACDNCRKRKIKCN-GKF------PCASCEIYSCECTF--STRQGGARI 83

Query: 73 ANV 75
           N+
Sbjct: 84 KNL 86

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          K RR  +AC  CR +KVKCD          PC+ C     EC + + +KR
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 49

>Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR451W
           (LEU3) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 124]
           FULL
          Length = 882

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 124/336 (36%), Gaps = 65/336 (19%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIA 79
           RR   AC+ CR +K KCD          PC RC ++   C+  +  +R   RV N   I 
Sbjct: 25  RRKKLACVECRQQKSKCD---AHEKAPEPCTRCAKKNVACVLQKDFRRTYKRVRN-EVIE 80

Query: 80  ENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEFLAKAA 139
           +     T S+S             G+++   KR        I  E  T+ D   F     
Sbjct: 81  KRFKELTKSLSNL-----------GAEE-ILKR--------IEEEQQTLLDKNNF----- 115

Query: 140 GSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIAPLL 199
               KE  + L          ES SN+     +SS S+ + T               P+ 
Sbjct: 116 ---TKEKLKKL--------RQESSSNNDVFPTLSSPSSMEHT---------------PMT 149

Query: 200 RP-------HGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFL 252
           RP       HGL   +  L+  ++S  P         + +G + M S E+  +L   F  
Sbjct: 150 RPPEGSPHDHGLSSNSPGLVAGMTSGEPNAESFECTPKSLGEIYM-STEDIQELYAEFEA 208

Query: 253 TMHPFFPHVPLQLQNPDEL-AQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIHER 311
             HPF P + +  + P+ + +  P L   I+ I  R        M    +  +++     
Sbjct: 209 KYHPFLPVMDIS-KGPELIYSLSPCLFWVIMLIGLRRKFRATETMAKLSTLVKSILAEIT 267

Query: 312 LWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNP 347
           +    +   S+      +  S+ +V AFLL+T W P
Sbjct: 268 MSPIIRYSPSENDEPVLNVASVYSVQAFLLYTFWPP 303

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 14/72 (19%)

Query: 15 QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR------- 67
          Q  K RR  +AC  CR +KVKCD          PC+ C     EC + +  KR       
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQNSGNS 62

Query: 68 GGLRVANVSAIA 79
          G L + N +  A
Sbjct: 63 GVLALGNAATAA 74

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          K RR  +AC  CR +KVKCD          PC+ C     EC + + +KR
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 49

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTE 63
           RR  +AC +CR RK+KC  GP+ NP    C  C +    C FT 
Sbjct: 97  RRVSKACDHCRKRKIKC--GPI-NPAKNKCDNCIKYSSACTFTH 137

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 10 ETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          E   +Q  K  +T+  C  CR+RKVKCDL        P C RC++   +C
Sbjct: 12 ERSYVQKGKRAKTFTGCWTCRSRKVKCDL------QRPNCGRCEKSGLDC 55

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
           Anc_7.56 YOR337W
          Length = 757

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 68/161 (42%), Gaps = 13/161 (8%)

Query: 25  ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLR-VANVSAIAENTA 83
           AC NCR R+ KCD+       + PC  C R   EC   E + R      ++V  +  + +
Sbjct: 50  ACSNCRKRRKKCDV-------EYPCGGCSRLGLECNINEEDLRKTRHSSSHVKTLEAHIS 102

Query: 84  NATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDA---LEFLAKAAG 140
           N    + + + S+F  N SE         +  I   P+    +T       +  +AKA  
Sbjct: 103 NLEKDIQRMV-SIFSSNASEFDHNL-MPTDIIIKYFPLTKSSSTSMSNSSDVANIAKAKE 160

Query: 141 SVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDST 181
           S++   S   +  + K EE +    S++DT I   ++ D T
Sbjct: 161 SISVGSSTTDITRTVKLEETDPILRSKSDTEIVEKTSLDQT 201

>NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.61
          YOR172W
          Length = 735

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 11/71 (15%)

Query: 15 QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCK-RERKECIFTESNKRGGLRVA 73
          +P K R+  ++C+ CR RK+KCD         P C +CK R+  +C++T+ N      V 
Sbjct: 12 EPKKRRKQIKSCMFCRKRKLKCDKAK------PMCGQCKERKLPDCLYTDFN----FPVN 61

Query: 74 NVSAIAENTAN 84
          ++  + +NT N
Sbjct: 62 SMKDLFDNTPN 72

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T+  C  CR RKVKCDLG       P C RC++   +C
Sbjct: 39 KTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71

>Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG 69
          ++   C NC+ R+VKCD G       P C +C   + EC++T  + R G
Sbjct: 46 KSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECVYTPIHLRKG 88

>SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON}
          conserved hypothetical protein
          Length = 1061

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 17 PKWRRTYQACLNCRTRKVKCDLGPVD---NPHDPP-CVRCKRERKECIFTESNKRGGLRV 72
          PK +   +ACL CR +K+KCD G V       DP  C  C     +C+F  S  RGG RV
Sbjct: 10 PKRKVARRACLTCREKKIKCD-GEVRASLGGSDPGICSNCAASGSKCVFVAS-MRGGRRV 67

Query: 73 A 73
          +
Sbjct: 68 S 68

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 10/63 (15%)

Query: 13 QIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRV 72
          +++ P+  +  +AC NCR RK+KC+ G        PC  C+    EC FT  +++GG R+
Sbjct: 31 RVRKPR-SKVSKACDNCRKRKIKCN-GKF------PCASCEIYSCECTFT--SRQGGHRI 80

Query: 73 ANV 75
           N+
Sbjct: 81 KNL 83

>Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON}
          (12074..14566) [2493 nt, 831 aa]
          Length = 830

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T+  C  CR+RK+KCDL        P C +C   R EC
Sbjct: 21 KTFTGCWTCRSRKIKCDLTK------PSCRKCTNSRIEC 53

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          K RR  +AC  CR +KVKCD          PC+ C     EC +   +KR
Sbjct: 29 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNHPSKR 71

>Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar to
           Ashbya gossypii AER141C
          Length = 665

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 101/272 (37%), Gaps = 72/272 (26%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIA 79
           +R  + C NC+  KVKC+          PC RC R   EC F +   RG           
Sbjct: 8   KRRTKPCSNCKQNKVKCEYN-----EGLPCSRCTRNGLECYFIQ---RG----------- 48

Query: 80  ENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALE-FLAKA 138
            N   + +S  +     FQ  T   +Q+P  +  NSID       L T + ALE  L   
Sbjct: 49  -NIDKSPSSQKQETMLQFQTAT---TQEPIKEWMNSID-----ERLNTFESALESVLGLL 99

Query: 139 AGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIAPL 198
            GS  ++                              +      +    N+PD   I  L
Sbjct: 100 HGSQIQQ--------------------------QQQINLLQQQISQQQHNLPD---INQL 130

Query: 199 LRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHPFF 258
           L P         L +  S V     ++ TD+       +L++++A +L+ LF        
Sbjct: 131 LIP--------TLFDSNSLV-----KQYTDVNDFRFDHVLTKQQAQELLALFDKNCSNHL 177

Query: 259 PHVPLQLQNPDEL-AQYPILLCAILTISSRYH 289
            H  +   + D+L    P+LL AI T++SRYH
Sbjct: 178 FHYTIGDLHIDDLWVNSPLLLAAICTVASRYH 209

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          K R+  +AC+ CR RK+KCDL        P C +C      CI+T
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLTK------PKCKQCSSRNLNCIYT 44

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 16 PPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESN 65
          P   RR  +AC  CR  K KCD        + PC RC +E K C ++ SN
Sbjct: 12 PTIKRRVSKACDACRKSKTKCD-------GERPCSRCLKENKLCTYSNSN 54

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 49/120 (40%), Gaps = 18/120 (15%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAE 80
           R  +AC  C+ RKVKCD        + PC+ C + +KEC       R   +V N      
Sbjct: 27  RVQKACELCKKRKVKCD-------GNKPCLNCSKHQKEC-------RYDFKVTNRRRRRR 72

Query: 81  NTANATASMSKAIT---SVFQGNTSEGSQQPDFKRENSIDPLPI-NSELTTMQDALEFLA 136
              +   +++K  T    VF  + S     P     +S    P  NS  + +Q  L F++
Sbjct: 73  QATSPIQNVNKEYTEADGVFSRDISASVNVPSDCLSSSAGNSPYSNSHYSNLQSTLPFMS 132

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 17  PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGL 70
           P  RR  QAC  CR +K+KCD G +     P C  C++    C  T    R GL
Sbjct: 92  PTGRRHSQACDRCRLKKIKCD-GLI-----PHCTNCRKINFNCQTTHKLSRRGL 139

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 66/330 (20%), Positives = 123/330 (37%), Gaps = 52/330 (15%)

Query: 24  QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAENTA 83
           QAC  CR +K++C          P C +C +    C ++   KR  L  A+++ + +   
Sbjct: 3   QACDICRVKKLRCS------KEKPSCFKCLKNNLTCTYSPRAKRSPLTRAHLTEVEKKLN 56

Query: 84  NATASMSKAITSVFQGNTSE----GSQQPDFKRENSIDPLPINSELTTMQDALEFLAKAA 139
           N T    K       GN  +     S + DF           N+ LT  ++  + + KA 
Sbjct: 57  NLTILFGKLFPGENIGNLVKRFNIDSSKSDFD----------NAYLTNNEEDDKKINKAN 106

Query: 140 GSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIAPLL 199
            ++  +DS + +     +EE   + N            +  T  S +      + I+ L 
Sbjct: 107 VTIPIDDSVENLLYGFDWEEKNDRVNH------GQSIMKHITDKSYNGYFGPNSTIS-LF 159

Query: 200 RPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHPFFP 259
           R   +    I ++ + +++  K    + + +   ++ +  +    + I  FF   HPF P
Sbjct: 160 R--SIKNLNIIMLLENNNISNKNLYGIPNAQISSSVNLTKKTTMKRYIRSFFENFHPFNP 217

Query: 260 HV-----------PLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEI 308
            V              + + +E   + +L+  ILTI +  H         GESN    EI
Sbjct: 218 IVDEDWFMSMYTDKKSVHSKNETQYWQLLMNIILTIGAWCHE--------GESN----EI 265

Query: 309 HERLWIYCQRLISQTVWAEASTRSIGTVLA 338
               + +C    S    +  S  SI  ++ 
Sbjct: 266 DTYYYQHCHNFFSNNGCSFLSNGSIDLLIV 295

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 15 QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          Q  K RR  +AC  CR +KVKCD          PC+ C     EC + +  KR
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKR 55

>CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa]
          {ON} weakly similar to uniprot|Q03631 Saccharomyces
          cerevisiae YML076c
          Length = 945

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          +R   AC+ C   K KC    V + +  PCVRC R R  CIF
Sbjct: 56 KRNTFACVKCHDLKQKCRPSDVGDIYRNPCVRCLRSRDPCIF 97

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T+  C  CR RKVKCDLG       P C RC++    C
Sbjct: 41 KTFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSC 73

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T+  C  CR RKVKCDL        P C RC+R   +C
Sbjct: 17 KTFTGCWTCRARKVKCDLTR------PSCTRCERSGLKC 49

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
          (REAL)
          Length = 913

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 7/55 (12%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANV 75
          ++   C NC+ R+VKCD G       P C +C   + EC++T  + R G R A V
Sbjct: 46 KSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKG-RGATV 93

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
           Anc_4.344 YML076C
          Length = 894

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 47/115 (40%), Gaps = 13/115 (11%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K +R   AC+ C + K KC    V++ +  PC RC R ++ C F  S +    +  N   
Sbjct: 54  KLKRNTFACVRCHSLKQKCVPSDVNDIYLKPCQRCSRNKQVCKFDLSKRTRKRKPKN--- 110

Query: 78  IAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDAL 132
                 +AT S S    S  +   S G Q    ++     P P+   L T Q  L
Sbjct: 111 ------SATPSRSPTPLSGLKREPSMGEQSTKLQK----TPSPVKPTLMTNQTVL 155

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 7/45 (15%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTES 64
          ++  +ACLNCR RK+KC  G        PC  C   + EC+F E+
Sbjct: 11 KKVVKACLNCRRRKIKCT-GTF------PCSNCAAYQCECVFDET 48

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 64/335 (19%), Positives = 126/335 (37%), Gaps = 57/335 (17%)

Query: 24  QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAENTA 83
           QAC +CR RK++C      +   P C +C +   EC ++    R  L   +++ + +   
Sbjct: 7   QACDSCRKRKLRC------SKELPKCSKCLKHNWECCYSPKAVRSPLTRVHLNYVEKK-- 58

Query: 84  NATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEFLAKAAGSVA 143
              A++ +    +F G   E + Q                   + Q+  E +  A  +  
Sbjct: 59  --LATLERLFHELFPGIDPEKALQGK-----------------SSQNLRELIGSATSNSI 99

Query: 144 KEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIAPLLRPH- 202
             +  ++  A T  + +      + + P       D     +S +  D  C   +   H 
Sbjct: 100 PGNKDEITTAKTLVKPMHQPQLPQDEIPDDPLYGFDWIEEDDSVHKDDGMCALNINPNHK 159

Query: 203 ---GLGRPTIPLIE-KLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHPFF 258
              GLG  T+ L   K++ + PK  R  + ++   T  + ++    K ID +F   H  +
Sbjct: 160 GYFGLGSSTVLLRSLKVNDIAPKLQRVPSIVK--ETYSLSAKYVTSKFIDAYFSQYHTTY 217

Query: 259 PHV---PLQLQNPDELAQ-----YPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIHE 310
           P +       Q  D+L       + ILL  +L +             NGES++ ++  ++
Sbjct: 218 PFIHKETFMAQYKDQLRPSSMDIWQILLNTVLALGCW--------CINGESSDIDIYYYQ 269

Query: 311 RLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEW 345
               Y   ++ +       T S+  V+A  L + +
Sbjct: 270 NAKSYLSSVVFE-------TGSVSLVVALTLLSSY 297

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa]
          {ON} YGL013C (REAL)
          Length = 1069

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 10/63 (15%)

Query: 13 QIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRV 72
          +++ P+  +  +AC NCR RK+KC+ G        PC  C+    EC FT   ++GG R+
Sbjct: 31 KVRKPR-SKVSKACDNCRKRKIKCN-GKF------PCASCEIYSCECTFT--TRQGGNRI 80

Query: 73 ANV 75
           N+
Sbjct: 81 KNL 83

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa]
          {ON} YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          +R   AC NC  +K KC    V + +  PCVRC++  K C F
Sbjct: 54 KRNTFACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTF 95

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          K RR  +AC  CR +KVKCD          PC+ C     EC + +  +R
Sbjct: 6  KRRRVTRACDECRKKKVKCD-------GKQPCIHCTVYNYECTYNQPTRR 48

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 7/50 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          K RR  +AC  CR +KVKCD          PC+ C     EC +    KR
Sbjct: 29 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNHPTKR 71

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 17 PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVS 76
          PK  R   AC NCR +K KCD          PC  CK    ECI+++   R  L    V 
Sbjct: 19 PKRLRVSHACDNCRLKKKKCD-------GQQPCKLCKNSENECIYSD---RRRLTTGTVL 68

Query: 77 AIAEN 81
          A  E+
Sbjct: 69 AAGES 73

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTES 64
          R  + CL CR RKVKCD         P C+RC +    C +T S
Sbjct: 10 RPSKVCLTCRRRKVKCD------QQHPSCMRCIKSSTLCTYTYS 47

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 10/89 (11%)

Query: 13  QIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRV 72
           Q+  PK +R   AC NCR R+ KCDL         PC  C R R +C   E + R     
Sbjct: 48  QLGLPKRKRL--ACTNCRKRRKKCDLS-------YPCASCVRLRIDCNVNEEDLRKKRYS 98

Query: 73  AN-VSAIAENTANATASMSKAITSVFQGN 100
           ++ V ++  + A   +++   I  V+  N
Sbjct: 99  SSYVKSLEGHVAYLESNLKTLIDKVYPNN 127

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 15 QPPKWRRTYQ----ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGL 70
          +PP+++++       C NC+ RK+KCD         P C RC +   EC++     + G 
Sbjct: 15 EPPEFKKSRMRQSFVCRNCKKRKIKCDKA------RPSCGRCSKLELECVYDFQENKDGR 68

Query: 71 R 71
          R
Sbjct: 69 R 69

>KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 919

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 13/100 (13%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDP------PCVRCKRERKECIFTESNKRGGLR 71
           K +R+  AC++C + K KC      NP DP      PC+RC +  K C F  S +R   +
Sbjct: 56  KVKRSTFACISCHSMKQKC------NPTDPTDIYRHPCIRCAKLNKICQFDLSKRRRRKK 109

Query: 72  VANVSAIAE-NTANATASMSKAITSVFQGNTSEGSQQPDF 110
              +  + + N +    +M     S   G+ S  + + D 
Sbjct: 110 KKKLGTVGDGNLSGYVGAMKNGGASTTNGDGSALNPKSDI 149

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAE 80
           ++   C NC+ R+VKCD G       P C +C   + +C++     R   +++ V  +  
Sbjct: 101 KSKNGCANCKRRRVKCDEG------KPTCQKCLNMKLQCVYLPVTARNKPKISQVETLPN 154

Query: 81  ---NTANATASMSKAITS 95
               T+N+T + ++ I S
Sbjct: 155 PSIMTSNSTINSNEKIKS 172

>Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON}
           (21147..23855) [2709 nt, 903 aa]
          Length = 902

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIA 79
           RR   AC+ CR +K KCD   V+   D PC +C ++  +CI  +  +R   R  N  AI 
Sbjct: 52  RRKKFACVECRQQKSKCD--AVERAPD-PCTKCSKKGLQCILKKDYRRTYKRARN-QAIE 107

Query: 80  ENTANATASMS 90
           +     T ++S
Sbjct: 108 QRFKELTKTLS 118

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 6/35 (17%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKR 54
          R+++  C  CR+RKVKCDL      + P C RC R
Sbjct: 11 RKSFNGCWTCRSRKVKCDL------NRPKCQRCDR 39

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 15 QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          Q  K R+  +AC +CR +KVKCD        + PC+ C     EC +    KR
Sbjct: 9  QEGKRRKVTRACDDCRKKKVKCD-------GNQPCIHCTVYSYECTYNHPLKR 54

>AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR228C (ECM22) and
           YDR213W (UPC2)
          Length = 866

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
           ++   C NC+ R+VKCD G       P C +C + R  C++T +  R
Sbjct: 84  KSKNGCDNCKRRRVKCDEG------KPGCQKCLKMRLSCVYTPAKPR 124

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 14 IQPPKWRRTYQACLNCRTRKVKCD-LGPVDNPHDPPCVRCKRERKECIF 61
          +Q    RR+ +AC +CR RK++CD + PV N     C  C + + EC F
Sbjct: 29 LQQHYKRRSTKACDHCRKRKIRCDEVNPVTN----KCSNCVKFKVECTF 73

>Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106W
          (RDS1) - transcriptional regulator [contig 139] FULL
          Length = 827

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 7/59 (11%)

Query: 15 QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT-ESNKRGGLRV 72
          + P+  R    CL CR RK+KCD         P C RCK+    C +  + N  GG ++
Sbjct: 4  KSPRVNRPRLVCLECRNRKLKCDKA------RPKCTRCKQNLLTCSYANDGNSPGGSKL 56

>ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain; DNA-binding
          transcriptional activator or CHA1 and to YOR337W
          uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer-mediated
          Activation Ty1 enhancer activator
          Length = 523

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 7/43 (16%)

Query: 25 ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          AC NCR ++ KCDL       + PC RC R + ECI T  + R
Sbjct: 7  ACQNCRQKRKKCDL-------ELPCSRCTRLKVECIPTVQDMR 42

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 5   KRTLFETQQ--IQPPKW---RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
           KRT    QQ  IQ   +   +R  +AC +CR RK+KCD  PVD P    C  C +    C
Sbjct: 115 KRTATSPQQEKIQQDTYYSKKRATRACESCRKRKIKCD--PVD-PITNKCSNCTKFHMIC 171

Query: 60  IFTESNKRG 68
           +F    ++ 
Sbjct: 172 VFDNRKRKA 180

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 19/92 (20%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K RR  +AC  CR +KVKCD          PC+ C     EC + + + R          
Sbjct: 58  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSTR---------- 100

Query: 78  IAENTANATASMSKAITSVFQGNTSEGSQQPD 109
              N +N++  +S  + S    N +  S Q +
Sbjct: 101 --RNNSNSSTPISTMVNSHSMTNLTMMSNQSN 130

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 9/86 (10%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF-----TESNKRGGLRV 72
           K +R   AC++C   K KC    +D+    PC RC R +K C F     T   K   +  
Sbjct: 59  KRKRNTFACISCHASKQKCVPSDLDDIFLKPCQRCFRSKKICAFDLSKRTRKRKSRSIGP 118

Query: 73  ANVSAIAENTAN----ATASMSKAIT 94
              SA +E  +N    ++ SM  +IT
Sbjct: 119 LKHSASSEEVSNQVKISSQSMQHSIT 144

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 77/183 (42%), Gaps = 27/183 (14%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC--IFTESNKRGGLRVAN--VS 76
           R  +AC  C+ RKVKCD        + PC+ C + +KEC   F  +N+R   R A   + 
Sbjct: 41  RVQKACEICKRRKVKCD-------GNRPCLNCSKHKKECRYDFKATNRRKKRRQATSLIQ 93

Query: 77  AIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEFLA 136
            + +       ++SK + S    N +  S   DF   ++ +    N   + +   L F+ 
Sbjct: 94  NVDKEYIETDVALSKDLLSKSNANVNAPS---DFLSSSASNSPYSNGHYSNLPCTLPFMG 150

Query: 137 -------KAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANI 189
                   + G++  E++   V A     +L  Q  S+        + ++S+  +N AN 
Sbjct: 151 ARSNNAFNSGGNIHAENNTS-VFAEDHMAKLLLQLGSKL-----RNTTKESSHKANEANG 204

Query: 190 PDE 192
            D+
Sbjct: 205 DDD 207

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF-----TESNKRGGLRVAN 74
           +R  +AC +CR RK+KCD  PV NP    C  C +    C F      E  KR    +  
Sbjct: 112 KRVARACDHCRRRKIKCD--PV-NPQTNKCSNCTKYDANCTFRVRDDVEKRKRANEAIDG 168

Query: 75  VSAIAEN 81
              ++E+
Sbjct: 169 SGGVSED 175

>NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON}
          Anc_7.512 YLR451W
          Length = 809

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 17 PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVS 76
          P  RR Y AC+ CR +K KCD    ++    PC +C R+   CI  +  +R   R  N  
Sbjct: 11 PMGRRKY-ACVECRQQKSKCD---ANDKAPNPCSKCARKGVPCILKKDFRRTYKRARN-E 65

Query: 77 AIAENTANATASMS 90
          AI +      A +S
Sbjct: 66 AIEKRFKELAAGLS 79

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {ON}
           YGL013C (REAL)
          Length = 1000

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 10/85 (11%)

Query: 11  TQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGL 70
           T +++ P+  +  +AC NCR RK+KC+ G        PC  C+    EC FT   + G  
Sbjct: 29  TGRVRKPR-SKVSKACDNCRKRKIKCN-GKF------PCASCEIYLCECTFT--TRHGSN 78

Query: 71  RVANVSAIAENTANATASMSKAITS 95
           R+ N      N   AT  + +   S
Sbjct: 79  RIKNFQKANLNLEGATVQVKEETDS 103

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          R+Y  C  CR RKVKCD         P C RCK+   EC
Sbjct: 15 RSYSGCWTCRARKVKCDT------QRPKCCRCKQLGIEC 47

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          RTY  C  CR+RK+KCD         P C RC +   +C
Sbjct: 11 RTYSGCWTCRSRKIKCD------QQKPQCKRCLKANLKC 43

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN 74
           +R  +AC +CR RK+KCD     +P+   C  C +   EC F    +   +  AN
Sbjct: 247 KRVSRACDHCRKRKIKCD--EKRDPNTNKCSNCIKYNSECTFKNWEQNDAIAAAN 299

>CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON}
           similar to uniprot|P08638 Saccharomyces cerevisiae
           YLR451w LEU3 transcription factor
          Length = 940

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 25  ACLNCRTRKVKCDLGPVDNPHDP---PCVRCKRERKECIFTESNKRGGLRVANVSAIAEN 81
           AC+ CR +K KCD       HD    PC RC+++   C+  +  +R   R  N  AI + 
Sbjct: 57  ACVECRQQKSKCD------AHDKAPEPCTRCQKKGVPCVLKKDFRRTYKRARN-EAIEKR 109

Query: 82  TANATASMS 90
               TA++S
Sbjct: 110 FKELTATLS 118

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 809

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 11/105 (10%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K +R   AC NC + K KC    ++N +  PC RC +  + C F  S +    +   +  
Sbjct: 56  KPKRNTFACTNCHSLKQKCVPSDINNIYGRPCQRCMKCNRTCKFDLSKRTRKKKRKMIHE 115

Query: 78  IAENTANATASMSKAITSVFQGNTSEGSQQPDFKR---ENSIDPL 119
             EN  +++ S           N SE  + P  +    +N IDPL
Sbjct: 116 YEENRFSSSPSAV--------DNFSEEVKDPTIQSSGMDNIIDPL 152

>SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]
          {ON} similar to gnl|GLV|KLLA0A04169g Kluyveromyces
          lactis KLLA0A04169g and some similarites with YDR213W
          uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
          involved in sterol uptake zinc finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 754

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          ++   C NC+ R+VKCD G       P C +C   + EC++T   +R
Sbjct: 49 KSKNGCDNCKRRRVKCDEG------KPCCQKCINMKLECVYTPITQR 89

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          K +R   ACL CR R +KC       P+  PC +C +   +C + E +++
Sbjct: 26 KQKRQQIACLECRKRHIKC-------PNGNPCFKCLKNNLKCEYIEPSRK 68

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 63/165 (38%), Gaps = 24/165 (14%)

Query: 17  PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVS 76
           P   ++ QAC  CR +K+KC          P C +C +   EC ++   KR  L  A+++
Sbjct: 3   PSTEKSEQACDICRIKKLKCSR------EKPKCAKCMKNGWECCYSPKAKRSPLTRAHLT 56

Query: 77  AIAENTANATASMSKAITSVFQGNTS--------EGSQQPDFKRENSIDPLPINSELTTM 128
            + +      + +     ++F G  S         G    D       D   I + +  +
Sbjct: 57  RVED----KLSKLENLFNALFIGKESTPTNTRSMNGYNVDDIDDTEHTDSSEILNSILKL 112

Query: 129 QDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPIS 173
           +   E         +K + R+ +D+      L + +N  T  PIS
Sbjct: 113 ETPAEMRDAIIAISSKMERRNTIDS------LTNAANGTTTVPIS 151

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 6/41 (14%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
           ++   C+NC+ R+VKCD G       P C +C   + +C++
Sbjct: 198 KSKNGCVNCKRRRVKCDEGK------PTCKKCLNMKLDCVY 232

>Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343
          bp, 780 aa] {ON}
          (9848..11548,11550..11612,11615..12193) [2343 nt, 781
          aa]
          Length = 780

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 7/45 (15%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRC-KRERKECIFTE 63
          R+  ++C  CR RK+KCD G       P C +C  RE  ECI+TE
Sbjct: 30 RKVIKSCTFCRKRKLKCDHG------RPMCNQCSSRELPECIYTE 68

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 850

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 49/115 (42%), Gaps = 25/115 (21%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG----LRVANVS 76
           +T+  C  CR+RKVKCDL        P C RC++    C        GG    LR +   
Sbjct: 35  KTFTGCWTCRSRKVKCDL------RRPHCQRCEKSGLVC--------GGYDIKLRWSKPL 80

Query: 77  AIAENTANATASMSKAITSVFQGNTSEGS-QQPDFKRENSIDPLPINSELTTMQD 130
              E     +A+   A     Q NTS  S  +P ++R N ID +  + E    +D
Sbjct: 81  QFDEFGVPISAAQGNA-----QDNTSGASNDEPQYQRRN-IDFVRYDEEYEFYED 129

>Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa]
          {ON} similar to Ashbya gossypii ACR209W + ACR208C
          Length = 856

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 24 QACLNCRTRKVKCD---LGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRV 72
          +ACL CR RK++CD    G V       C  C     +CIF  S +RGG R+
Sbjct: 16 RACLACRKRKIRCDGETRGTVVEDGQRVCSNCANHGLKCIFVRS-QRGGRRM 66

>Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}
          YBR297W (REAL)
          Length = 463

 Score = 39.3 bits (90), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 10/60 (16%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG---LRVANVSAIAE 80
          QAC  CR R+VKCD        D PC RC +   +C + +  K+ G   +R  ++  IAE
Sbjct: 6  QACDCCRVRRVKCD-------GDKPCNRCLQHDLKCTYLQPLKKRGPKNIRSRSLKKIAE 58

>YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol
           regulatory element binding protein, induces
           transcription of sterol biosynthetic genes and of
           DAN/TIR gene products; Ecm22p homolog; relocates from
           intracellular membranes to perinuclear foci on sterol
           depletion
          Length = 913

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 68/160 (42%), Gaps = 38/160 (23%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAE 80
           ++   C NC+ R+VKCD G       P C +C   + EC +T  + R G           
Sbjct: 46  KSKNGCDNCKRRRVKCDEG------KPACRKCTNMKLECQYTPIHLRKG----------- 88

Query: 81  NTANATASMSKAITSVFQGNTSEGSQQPDFKRENSID-PLPINSELTTMQDALEFLAKAA 139
                 A++ K +T       ++GS + D    +S+D P  I  E T   D ++   KA+
Sbjct: 89  ----RGATVVKYVT-----RKADGSVESD----SSVDLPPTIKKEQTPFND-IQSAVKAS 134

Query: 140 GSVAKEDSRDLVDASTKYEELESQSNSRTD----TPISSG 175
           GS    DS     ++TK E  E  S    D    TP+S G
Sbjct: 135 GS--SNDSFPSSASTTKSESEEKSSAPIEDKNNMTPLSMG 172

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          R+ + AC NCR ++ KCD+       + PC  C +   ECI   ++KR
Sbjct: 11 RKAHLACQNCRIKRRKCDM-------ERPCSNCLKYGIECITVNNDKR 51

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTES 64
          +  +AC NCR RK+KC         + PC  CK    ECIF+ S
Sbjct: 12 KVSKACDNCRRRKIKC-------SGERPCAGCKTYNCECIFSVS 48

>KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {ON} 
          Length = 847

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K R +Y  C+ CRT+K+KCD         P C RC + +++C++  ++    L   ++ +
Sbjct: 8   KIRPSY-VCVTCRTQKLKCD------KQRPSCGRCLKNKRKCVYEINSSLDSLHENSMRS 60

Query: 78  IAENTANATASMSKAITSVFQGNTS 102
            + N  +  +S   +  ++ + + S
Sbjct: 61  HSNNQISPASSSGHSNATLIENSIS 85

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
           Anc_4.344 YML076C
          Length = 936

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 46/104 (44%), Gaps = 7/104 (6%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K +R   AC+ C + K KC     ++ +  PC RC R++  C F  S +    R   +++
Sbjct: 46  KTKRHAFACVRCHSLKQKCVPSDSNDIYRKPCQRCLRQKIVCKFDLSKRIRKKRKMGMAS 105

Query: 78  IAENTANATASMSKAIT-SVFQGNTSEGSQQP------DFKREN 114
           I  +   + A +  + + SV     S  SQ P      DF  EN
Sbjct: 106 IDNSAKTSPAVIDNSPSNSVVNDILSNSSQTPPSVQNSDFSVEN 149

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 6/37 (16%)

Query: 25 ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
           CL CR++KVKCD         P C RC++  K C++
Sbjct: 14 VCLVCRSKKVKCDKA------RPSCGRCRKTNKLCVY 44

>TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 69/177 (38%), Gaps = 29/177 (16%)

Query: 17  PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVS 76
           P+ R ++  C  C+ RK+KCD G       P C  C R  K C + +  +          
Sbjct: 8   PRKRYSHNGCKECKRRKIKCDEG------KPVCWHCDRLEKSCQYLQVKE---------- 51

Query: 77  AIAENTANATASMSKA--ITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEF 134
             AE +      + KA  I +   G  +     P     +S    P   E   + D+  F
Sbjct: 52  --AEYSVRKVTHLPKAGSIQTALYGEETNSGGTPATPVVSSTGNRPHEVEAGQLHDS--F 107

Query: 135 LAKAAGSVAKEDSRDLVDAS----TKYEELESQSNSRTD--TPISSGSAQDSTRNSN 185
            A  A  +A  D  DLV+++    T  EE ES   S  +  TP SS S +     +N
Sbjct: 108 TAYWAPLLAN-DLSDLVNSTLSEMTAIEEPESPFYSIPNGITPGSSASVEQVMFQTN 163

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
           conserved hypothetical protein
          Length = 955

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 12/111 (10%)

Query: 1   MNNKKRTLFETQQIQPPKWRRTYQ--ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKE 58
           M +K   + + ++I   + +R  Q  +C+ C  RK+KCD         P C  C +   E
Sbjct: 19  MKDKSALVIDDRKIYKIQHKRQRQILSCVACHKRKIKCDRA------KPVCESCGKNGWE 72

Query: 59  CIFTESNK--RGGLRVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQ 107
           C++  + +  RGG    N+S   E+   + AS  + +  + +    E  QQ
Sbjct: 73  CLYFLNARVSRGGKH--NISTGTEDVTASEASKEELLKVIEKAKVLELEQQ 121

>TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON}
          Anc_8.423 YLR228C
          Length = 973

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          ++   C NC+ R+VKCD         P CV+C   + +C+++
Sbjct: 47 KSKNGCDNCKRRRVKCD------EAKPACVKCSNMKLDCVYS 82

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 2  NNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          + K   + E    +  K +R+  AC  CR R +KC       P   PC +C +    C +
Sbjct: 22 DEKDEVIVELLNDKKKKVKRSSLACTRCRRRHIKC-------PGGNPCSKCLKAGVACEY 74

Query: 62 TESNKR 67
           E NK+
Sbjct: 75 VEPNKK 80

>KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON}
          Anc_8.423 YLR228C
          Length = 864

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 6/41 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          ++   CLNC+ R+VKCD         P C++C   + +C++
Sbjct: 50 KSKTGCLNCKRRRVKCD------ETKPFCIKCTNMKLDCVY 84

>NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {ON} 
          Length = 980

 Score = 39.3 bits (90), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 13/96 (13%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNK-----RGGLRV 72
           K  R+ +AC NCR RK+KC         + PC  C+     C FT   +     +G  R+
Sbjct: 10  KKTRSSRACENCRARKIKC-------SGNQPCSNCEIYNCPCAFTPIKRKNLSDKGIERI 62

Query: 73  ANVSAI-AENTANATASMSKAITSVFQGNTSEGSQQ 107
           AN   +  EN A+ T ++     S    N    S +
Sbjct: 63  ANNDHLFQENNASTTTNIRSDFESTNDANKPASSSE 98

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON}
          Anc_6.279 YPL248C
          Length = 993

 Score = 39.3 bits (90), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAE 80
          QAC +CR +K++C      +  +P C +C + + EC ++   +R  L  A+++ + +
Sbjct: 10 QACDSCRIKKLRC------SKENPKCAKCLKNKWECCYSPRKRRSPLTRAHLTEVED 60

>TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1086

 Score = 39.3 bits (90), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 98/227 (43%), Gaps = 40/227 (17%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGL-RVANVSAIA 79
           +  +AC NCR RK+KC         + PC  C   + ECIF+    +G L  + N+S I 
Sbjct: 15  KVSRACENCRRRKIKC-------TGNQPCNNCVTYQCECIFS----KGTLSSIGNISQIT 63

Query: 80  ENTANATASMSKAITSVFQGNT-----------SEGSQQPDFKRENSIDPLPINSELTTM 128
             ++    S++   ++V + ++                + D + + + D    +  + ++
Sbjct: 64  PASSENLTSVTNCDSTVERASSSRTSSNSAPLEKNSCTEKDVEEKTATDATIFDPVMDSV 123

Query: 129 QDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQ--DSTRNSNS 186
            + +E + K   S+   + +  VD            + + D   SS +    D T+ ++ 
Sbjct: 124 SENIESMTKNVYSIKSMNEKLRVD----------NQDCKADMGNSSAACDICDMTK-TDV 172

Query: 187 ANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIG 233
           A +PD   + P+   +GL +  +   EK+S ++    +RL  + ++G
Sbjct: 173 AALPD---LTPVKGDNGLYQDDMEFQEKISEMQAM-LKRLKPLSHVG 215

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 25  ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAENTAN 84
           AC+ CR R VKC       P   PC +C      C + E NK+  + +  +  + E+ AN
Sbjct: 75  ACVRCRRRHVKC-------PGGQPCAKCASANIACEYLEPNKKLIVSMKYLQDLQESLAN 127

>Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa]
          {ON} YDR213W (UPC2) - zinc finger transcription factor
          of the Zn(2)-Cys(6) binuclear cluster domain type
          [contig 249] FULL
          Length = 788

 Score = 38.9 bits (89), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          +++   C NC+ R+VKCD         P C +C   + EC++T    R
Sbjct: 44 KKSKNGCDNCKRRRVKCD------EDKPSCQKCLNMKLECVYTPVTSR 85

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTE 63
          K  R    CLNCR RK KCD G       P C  C +  + C+++E
Sbjct: 13 KRHRPTLVCLNCRRRKTKCDRGK------PSCSNCLKLGETCVYSE 52

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 6/41 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          +  +ACLNCR +K KCD         P C +C+  + EC++
Sbjct: 11 KAIKACLNCRRKKQKCDQAR------PQCYQCRIRKTECVY 45

>Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K + +   C  C+ R++KCD         P C +C R  +EC++  + K    R +N + 
Sbjct: 145 KRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRECVYVLNPKNKKRRTSNANK 198

Query: 78  IAE 80
           I E
Sbjct: 199 IKE 201

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa]
          {ON} 
          Length = 1136

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 14 IQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTE 63
          IQ  K  R    C NCR  K+KCD         P C RC ++  +C++ E
Sbjct: 38 IQLKKRNRISFVCQNCRKSKMKCD------REKPECTRCLKQGIKCVYDE 81

>Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T+  C  CR RKVKCDL        P C RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884
          bp, 627 aa] {ON} Anc_7.56 YOR337W
          Length = 627

 Score = 38.5 bits (88), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 13/88 (14%)

Query: 1  MNNKKRTLFETQQIQPPKWRRTYQ---ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERK 57
          M+N    +  TQ+ Q  K  R      AC +CR  + KCD G        PC  C +   
Sbjct: 1  MDNIYPRIIATQRWQNQKRLRKILKKLACQHCRKIRRKCDTGS-------PCANCMKFET 53

Query: 58 ECIFTESNKRGGLRVAN--VSAIAENTA 83
          EC++T  + R   R +N  V A+ E+ A
Sbjct: 54 ECVYTGHDLRKA-RYSNSYVKALEEHIA 80

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa]
          {ON} Anc_6.279 YPL248C
          Length = 1033

 Score = 38.9 bits (89), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAI 78
          QAC NCR +K+KC        H P C +C +    CI++   KR  L   +++ +
Sbjct: 9  QACDNCRLKKLKCS------KHFPKCGQCLKNNWPCIYSPKVKRSPLTRVHLTNL 57

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
          274] FULL
          Length = 628

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 8/57 (14%)

Query: 14 IQPPKWR--RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRG 68
          +Q PK +  R    C  CR RK+KC      N   P C RC +   +C++T   + G
Sbjct: 1  MQTPKSKKNRISHVCDACRIRKLKC------NKQKPSCSRCVKHDLQCVYTPYRREG 51

>TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}
          Length = 812

 Score = 38.5 bits (88), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 25  ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESN-KRGGLRVANVS 76
           AC+ C   K KC    + + +  PC +CKR R +C+F  +  KR   R +N++
Sbjct: 48  ACVRCHRLKQKCLPSDLADIYRKPCSKCKRMRLKCVFDLTKRKRNRKRNSNIT 100

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa]
          {ON} similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 856

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 7/47 (14%)

Query: 14 IQPPKWR-RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          ++P K R +T+  C  CR+RKVKCDL        P C RC++    C
Sbjct: 1  MKPAKPRVKTFTGCWTCRSRKVKCDL------RRPGCERCEKGGLIC 41

>KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa]
           {ON} Anc_3.109 YOL089C
          Length = 1050

 Score = 38.5 bits (88), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 3/72 (4%)

Query: 17  PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVS 76
           P  +R   AC +CR RK+KC  GP+ N  +  C  C +   EC F   +     +  N+ 
Sbjct: 139 PAKKRVSMACDHCRKRKIKC--GPI-NTVENKCSHCIKYNAECTFQHRDAMQARKRNNLD 195

Query: 77  AIAENTANATAS 88
              ++   + A+
Sbjct: 196 PQNDDYGESAAT 207

>TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON}
          Anc_8.423 YLR228C
          Length = 810

 Score = 38.5 bits (88), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          ++   C NC+ R+VKCD G       P C +C   + +C++T
Sbjct: 45 KSKNGCDNCKRRRVKCDEG------KPACQKCLNMKLDCVYT 80

>KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]
          {ON} conserved hypothetical protein
          Length = 661

 Score = 38.5 bits (88), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESN 65
          RR  + C NC+  KVKC           PC RC R + +C F E+N
Sbjct: 7  RRRTKPCTNCKKNKVKCLYQD-----SLPCERCARHQLQCHFAENN 47

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 38.5 bits (88), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 77/198 (38%), Gaps = 45/198 (22%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT---ESNKRGGLRVAN 74
           K + +   C  C+ R++KCD         P C +C R  +EC++    ++ KR G    N
Sbjct: 111 KRKYSRNGCAECKRRRMKCD------ETKPTCWQCSRLNRECVYVLNPKNKKRNGKSTEN 164

Query: 75  V---------------------SAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRE 113
           +                     + I +N  N   ++ + I   F GN S  S+   +   
Sbjct: 165 IVEEHCSSTVVTPSKIELRNTYTDIQKNVLNVNGTVKQGIQDAF-GNHSITSEVSGYDAS 223

Query: 114 NSIDPLPINSELTTMQ--DALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTP 171
             I  L   +++  M+  D+ +           ED +DL     +  EL S+  +    P
Sbjct: 224 LLIQNL---NDIVNMKLHDSFQL---------NEDLKDLGSFDLELPELISKEETLNSVP 271

Query: 172 ISSGSAQDSTRNSNSANI 189
           IS  S    T N++ +++
Sbjct: 272 ISFNSNSIITFNTDLSSL 289

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 844

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          ++   C +C+ R+VKCD G       P C +C + + EC++T
Sbjct: 49 KSKNGCDHCKRRRVKCDEG------KPMCDKCVKMKLECVYT 84

>Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T+  C  CR RKVKCDL        P C RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
          ARG81Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type, involved in
          the regulation of arginine-responsive genes; acts with
          Arg80p and Arg82p
          Length = 880

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T+  C  CR RKVKCDL        P C RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>Ecym_5187 Chr5 complement(393102..394199) [1098 bp, 365 aa] {ON}
           similar to Ashbya gossypii ACR245C
          Length = 365

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 8/106 (7%)

Query: 238 LSEEEAVKLIDLFFLTMHPFF--PHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVN 295
           L  E+ +K  D + + M P F   HV   +   +EL +YP+    IL   S+ H      
Sbjct: 118 LYHEDGLKPQDFYRIVMRPGFSTAHVKELMSTTNELPKYPLDFSVILCNKSKRHE----- 172

Query: 296 MYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLL 341
            Y  E  ++ +E +E+L +  QRL+ +   +      +   L  L+
Sbjct: 173 -YYAEWRDKWIENYEKLAVISQRLVWRVALSVGGIDEVKKCLDLLV 217

>NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON}
          Anc_7.512 YLR451W
          Length = 823

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN 74
          RR Y AC+ CR +K KCD          PC +C ++R  C+  +  +R   R  N
Sbjct: 23 RRKY-ACVECRQQKSKCD---AHETMPNPCSKCAKKRVPCVLKKDFRRTYKRARN 73

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF-TESNKR 67
           RR  +AC  CR RK KCD     +P+   C  C +   +CIF TE  K+
Sbjct: 172 RRAAKACEYCRKRKTKCDEV---SPYTNKCSNCSKAGVDCIFITEPTKK 217

>YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON}
           WAR1Homodimeric Zn2Cys6 zinc finger transcription
           factor; binds to a weak acid response element to induce
           transcription of PDR12 and FUN34, encoding an acid
           transporter and a putative ammonia transporter,
           respectively
          Length = 944

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNK 66
           K +R   AC+ C + K KC+   V++ +  PC RC + +K C F  S +
Sbjct: 68  KTKRNSFACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKFDLSKR 116

>Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {ON}
           YOL089C (REAL)
          Length = 1030

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESN----KRGGLRVANV 75
           +R  +AC +CR RK++CD   VD  +   C  C +    C F   +    K+  L +   
Sbjct: 130 KRVSKACDHCRKRKIRCD--EVDQ-YTKKCSNCVKFESPCTFKHRDEILKKKRKLEIKQN 186

Query: 76  SAIAENTANATASMSKAITSVFQGNTSE-GSQQPDFKRENSI 116
           SA  + +  A  ++  +++S   GN SE  S   +   ENSI
Sbjct: 187 SA-PDKSPQAQNNVPNSVSSSIVGNKSEFESFNSNVSLENSI 227

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          + +R+  AC+ CR R VKC       P   PC +C      C + E NK+
Sbjct: 40 RQKRSSMACVRCRRRHVKC-------PGGNPCSKCIAANIACEYIEPNKK 82

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 10 ETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG 69
          + Q I+    +R+ QAC  CR +K+KCD         P C  CK+   +C  ++   R G
Sbjct: 13 DGQTIELSNMKRSSQACDRCRLKKIKCD------GLRPSCTSCKKIGYQCKTSDKLTRRG 66

Query: 70 L 70
           
Sbjct: 67 F 67

>Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172W
          (REAL)
          Length = 790

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 7/47 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCK-RERKECIFTE 63
          K R+  ++C  CR RK++CD         P C  CK R R +C++TE
Sbjct: 23 KRRKPIKSCAFCRKRKLRCD------QQKPVCSTCKARRRTDCLYTE 63

>Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}
          YGR288W (REAL)
          Length = 473

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 13/75 (17%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG---LRVANVSAIAE 80
          QAC  CR R+VKCD          PC  C +    C + + +K+ G   +R+ ++  IAE
Sbjct: 11 QACDCCRVRRVKCD-------SKRPCSSCLQNNLSCTYLQPSKKRGPKSIRLRSLKKIAE 63

Query: 81 NTANATASMSKAITS 95
                 SM+  IT+
Sbjct: 64 ---VQMVSMTNVITT 75

>Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}
          similar to Ashbya gossypii AGL091W
          Length = 840

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 6/48 (12%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          +++   C NC+ R+VKCD       + P C +C + +  CI+T +  R
Sbjct: 51 KKSKNGCDNCKRRRVKCD------ENKPCCQKCFKMKLHCIYTPAKPR 92

>Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}
          YML099C (REAL)
          Length = 882

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T+  C  CR RKVKCDL        P C RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RRPHCQRCEKSNLPC 48

>SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]
          {ON} conserved hypothetical protein
          Length = 676

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRG 68
          RR  + C+NC+  KV+C           PCVRC++    C + E+ ++ 
Sbjct: 7  RRRTKPCMNCKRNKVRCQYIET-----LPCVRCQKHNLRCFYPENEQQN 50

>KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {ON}
           similar to uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
           mediated Activation Ty1 enhancer activator and to
           YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
           CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
           binuclear cluster domain; DNA-binding transcriptional
           activator or CHA1
          Length = 652

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 8/85 (9%)

Query: 25  ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN-VSAIAENTA 83
           AC NCR R+ KCD+G        PC  C + + +C     + R     A  V ++  + A
Sbjct: 33  ACSNCRRRRKKCDMG-------YPCASCVKMKLDCNVNMDDMRKKRYAAGYVKSLEAHVA 85

Query: 84  NATASMSKAITSVFQGNTSEGSQQP 108
                +     +   G +S G+ +P
Sbjct: 86  YLETRLKNLDAAKISGTSSLGTSEP 110

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
          similar to Ashbya gossypii AER183C
          Length = 898

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 8/56 (14%)

Query: 12 QQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          + +Q P+ +R  +AC  CR +K+KC+        + PC  C +   EC +T   KR
Sbjct: 14 KSMQLPR-KRVSKACDTCRAKKIKCN-------GEEPCSNCGKHDLECAYTHVIKR 61

>ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR451W (LEU3)
          Length = 864

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 9/53 (16%)

Query: 25 ACLNCRTRKVKCDLGPVDNPHD---PPCVRCKRERKECIFTESNKRGGLRVAN 74
          AC+ CR +K KC      N HD    PC RC +    C+     +R   RV N
Sbjct: 43 ACVECRQQKSKC------NAHDRAPEPCSRCAKNNVPCVLQRDFRRACKRVRN 89

>Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa]
          {ON} YLR228C (REAL)
          Length = 813

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          ++   C NC+ R+VKCD G       P C +C   + EC+++
Sbjct: 38 KSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLECVYS 73

>KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa]
          {ON} some similarities with uniprot|Q12151
          Saccharomyces cerevisiae YDR213W UPC2 involved in
          sterol uptake zinc finger transcription factor of the
          Zn(2)- Cys(6) binuclear cluster domain type
          Length = 788

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          +++   C NC+ R+VKCD         P C +C   + EC++T
Sbjct: 44 KKSKNGCDNCKRRRVKCD------EDKPSCQKCINMKLECVYT 80

>YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON}
          CHA4DNA binding transcriptional activator, mediates
          serine/threonine activation of the catabolic L-serine
          (L-threonine) deaminase (CHA1); Zinc-finger protein
          with Zn[2]-Cys[6] fungal-type binuclear cluster domain
          Length = 648

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRG 68
          R+   AC NCR R+ KC++       + PC  C + R EC+FT+ + R 
Sbjct: 38 RKRKLACQNCRRRRRKCNM-------EKPCSNCIKFRTECVFTQQDLRN 79

>Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {ON}
           YML076C (REAL)
          Length = 944

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNK 66
           K +R   AC+ C + K KC+    ++ +  PC RC + RK C F  S +
Sbjct: 67  KIKRNSFACVCCHSLKQKCEPSDANDIYRKPCRRCLKHRKLCKFDLSKR 115

>Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W
          (REAL)
          Length = 470

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 11/73 (15%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG---LRVANVSAIAE 80
          Q+C  CR R+VKCD        + PC RC +   +C + +  K+ G   +R  ++  IAE
Sbjct: 6  QSCDCCRVRRVKCD-------RNKPCNRCLQRHLKCTYLQPLKKRGPKSIRPGSLKKIAE 58

Query: 81 -NTANATASMSKA 92
            T +  ++M  A
Sbjct: 59 VQTISMNSNMMAA 71

>ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 1035

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
           K +R   AC++C + K KC     ++ +  PC+RC +  K C F
Sbjct: 100 KLKRNSFACISCHSLKQKCVPSDFNDIYRKPCIRCLKNGKLCRF 143

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa]
          {ON} Anc_6.279
          Length = 935

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAE 80
          QAC  CR +K+KC      +   P C +C +   EC ++   +R  L  A+++ + +
Sbjct: 11 QACDLCRVKKLKC------SKEKPKCAKCLKNNWECCYSPKTRRSPLTRAHLTKVED 61

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 7/88 (7%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K + +   C  C+ R++KCD G       P C +C R  +EC++    K    R  +  A
Sbjct: 141 KRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVYIIRTKNRKRRPKSTEA 194

Query: 78  IAENTANATASMSKAITSVFQGNTSEGS 105
             E +A A A + ++       N S GS
Sbjct: 195 SKE-SAQADALVRESNAPGLTTNPSGGS 221

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          +T++ C  CR RK+KCDL        P C +C+     C
Sbjct: 18 KTFEGCWTCRLRKIKCDLKK------PKCDKCRSSAISC 50

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
           ++   C+NC+ R+VKCD G       P C +C      C++
Sbjct: 92  KSKTGCINCKKRRVKCDEG------KPACKKCTNMSLSCVY 126

>KNAG0G03000 Chr7 (651063..651752) [690 bp, 229 aa] {ON} Anc_8.751
           YOR289W
          Length = 229

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 39/93 (41%), Gaps = 18/93 (19%)

Query: 840 LPPPRMNSLPE---TTNFAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTE 896
            PP ++  LPE   T N   N    +S Q   T   P  + DW   +  + L F +PW+ 
Sbjct: 94  FPPIQLRELPELHCTCNILDNFTIIYSKQQDSTGG-PQDIFDWDVGTHGVELKFRDPWSH 152

Query: 897 -----------MIEQQFISNDNNKTFENLYNQA 918
                      M+EQ +   D   TFENL  +A
Sbjct: 153 TLRSATFLPEVMLEQHW---DKRATFENLVQKA 182

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 7/74 (9%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K + +   C  C+ R++KCD G       P C +C R  +EC++   N +   R   V  
Sbjct: 156 KRKYSRNGCTECKKRRMKCDEGK------PSCWQCTRLNRECVYI-LNPKNKKRKPRVGR 208

Query: 78  IAENTANATASMSK 91
            A N+   +A+  K
Sbjct: 209 NAGNSTKHSAAKQK 222

>KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa]
          {ON} similar to uniprot|Q05958 Saccharomyces cerevisiae
          YLR228C ECM22 Sterol regulatory element binding protein
          regulates transcription of the sterol biosynthetic
          genes ERG2 and ERG3 member of the fungus-specific
          Zn[2]-Cys[6] binuclear cluster family of transcription
          factors homologous to Upc2p
          Length = 775

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 6/48 (12%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          +++   C +C+ R+VKCD      PH   C+ CK+   +C++T    R
Sbjct: 51 KKSKNGCDHCKRRRVKCD---ETRPH---CLNCKKMSLDCVYTPVQPR 92

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 6   RTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESN 65
           +++ ++Q  +  ++R ++  C  CR  KVKCD         P C RC +   EC++ +  
Sbjct: 21  KSINDSQVTKKKRYRLSF-VCQGCRRSKVKCD------QEKPVCSRCSKHDLECVY-DVT 72

Query: 66  KRGGLRVANVSAIAENTANATASMSKAITSVFQGNT--SEGSQQPD 109
           K+   R  N +A             K + S+ + N   S G+ + D
Sbjct: 73  KQHAPRNPNKAATMARLRREVEYWKKKVASLTEENAPISNGNNEND 118

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAE 80
           R  +AC  C+ RKVKCD        + PC+ C + +KEC +         R   V++   
Sbjct: 82  RVQKACELCKKRKVKCD-------GNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVR 134

Query: 81  NTANATASMSKAI 93
           + +   A  S++ 
Sbjct: 135 DVSKTYAETSESF 147

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 10/64 (15%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT---ESNKRGGLRVANVS 76
          +R  +AC  CR +K+KCD          PC  CK+  +EC +T   +  ++   RV+N  
Sbjct: 8  KRVSKACDACRAKKIKCD-------GCDPCSNCKKVSQECGYTYVVKKRQKPPTRVSNRK 60

Query: 77 AIAE 80
           +A+
Sbjct: 61 ILAD 64

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 855

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 8/41 (19%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHD-PPCVRCKRERKECI 60
          ++  AC  CRT+K+KCD       H+ P C +C R  K C+
Sbjct: 28 KSISACKRCRTKKIKCD-------HEFPSCKKCARANKPCV 61

>KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON}
          conserved hypothetical protein
          Length = 597

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF-TESNKRGGLRVANVSAI 78
          +R+   CL CR RK KCD         P C  CKR   ECI+   SN + G     +S +
Sbjct: 5  KRSSTGCLICRRRKKKCD------EVKPTCTACKRNFLECIWPNSSNTKDGKVGKKISQV 58

Query: 79 -AENT 82
           +E+T
Sbjct: 59 ESEDT 63

>NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa]
          {ON} 
          Length = 757

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 7/55 (12%)

Query: 11 TQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRC-KRERKECIFTES 64
          TQ I   + R+  ++C  CR RK+KCD       + P C +C  R+   CI+TE+
Sbjct: 6  TQNIGFKRRRKPIKSCAFCRGRKLKCD------KNKPICNQCLMRKHPTCIYTET 54

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON}
          Anc_1.277 YJL089W
          Length = 725

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 6/50 (12%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGL 70
          R  QAC  CR +K+KCD         P C  CK+    C  +    R GL
Sbjct: 11 RVSQACDRCRLKKIKCD------GQKPRCSNCKKINFNCAISTKLSRRGL 54

>Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K + +   C  C+ R++KCD         P C +C R  ++C++  + K    R +N S 
Sbjct: 145 KRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRQCVYVLNPKNKKRRTSNTSR 198

Query: 78  IAE 80
           + E
Sbjct: 199 VKE 201

>Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar to
          Ashbya gossypii ABR174W
          Length = 884

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 9/60 (15%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHD---PPCVRCKRERKECIFTESNKRGGLRVAN 74
          K +R   AC+ CR +K KCD       HD    PC RC ++   C+     +R   R  N
Sbjct: 31 KQKRKKFACVECRQQKSKCD------AHDRAPEPCTRCFKKNVPCVLQRDFRRTYKRARN 84

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 17/95 (17%)

Query: 1   MNNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECI 60
           MN+ K  L     +   K RR  +AC  CR +KVKCD          PC+ C     +C 
Sbjct: 49  MNSNK--LSNVASVTQKKRRRVTRACDECRKKKVKCD-------GQNPCIHCTVYSYKCS 99

Query: 61  FTESNKRGGLRVANVSAIAENTANATASMSKAITS 95
           + +  K+             NT+  +  +++ +TS
Sbjct: 100 YDQPVKKNNTN--------HNTSGFSKKLNQTVTS 126

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920
          aa] {ON} YMR019W (REAL)
          Length = 920

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 7/39 (17%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC 59
          R  +AC  C+ RKVKCD        + PC+ C + +KEC
Sbjct: 52 RVQKACELCKKRKVKCD-------GNKPCLNCFKHQKEC 83

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPL248C
          (GAL4)
          Length = 648

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 6/55 (10%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAI 78
          QAC +CR RK+KC      +   P C +C+ + + C+++   +R  L  A+++ +
Sbjct: 7  QACDSCRRRKMKC------SKTFPKCAKCREDNRVCLYSPKIRRSPLTRAHLTEV 55

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          +T +AC  CR +K +CD     +  +P C  C+R  K C F
Sbjct: 34 KTSRACDQCRGKKTRCDF----SDENPVCTSCQRMSKTCTF 70

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 9/53 (16%)

Query: 15 QPPKWRR--TYQACLNCRTRKVKCDLGPVDNPHDPPCVRCK-RERKECIFTES 64
          +PP+ +R  T ++C  CR RK+KCD         P C  C+ R   ECI++++
Sbjct: 22 KPPRKKRRSTIKSCSFCRRRKLKCD------KSKPLCSTCRARNFTECIYSDA 68

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRG 68
          R+   AC +CR R+ KCD+       + PC  C + + +C+F + + R 
Sbjct: 38 RKRKLACQSCRRRRRKCDM-------EKPCSNCIKFQTDCVFAQQDLRN 79

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 6/44 (13%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
           K + +   CL C+ R++KCD G       P C +C R  ++C++
Sbjct: 147 KRKYSRNGCLECKKRRMKCDEG------KPTCWQCARLNRKCVY 184

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
          similar to uniprot|P35995 Saccharomyces cerevisiae
          YKL222C Hypothetical ORF and similar to uniprot|Q12340
          Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRC-KRERKECIFTE 63
          K R+  ++CL CR RK+KCD         P C  C  R   EC++ E
Sbjct: 11 KRRKVIKSCLFCRKRKLKCD------HKKPKCSTCAARNLPECVYVE 51

>Kpol_2002.26 s2002 (52403..54820) [2418 bp, 805 aa] {ON}
           (52403..54820) [2418 nt, 806 aa]
          Length = 805

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 83/186 (44%), Gaps = 27/186 (14%)

Query: 15  QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN 74
           +P K R+T+ +C  CR  K +CD  P+       C RC   +  C  T+       R + 
Sbjct: 72  RPRKKRKTF-SCDVCRKFKTRCDFEPLVG----KCHRCNMLQLVCSLTKE------RESE 120

Query: 75  VSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELT-TMQDALE 133
           + A  E+++        +I S+ +     GS++    R+ + + +P+ + LT T+ + L 
Sbjct: 121 ILAAIEDSSKVATFPVTSIASIAKNIVKNGSERK--VRDTAKEQVPVLNPLTHTLTNRLN 178

Query: 134 FLAKAAGSVAKEDSRDLV--------DASTKYEELESQSN---SRTDTPISSGSAQDSTR 182
            L +   S+  E   +LV         A+T  +++  QS    +  D P+  GS  +++ 
Sbjct: 179 RLEEKFSSL--EGKIELVLMLLQGSTSAATNAKDVALQSMIQLNTMDKPLQFGSMSNTSI 236

Query: 183 NSNSAN 188
           N N  N
Sbjct: 237 NKNEFN 242

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON}
          conserved hypothetical protein
          Length = 639

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 14 IQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG 69
          I+  K  R+Y  C  C++ K KCD         P C  CK+   +C ++ + K GG
Sbjct: 5  IEMKKVARSYMGCQKCKSLKKKCD------EVKPHCGYCKKRGFQCDYSRTLKWGG 54

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 17  PKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANV 75
           PK +R  +AC +CR RK+KCD      P    C  C +   EC F   N     R A++
Sbjct: 131 PK-KRVSKACDHCRKRKIKCD---DVKPRTGKCSNCTKFNAECTFDHHNAMEKKRKAHL 185

>KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {ON}
           similar to uniprot|P08638 Saccharomyces cerevisiae
           YLR451W LEU3 Zinc-finger transcription factor that
           regulates genes involved in branched chain amino acid
           biosynthesis and ammonia assimilation positively
           regulated by alpha-isopropylmalate an intermediate in
           leucine biosynthesis
          Length = 925

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 124/335 (37%), Gaps = 70/335 (20%)

Query: 25  ACLNCRTRKVKCDLGPVDNPHD---PPCVRCKRERKECIFTESNKRGGLRVANVSAIAEN 81
           AC+ CR +K KCD       H+    PC RC ++   C+  +  +R   R  N   IA+ 
Sbjct: 48  ACVECRQQKSKCD------AHERAPEPCSRCLKKGVPCVLQKDFRRTCKRARN-EVIAKK 100

Query: 82  TANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEF-LAKAAG 140
               T S+S             GS+                 EL    DA    L +  G
Sbjct: 101 FQELTQSLSNL-----------GSE-----------------ELLKKLDAETLRLPEDLG 132

Query: 141 SVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIAPLLR 200
            +  E S     A   +++    + SR++   S+G  + + R   S N  D   IA    
Sbjct: 133 LIKVETS---TGAEAPWDQNSIGTGSRSN---STGGQEIALRTVLSTN--DFVSIAVSSN 184

Query: 201 PHGLGRPT---IPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHPF 257
             G G      I L ++    +PK    L D+        LS  +       F    HPF
Sbjct: 185 TTGSGTKLDGPITLTKQQLECQPK---TLGDV-------TLSSSDIANFFSEFTTKYHPF 234

Query: 258 FPHVPLQLQNPDEL-AQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIHERLWIYC 316
            P V +  + P+ + +  P L   I+ +  R   F+ + M N  SN     + E   I  
Sbjct: 235 LPVVDVT-KGPERIYSLSPCLFWVIILVGLR-RKFEAIEMMNKLSNMVKSILAE---ITI 289

Query: 317 QRLISQTVWAE----ASTRSIGTVLAFLLFTEWNP 347
             +I  T         +  S+ +V AFL++T W P
Sbjct: 290 SPIIRYTPMESDEPVLNVSSVYSVQAFLIYTYWPP 324

>KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa]
          {ON} 
          Length = 841

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 10 ETQQIQPPKWRRT--YQACLNCRTRKVKCDLGPVDNPHDPPCVRCK-RERKECIFTESNK 66
          +TQ  +  K RR    ++CL CR RK+KCD         P C  CK R +  CI+ +S  
Sbjct: 2  DTQHTRVAKQRRRKRVKSCLFCRHRKLKCDQAV------PLCSSCKVRNKTVCIYADSPD 55

Query: 67 RG 68
           G
Sbjct: 56 DG 57

>ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON}
          conserved hypothetical protein
          Length = 680

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          K +R  +AC  CR  K +C L P+  P++  C+RC+  +  C F +   R
Sbjct: 25 KGKRAVRACDTCRRLKTRCILSPI--PNEFYCLRCESLKIHCSFQDMFGR 72

>ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL015W (PUT3)
          Length = 835

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 7/66 (10%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIA 79
           +R   ACL CR R V+C       P   PC +C      C + E +K+  + +  +  + 
Sbjct: 55  KRAPLACLRCRRRHVRC-------PGGTPCAKCAVANIACEYLEPSKKLIVSMKYLQRLQ 107

Query: 80  ENTANA 85
           E+ A A
Sbjct: 108 EDLARA 113

>ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa]
          {ON} conserved hypothetical protein
          Length = 686

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          +R+   CL CR RK KCD         P C  C+R   +CI+ + N +
Sbjct: 28 KRSKSGCLTCRNRKKKCD------ETKPLCKGCRRNFLQCIWPQGNSK 69

>KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]
           {ON} weakly similar to uniprot|P26370 Saccharomyces
           cerevisiae YDL170W
          Length = 681

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 11/99 (11%)

Query: 15  QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN 74
           +P + R + + CL C+ RK +C      +   P C  C R   +C+F ++  +  +R   
Sbjct: 9   EPKRRRHSKKGCLTCKVRKKRC------SEDRPICKDCARLSLDCVFPDNLTKDQIRAYK 62

Query: 75  VSAIAE-----NTANATASMSKAITSVFQGNTSEGSQQP 108
           V    E        NA  S+S+  +S    +T      P
Sbjct: 63  VWLQTELKKKKLKVNAVMSISRDSSSAAGSSTLVNGHSP 101

>ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 736

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 8/78 (10%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF--TESNKRGGLRVANV 75
           K + +   C  C+ R++KCD         P C +C R  +EC++     NK+   R A +
Sbjct: 112 KRKYSRNGCTECKRRRMKCD------ETKPTCWQCARLNRECVYILNAKNKKRKPREARI 165

Query: 76  SAIAENTANATASMSKAI 93
            +   N     A  + +I
Sbjct: 166 KSTDRNNKKGLAKTNGSI 183

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 2/42 (4%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
           RR  +AC  CR RK+KCD   + N     C  C +   EC F
Sbjct: 117 RRVARACDRCRKRKIKCD--EIKNLKVNKCSNCVKYGAECTF 156

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
          (REAL)
          Length = 878

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAI 78
          QAC  CR +K+KC      +   P C +C +   EC ++   KR  L  A+++ +
Sbjct: 9  QACDICRLKKLKC------SKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEV 57

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
          (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          +R  +AC +CR RK+KC  GPV NP    C  C +    C F
Sbjct: 23 KRVPKACDHCRKRKIKC--GPV-NPITGTCENCNKFNTSCTF 61

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 8/89 (8%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESN----KRGGLRVANV 75
           +R  +AC +CR RK++CD   VD P    C  C + +  C F   +    K+  L +   
Sbjct: 130 KRVSKACDHCRKRKIRCD--EVD-PQTDKCSNCVKFQSVCTFKHRDEILQKKRKLEIKQH 186

Query: 76  SAIAENTANATASMSKAITSVFQGNTSEG 104
            A +E +  +  ++S   +S   GN   G
Sbjct: 187 LA-SEKSPQSQNNVSSYASSSLPGNNDNG 214

>ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} similar
          to gnl|GLV|KLLA0A04169g Kluyveromyces lactis
          KLLA0A04169g and some similarites with YDR213W
          uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
          involved in sterol uptake zinc finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 793

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          ++   C NC+ R+VKCD G       P C +C   + +C++T +  +
Sbjct: 42 KSKNGCDNCKRRRVKCDEG------KPLCRKCVNMKLDCVYTPAQPK 82

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCK-RERKECIFTES 64
           K R+  ++C  CR RK+KCD         P C  CK R   EC++T+ 
Sbjct: 82  KRRKVIKSCTFCRKRKLKCD------RKRPMCTGCKMRGLSECVYTDG 123

>TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.61
          YOR172W
          Length = 799

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 7/53 (13%)

Query: 11 TQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRC-KRERKECIFT 62
          T Q    K  +  ++C  CR RK+KCD       + P C  C  R+RKEC +T
Sbjct: 12 TNQGVKKKRNKLIKSCTFCRMRKLKCD------KNKPMCSTCVVRQRKECSYT 58

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
          PUT3Transcriptional activator of proline utilization
          genes, constitutively binds PUT1 and PUT2 promoter
          sequences as a dimer and undergoes a conformational
          change to form the active state; differentially
          phosphorylated in the presence of different nitrogen
          sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 8/54 (14%)

Query: 15 QPPK-WRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          QP K  +R+  ACL+CR R +KC       P   PC +C      C + E +K+
Sbjct: 22 QPQKRQQRSSVACLSCRKRHIKC-------PGGNPCQKCVTSNAICEYLEPSKK 68

>KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}
          Anc_7.56 YOR337W
          Length = 710

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 7/43 (16%)

Query: 25 ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          +C NCR R+ KCDLG        PC  C R   EC   E + R
Sbjct: 39 SCSNCRKRRKKCDLG-------FPCGNCTRLEIECNVNEDDLR 74

>Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C -
           Hypothetical ORF [contig 123] FULL
          Length = 779

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 57/141 (40%), Gaps = 12/141 (8%)

Query: 15  QPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN 74
           +P K R+TY +C  CR  K +CD  P+       C RC   + +C  T+       R   
Sbjct: 47  KPRKKRKTY-SCEVCRKFKTRCDFEPLVG----RCHRCSVLKLQCSLTKE------REDE 95

Query: 75  VSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPIN-SELTTMQDALE 133
           + A  E ++NAT +    + S         S        N ++ L  N + L +  D L 
Sbjct: 96  ILAAIETSSNATLTAPGPVGSDASSKDVLVSHPVASTLNNRLNKLEANLNSLNSKLDLLV 155

Query: 134 FLAKAAGSVAKEDSRDLVDAS 154
            LA+ + S     +   + AS
Sbjct: 156 LLAQGSHSAVANSTGSKISAS 176

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON}
          Anc_6.279
          Length = 890

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGL 70
          QAC NCR +K+KC      +   P C +C +   +C+++   KR  L
Sbjct: 18 QACDNCRLKKLKC------SKETPKCSKCLKNGMKCLYSPKVKRSPL 58

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGL 70
          +R  QAC  CR++K+KCD          PC  C +    C+ ++   R GL
Sbjct: 23 KRHSQACDRCRSKKIKCD-------GLQPCSNCAKIGYNCVTSDKLSRRGL 66

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
           {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 36/82 (43%), Gaps = 7/82 (8%)

Query: 20  RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIA 79
           R+  +AC NCR RK+KC           PC  C+  + +C+F+ S          +S   
Sbjct: 17  RKVNRACDNCRKRKIKCS-------ETTPCTNCQIYQCKCVFSSSASPPSKPNGKISKNG 69

Query: 80  ENTANATASMSKAITSVFQGNT 101
            +   +++ +    + V Q N+
Sbjct: 70  SSRLKSSSQLDSLGSKVSQNNS 91

>TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa]
          {ON} Anc_1.260 YJL103C
          Length = 496

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 38/91 (41%), Gaps = 19/91 (20%)

Query: 4  KKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF-- 61
          KK T FE +  +P     T +AC  C  + ++CD G        PC  C + R EC    
Sbjct: 3  KKLTDFEKKHRRP-----TVKACQMCHDKHIQCDKG-------RPCKNCIKRRTECHCKD 50

Query: 62 -----TESNKRGGLRVANVSAIAENTANATA 87
               T SN R  +   N S ++ N+    A
Sbjct: 51 IERKSTSSNLRHQINYKNASEMSLNSTVEVA 81

>Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {ON}
           YML076C (REAL)
          Length = 939

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNK 66
           K +R   AC+ C + K KC+    ++ +  PC RC + +K C F  S +
Sbjct: 67  KIKRNSFACVCCHSLKQKCEPSDTNDIYRKPCQRCLKHKKLCKFDLSKR 115

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTE 63
          K RR  +AC  CR +KVKC     D+ H  PC+ C     EC + +
Sbjct: 10 KRRRVTRACDECRKKKVKC-----DSRH--PCIHCTVYSYECTYNQ 48

>TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.56
           YOR337W
          Length = 662

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 8/78 (10%)

Query: 21  RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVAN-VSAIA 79
           R   AC NCR R+ KCDL         PC  C+R   EC   E + R     A  V ++ 
Sbjct: 35  RKRLACSNCRRRRKKCDLT-------YPCGNCQRLSLECNVNEEDLRKKRYAATYVKSLE 87

Query: 80  ENTANATASMSKAITSVF 97
            + A    S+   +  V+
Sbjct: 88  THIAYLETSLKNLVDKVY 105

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
          similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 10 ETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG 69
          E + I+    +R+ QAC  CR +K+KCD         P C  CK+   +C  ++   R G
Sbjct: 14 EERTIELSSVKRSSQACDRCRLKKIKCD------GVRPSCTSCKKIGYQCRTSDKLTRRG 67

Query: 70 L 70
           
Sbjct: 68 F 68

>Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa]
          {ON} YLR228C (REAL)
          Length = 814

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          ++   C NC+ R+VKCD G       P C +C   + +C+++
Sbjct: 40 KSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYS 75

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646
          bp, 881 aa] {ON} complement(81534..83840,83842..84180)
          [2646 nt, 882 aa]
          Length = 881

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 22 TYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAI 78
          T Q C +CR +K+KC      +   P C +C +   EC ++   KR  L  A+++ +
Sbjct: 6  TNQVCDSCRLKKLKC------SKEKPKCFKCLKHNWECNYSPKIKRSPLTRAHLTDV 56

>SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON}
          conserved hypothetical protein
          Length = 750

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          +R+   CL CR RK KCD         P C  CKR   +C++ 
Sbjct: 30 KRSKSGCLTCRKRKKKCDEA------RPRCTGCKRNLLDCVWV 66

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
          GAL4DNA-binding transcription factor required for the
          activation of the GAL genes in response to galactose;
          repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 24 QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAI 78
          QAC  CR +K+KC      +   P C +C +   EC ++   KR  L  A+++ +
Sbjct: 9  QACDICRLKKLKC------SKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEV 57

>NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON}
          Anc_5.322 YDR303C
          Length = 769

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 7/38 (18%)

Query: 25 ACLNCRTRKVKCDLGPVDNPHDPPCVRC-KRERKECIF 61
          AC+ CR RK+ CD G       P C  C K +R +CI+
Sbjct: 16 ACIQCRKRKIGCDRG------HPKCGNCIKLKRAQCIY 47

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa]
          {ON} Anc_2.565
          Length = 803

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVA 73
          R  +AC  C+ RKVKCD          PC  C +  K+C +T + K   ++ +
Sbjct: 20 RVQRACAICKKRKVKCD-------GMKPCSNCIKRSKDCTYTTAYKIPNMKYS 65

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 817

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 7/42 (16%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          R+T QAC++CR RKVKC+          PC  CK    EC +
Sbjct: 45 RKTPQACISCRRRKVKCN-------GCRPCSSCKTNGLECAY 79

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 7/50 (14%)

Query: 12 QQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          QQ    + RR++  C+ C+ +K++CD         P C RC+R  ++C++
Sbjct: 18 QQKSLRRQRRSH-VCITCKNQKLRCD------RERPSCSRCRRIGRDCVY 60

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 9/53 (16%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF---TESNKR 67
           K + +   C  C+ R++KCD G       P C +C R  +EC++   T++ KR
Sbjct: 141 KRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVYVIRTKNRKR 187

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 8/71 (11%)

Query: 15 QPPKWRRTYQ-ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVA 73
          +P   RR    AC+ CR R +KC  G        PC RC +   +C + E +K+  + + 
Sbjct: 17 EPSSKRRPKSLACILCRKRHIKCSGGN-------PCARCIKHDLKCEYIEPSKKIVVSLK 69

Query: 74 NVSAIAENTAN 84
           +  + ++ AN
Sbjct: 70 YLQQLQDSLAN 80

>YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON}
          ECM22Sterol regulatory element binding protein,
          regulates transcription of sterol biosynthetic genes;
          contains Zn[2]-Cys[6] binuclear cluster; homologous to
          Upc2p; relocates from intracellular membranes to
          perinuclear foci on sterol depletion
          Length = 814

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          ++   C NC+ R+VKCD G       P C +C   + +C+++
Sbjct: 39 KSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYS 74

>KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON}
          Anc_7.512 YLR451W
          Length = 766

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 20 RRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAI 78
          RR Y AC+ CR +K KCD          PC RCK++   C   +  KR   R A   AI
Sbjct: 13 RRKY-ACVECRQQKSKCDYT---TKFPEPCSRCKKKGIICAVKQGFKRTKKR-ATAEAI 66

>YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}
           LYS14Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway; requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 790

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 6/70 (8%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
           K + +   C  C+ R++KCD         P C +C R  ++C++  + K    R +N   
Sbjct: 151 KRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRQCVYVLNPKNKKRRTSNAQR 204

Query: 78  IAENTANATA 87
           + E   ++T+
Sbjct: 205 VKEFRKHSTS 214

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 8/86 (9%)

Query: 11 TQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGL 70
          T ++QP K  R  +AC  CR RKV+CD          PC+ C      C +  +++    
Sbjct: 18 TNRLQP-KRLRVSRACDVCRQRKVRCD-------GRQPCIHCTVYSYNCTYNPTSRTRKR 69

Query: 71 RVANVSAIAENTANATASMSKAITSV 96
            A  SA  ++     AS++ A  S 
Sbjct: 70 VRAKESAQPDDDGATAASVTAADASA 95

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 34.7 bits (78), Expect = 0.33,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 18/78 (23%)

Query: 24  QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGG---------LRVAN 74
           QAC  CR R+VKCD          PC RC +    C + +  ++ G          ++A 
Sbjct: 39  QACDCCRVRRVKCD-------GKGPCGRCLQRDLNCTYLQPLRKRGPKSIRSRSLKKIAC 91

Query: 75  VSAIAENTANATASMSKA 92
           V  ++EN  N T+S   A
Sbjct: 92  VQRVSEN--NGTSSTMTA 107

>Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa]
          {ON} YLR228C (REAL)
          Length = 812

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFT 62
          ++   C NC+ R+VKCD G       P C +C   + +C+++
Sbjct: 39 KSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYS 74

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
           K  +  +AC  CR +K+KCD     N     C  C+R  ++C F
Sbjct: 83  KRTKASRACDQCRKKKIKCDFTEAKN----ICSNCQRNAEKCTF 122

>Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172W
          (REAL)
          Length = 784

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 7/47 (14%)

Query: 18 KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCK-RERKECIFTE 63
          K R+  ++C  CR RK++CD         P C  CK + R +CI+TE
Sbjct: 23 KRRKPIRSCAFCRKRKLRCD------RQKPICSTCKTKGRSDCIYTE 63

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa]
          {ON} Anc_8.283 YLR098C
          Length = 664

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 7/57 (12%)

Query: 25 ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSAIAEN 81
          AC+ CR R+ KCD+         PC  C +    C+FT  + R     A+     EN
Sbjct: 18 ACITCRQRRRKCDM-------QEPCSICIKFGTRCVFTGEDLRKSRHSASYVKTLEN 67

>KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} similar
          to uniprot|Q754A1 Ashbya gossypii AFR171W AFR171Wp and
          weakly similar to YDR034C uniprot|P40971 Saccharomyces
          cerevisiae YDR034C LYS14 Transcriptional activator
          involved in regulation of genes of the lysine
          biosynthesis pathway requires 2-aminoadipate
          semialdehyde as co-inducer
          Length = 673

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 8/49 (16%)

Query: 15 QPPKWRRTY--QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
          +P K +R Y    CL C+ +KVKCD         P C +C     EC++
Sbjct: 15 EPAKKKRKYSKNGCLECKRKKVKCD------ETKPMCWQCTHLSLECVY 57

>SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} similar
          to uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer- mediated
          Activation Ty1 enhancer activator and to YLR098C
          uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
          Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain DNA-binding transcriptional
          activator or CHA1
          Length = 701

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 21 RTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKR 67
          R   AC NCR R+ KCDL       + PC  C R R +C   E + R
Sbjct: 50 RKRLACSNCRRRRKKCDL-------NYPCSSCVRLRLQCNVNEEDLR 89

>SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]
          {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
          AFR171Wp and some similarites with YDR034C
          uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
          Transcriptional activator involved in regulation of
          genes of the lysine biosynthesis pathway requires
          2-aminoadipate semialdehyde as co-inducer
          Length = 645

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 8/62 (12%)

Query: 20 RRTYQ--ACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77
          +R Y    C  C+ RKVKCD         P C +C    K C+++  + R     AN S 
Sbjct: 13 KRKYSKLGCTECKRRKVKCD------ETKPMCWQCSHLGKNCVYSSPSTRITFCEANFSG 66

Query: 78 IA 79
          + 
Sbjct: 67 VG 68

>ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR034C (LYS14)
          Length = 800

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 10/56 (17%)

Query: 16  PPKWRRTY--QACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKEC--IFTESNKR 67
           P + +R Y    C  C+ R++KCD G       P C +C R  +EC  I    NK+
Sbjct: 185 PKRTKRKYSRNGCTECKRRRMKCDEGK------PICWQCSRLNRECKYILNARNKK 234

>TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447
           bp, 1148 aa] {ON} Anc_5.577 YML034W
          Length = 1148

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 42/101 (41%), Gaps = 17/101 (16%)

Query: 2   NNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF 61
           N + +    + Q+   K  +  +ACL CR  K+ CD         P C  C ++ K CI+
Sbjct: 284 NERDKEKTSSDQLTFTKLNKKPRACLTCRKSKIGCDRTK------PDCNNCTKKNKTCIY 337

Query: 62  TE-------SNKRGGLRV----ANVSAIAENTANATASMSK 91
            +       SNK   L      A++    +NT  A   M+K
Sbjct: 338 PDVPSTANSSNKPKDLEKLHPNADLQNAVKNTEQADNHMNK 378

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,702,686
Number of extensions: 4421879
Number of successful extensions: 18257
Number of sequences better than 10.0: 608
Number of HSP's gapped: 18671
Number of HSP's successfully gapped: 615
Length of query: 930
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 811
Effective length of database: 39,836,145
Effective search space: 32307113595
Effective search space used: 32307113595
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)