Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G04862g5.524ON2444140864670.0
ADR200C5.524ON23384124941e-48
Suva_2.5975.524ON17974184491e-43
KLLA0A01826g5.524ON14642694472e-43
Ecym_40605.524ON22012654313e-41
YDR420W (HKR1)5.524ON18022484213e-40
KNAG0C032605.524ON15304824161e-39
Kwal_47.186505.524ON21592474152e-39
KLTH0G03696g5.524ON20852793936e-37
Skud_4.6945.524ON15042523919e-37
Smik_4.6955.524ON15553083882e-36
TDEL0A038805.524ON16962773712e-34
ZYRO0D12496g5.524ON23852663704e-34
CAGL0F03003g5.524ON11852493666e-34
TPHA0L003605.524ON11615653514e-32
KAFR0E033205.524ON11902873442e-31
Kpol_363.145.524ON7612503154e-28
SAKL0H23188g4.150ON12621012754e-23
KLTH0E08844g4.150ON15201082664e-22
Kwal_47.177034.150ON15681842512e-20
KLLA0C17985g4.150ON9081112387e-19
TPHA0K013904.150ON826872332e-18
YGR014W (MSB2)4.150ON1306832323e-18
NDAI0K025804.150ON9851142324e-18
ZYRO0G11242g4.150ON14871022315e-18
NCAS0A052304.150ON7851072305e-18
TDEL0D030104.150ON11231212191e-16
Skud_7.2994.150ON1169832136e-16
Ecym_73494.150ON11291232128e-16
Kpol_1062.374.150ON973942119e-16
Suva_7.2964.150ON1135832101e-15
AGR019C4.150ON1105752046e-15
Smik_7.3024.150ON11891272047e-15
KAFR0F034704.150ON9491231992e-14
KNAG0D035904.150ON994721966e-14
TBLA0G012104.150ON1825951913e-13
CAGL0F08833g4.150ON9361051591e-09
TBLA0G009505.524ON22532401573e-09
Kpol_163.1singletonON26630791.8
Smik_12.855.198ON25061782.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G04862g
         (2444 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...  2495   0.0  
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...   194   1e-48
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   177   1e-43
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   176   2e-43
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   170   3e-41
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   166   3e-40
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   164   1e-39
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...   164   2e-39
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   155   6e-37
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   155   9e-37
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...   154   2e-36
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   147   2e-34
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   147   4e-34
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...   145   6e-34
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...   139   4e-32
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...   137   2e-31
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...   125   4e-28
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...   110   4e-23
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...   107   4e-22
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...   101   2e-20
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...    96   7e-19
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...    94   2e-18
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...    94   3e-18
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    94   4e-18
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    94   5e-18
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...    93   5e-18
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...    89   1e-16
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...    87   6e-16
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...    86   8e-16
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    86   9e-16
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    86   1e-15
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...    83   6e-15
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    83   7e-15
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...    81   2e-14
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...    80   6e-14
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    78   3e-13
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    66   1e-09
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    65   3e-09
Kpol_163.1 s163 (208..1008) [801 bp, 266 aa] {ON} (208..1008) [8...    35   1.8  
Smik_12.85 Chr12 complement(170982..171734) [753 bp, 250 aa] {ON...    35   2.4  

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score = 2495 bits (6467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1238/1408 (87%), Positives = 1238/1408 (87%)

Query: 1037 YPIFTFGSDKPVFTQPTKGISENSIPTLNDQTPSTTPKSTETNPTQAGVSITNQELPTIS 1096
            YPIFTFGSDKPVFTQPTKGISENSIPTLNDQTPSTTPKSTETNPTQAGVSITNQELPTIS
Sbjct: 1037 YPIFTFGSDKPVFTQPTKGISENSIPTLNDQTPSTTPKSTETNPTQAGVSITNQELPTIS 1096

Query: 1097 TFTGNPSMQLXXXXXXXXXXXXXXXQETLENSQASSTPIENPPQSFIYSPTSYALVLTSE 1156
            TFTGNPSMQL               QETLENSQASSTPIENPPQSFIYSPTSYALVLTSE
Sbjct: 1097 TFTGNPSMQLTESISPSTIYTITPTQETLENSQASSTPIENPPQSFIYSPTSYALVLTSE 1156

Query: 1157 NVGPTSIQILTTSYQLQPITQTKNAQSSAPEYVADTLEQSTSPTVNQFQSTESPFVVSVI 1216
            NVGPTSIQILTTSYQLQPITQTKNAQSSAPEYVADTLEQSTSPTVNQFQSTESPFVVSVI
Sbjct: 1157 NVGPTSIQILTTSYQLQPITQTKNAQSSAPEYVADTLEQSTSPTVNQFQSTESPFVVSVI 1216

Query: 1217 DTSSVSANDISKKTVTEGAGKSTLTENQLESATYKTTNVVLIQSETSENNHLQSSNSVQM 1276
            DTSSVSANDISKKTVTEGAGKSTLTENQLESATYKTTNVVLIQSETSENNHLQSSNSVQM
Sbjct: 1217 DTSSVSANDISKKTVTEGAGKSTLTENQLESATYKTTNVVLIQSETSENNHLQSSNSVQM 1276

Query: 1277 LYTPTTLHSSDKSLTQPLEVNSLQSTYTSKNLQYFTTVLTKIYSTDSTVLMGSNFQSTGS 1336
            LYTPTTLHSSDKSLTQPLEVNSLQSTYTSKNLQYFTTVLTKIYSTDSTVLMGSNFQSTGS
Sbjct: 1277 LYTPTTLHSSDKSLTQPLEVNSLQSTYTSKNLQYFTTVLTKIYSTDSTVLMGSNFQSTGS 1336

Query: 1337 DSRVRPTKTESTDPKQTGSTYLTESTQHQGQSTISVTGLQSTGTSTRAQLTITASRAYKG 1396
            DSRVRPTKTESTDPKQTGSTYLTESTQHQGQSTISVTGLQSTGTSTRAQLTITASRAYKG
Sbjct: 1337 DSRVRPTKTESTDPKQTGSTYLTESTQHQGQSTISVTGLQSTGTSTRAQLTITASRAYKG 1396

Query: 1397 SSEVELQPVTSGSDDNTFRDVSKTGDSRSGFSTRYVTGMQHSQKAFSTQSPYTVLETSVT 1456
            SSEVELQPVTSGSDDNTFRDVSKTGDSRSGFSTRYVTGMQHSQKAFSTQSPYTVLETSVT
Sbjct: 1397 SSEVELQPVTSGSDDNTFRDVSKTGDSRSGFSTRYVTGMQHSQKAFSTQSPYTVLETSVT 1456

Query: 1457 PSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPA 1516
            PSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPA
Sbjct: 1457 PSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPA 1516

Query: 1517 GHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTL 1576
            GHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTL
Sbjct: 1517 GHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTL 1576

Query: 1577 LQRRLTSSAAEIDTCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVM 1636
            LQRRLTSSAAEIDTCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVM
Sbjct: 1577 LQRRLTSSAAEIDTCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVM 1636

Query: 1637 NSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKN 1696
            NSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKN
Sbjct: 1637 NSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKN 1696

Query: 1697 PENSLKALASLIDPSVPLTGLVDSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1756
            PENSLKALASLIDPSVPLTGLVDSD                                   
Sbjct: 1697 PENSLKALASLIDPSVPLTGLVDSDGNSVTNEEGGNSGSSGSNSSGDSDPSSGGSGESQG 1756

Query: 1757 XXXXXXXXXXXXXXXXYGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIG 1816
                            YGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIG
Sbjct: 1757 GANGDGSALGSLDDGAYGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIG 1816

Query: 1817 KRLKPNDKTWSSSPGAFYNHHYNSHYSDPNNPFYDPERSLREKCSFXXXXXXXXXXXXXX 1876
            KRLKPNDKTWSSSPGAFYNHHYNSHYSDPNNPFYDPERSLREKCSF              
Sbjct: 1817 KRLKPNDKTWSSSPGAFYNHHYNSHYSDPNNPFYDPERSLREKCSFDERYDYDYDTEEQD 1876

Query: 1877 GYLYDDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHNQLQSME 1936
            GYLYDDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHNQLQSME
Sbjct: 1877 GYLYDDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHNQLQSME 1936

Query: 1937 HIYEGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTDTVES 1996
            HIYEGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTDTVES
Sbjct: 1937 HIYEGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTDTVES 1996

Query: 1997 YNNNQYYKMNTLITTESSEQQVGNSLSVSGAGLALVSSSNEGSNGIIQLKSHDENYEDYF 2056
            YNNNQYYKMNTLITTESSEQQVGNSLSVSGAGLALVSSSNEGSNGIIQLKSHDENYEDYF
Sbjct: 1997 YNNNQYYKMNTLITTESSEQQVGNSLSVSGAGLALVSSSNEGSNGIIQLKSHDENYEDYF 2056

Query: 2057 YDSSHEDEGLPNVENTGTTKYNRTHALSLNINSNXXXXXXXXXXXXXXXXXXXXXXXXXX 2116
            YDSSHEDEGLPNVENTGTTKYNRTHALSLNINSN                          
Sbjct: 2057 YDSSHEDEGLPNVENTGTTKYNRTHALSLNINSNGDGYDEKEEEEDDDDGDVEDYAIDLD 2116

Query: 2117 XXXXXXXXXXGELDELDEEMYRRLSNFNELHGLQNRSSGTNTYESTVNQQIFAQLPXXXX 2176
                      GELDELDEEMYRRLSNFNELHGLQNRSSGTNTYESTVNQQIFAQLP    
Sbjct: 2117 DEDDVNDVIVGELDELDEEMYRRLSNFNELHGLQNRSSGTNTYESTVNQQIFAQLPTAST 2176

Query: 2177 XXXXXXXPHFKSQKTLSTSRPDNQDSAGDWSTSNSTASFMSPSVVIVXXXXXXXXXXXXX 2236
                   PHFKSQKTLSTSRPDNQDSAGDWSTSNSTASFMSPSVVIV             
Sbjct: 2177 ATSSYSTPHFKSQKTLSTSRPDNQDSAGDWSTSNSTASFMSPSVVIVGASAGEASLALST 2236

Query: 2237 XXXXXXXXXXXXXLNFDELMNNIPPDVAMAAAESTSRYLRTTPRSDVKKYNSSIHWDFEK 2296
                         LNFDELMNNIPPDVAMAAAESTSRYLRTTPRSDVKKYNSSIHWDFEK
Sbjct: 2237 PSKPKRPDRPSSTLNFDELMNNIPPDVAMAAAESTSRYLRTTPRSDVKKYNSSIHWDFEK 2296

Query: 2297 HPHNEVGDKPRNNQSLDNFSNKLTXXXXXXXXXXXXXXXXXPEVHATTAKTPSVALDSKD 2356
            HPHNEVGDKPRNNQSLDNFSNKLT                 PEVHATTAKTPSVALDSKD
Sbjct: 2297 HPHNEVGDKPRNNQSLDNFSNKLTSSSISSANNVAVASVFNPEVHATTAKTPSVALDSKD 2356

Query: 2357 HRQAEFQVDAISRKSTKNGHKSRSSWTKSITESVRHSVVLSTSHSRRGSLSKVIPATGPR 2416
            HRQAEFQVDAISRKSTKNGHKSRSSWTKSITESVRHSVVLSTSHSRRGSLSKVIPATGPR
Sbjct: 2357 HRQAEFQVDAISRKSTKNGHKSRSSWTKSITESVRHSVVLSTSHSRRGSLSKVIPATGPR 2416

Query: 2417 GHTREELKKIRISGPIFSENSLGWSAMK 2444
            GHTREELKKIRISGPIFSENSLGWSAMK
Sbjct: 2417 GHTREELKKIRISGPIFSENSLGWSAMK 2444

 Score = 1561 bits (4043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 816/881 (92%), Positives = 816/881 (92%)

Query: 1   MFSIRWKIRXXXXXXXXXINFDMVSAQVYENLDSAHFSNKTSILVSSSAYTNSDASTNLP 60
           MFSIRWKIR         INFDMVSAQVYENLDSAHFSNKTSILVSSSAYTNSDASTNLP
Sbjct: 1   MFSIRWKIRLLLLLYALLINFDMVSAQVYENLDSAHFSNKTSILVSSSAYTNSDASTNLP 60

Query: 61  RTSKPEQSISFGSSKTAGEAITGQLQESSSAISTDLEMSSNLVFPTSTILGSLKTGIIRS 120
           RTSKPEQSISFGSSKTAGEAITGQLQESSSAISTDLEMSSNLVFPTSTILGSLKTGIIRS
Sbjct: 61  RTSKPEQSISFGSSKTAGEAITGQLQESSSAISTDLEMSSNLVFPTSTILGSLKTGIIRS 120

Query: 121 STLSKAINNNGQPSLTASSVVAQSNSSPISSTDLPAESLQYLSHSASGTAGQVQTVRGDS 180
           STLSKAINNNGQPSLTASSVVAQSNSSPISSTDLPAESLQYLSHSASGTAGQVQTVRGDS
Sbjct: 121 STLSKAINNNGQPSLTASSVVAQSNSSPISSTDLPAESLQYLSHSASGTAGQVQTVRGDS 180

Query: 181 TRPLDGSSVEDDSLTITVPKTYASQPFHPELMKQYIKVGSGTLETSISTIPTDSYHLSEP 240
           TRPLDGSSVEDDSLTITVPKTYASQPFHPELMKQYIKVGSGTLETSISTIPTDSYHLSEP
Sbjct: 181 TRPLDGSSVEDDSLTITVPKTYASQPFHPELMKQYIKVGSGTLETSISTIPTDSYHLSEP 240

Query: 241 DKTPLSTEIKPSTTSSPLPAGTTNSATSSPQQVETADXXXXXXXXXGVEPPTTSSPLPVE 300
           DKTPLSTEIKPSTTSSPLPAGTTNSATSSPQQVETAD         GVEPPTTSSPLPVE
Sbjct: 241 DKTPLSTEIKPSTTSSPLPAGTTNSATSSPQQVETADSTTTSLLSTGVEPPTTSSPLPVE 300

Query: 301 TTNSATSSPLPTEATAAVPTEISEPNLVLSKTPDPSEELGSTPPLPGTMGSSAAQPTGTN 360
           TTNSATSSPLPTEATAAVPTEISEPNLVLSKTPDPSEELGSTPPLPGTMGSSAAQPTGTN
Sbjct: 301 TTNSATSSPLPTEATAAVPTEISEPNLVLSKTPDPSEELGSTPPLPGTMGSSAAQPTGTN 360

Query: 361 LITSVLAXXXXXXXXXXXXIDSTQSTVFEGTSDDFVYTFPVHTIIPTSGLDSATLTASIS 420
           LITSVLA            IDSTQSTVFEGTSDDFVYTFPVHTIIPTSGLDSATLTASIS
Sbjct: 361 LITSVLATTDTTGMTGSQTIDSTQSTVFEGTSDDFVYTFPVHTIIPTSGLDSATLTASIS 420

Query: 421 ENSAQPTGTNLATAVPTTRETTGMIGSQTIDSTQSTVFEGTSDDFVYTFPVHTIIPTSGL 480
           ENSAQPTGTNLATAVPTTRETTGMIGSQTIDSTQSTVFEGTSDDFVYTFPVHTIIPTSGL
Sbjct: 421 ENSAQPTGTNLATAVPTTRETTGMIGSQTIDSTQSTVFEGTSDDFVYTFPVHTIIPTSGL 480

Query: 481 DSATLTASISENSAQPTGTNLATAVPTTRETTDMIGSQTIDSTQSTVFEGTSDDFVYTFP 540
           DSATLTASISENSAQPTGTNLATAVPTTRETTDMIGSQTIDSTQSTVFEGTSDDFVYTFP
Sbjct: 481 DSATLTASISENSAQPTGTNLATAVPTTRETTDMIGSQTIDSTQSTVFEGTSDDFVYTFP 540

Query: 541 VHTIIPTSGLDSATLTASISENSAQPTGTNLATAVPTTRETTGMIGSQTIDSTQSTVFEG 600
           VHTIIPTSGLDSATLTASISENSAQPTGTNLATAVPTTRETTGMIGSQTIDSTQSTVFEG
Sbjct: 541 VHTIIPTSGLDSATLTASISENSAQPTGTNLATAVPTTRETTGMIGSQTIDSTQSTVFEG 600

Query: 601 TSDDFVYTFPVYTIIPTSGLDSATLTASISENSAQPTGTNLATAVPTTRETTGMIGSQTI 660
           TSDDFVYTFPVYTIIPTSGLDSATLTASISENSAQPTGTNLATAVPTTRETTGMIGSQTI
Sbjct: 601 TSDDFVYTFPVYTIIPTSGLDSATLTASISENSAQPTGTNLATAVPTTRETTGMIGSQTI 660

Query: 661 DSTQSTVFEGTSDDFVYTFPVYTIIPTSGLDSATLTASISENSAQPTGTNLATAVPTTRE 720
           DSTQSTVFEGTSDDFVYTFPVYTIIPTSGLDSATLTASISENSAQPTGTNLATAVPTTRE
Sbjct: 661 DSTQSTVFEGTSDDFVYTFPVYTIIPTSGLDSATLTASISENSAQPTGTNLATAVPTTRE 720

Query: 721 TTGMIGSQTIDSTQSTVFEGTSDDFVYTFPVYTIIPTSGLDSATLTASISENSVQPTSSS 780
           TTGMIGSQTIDSTQSTVFEGTSDDFVYTFPVYTIIPTSGLDSATLTASISENSVQPTSSS
Sbjct: 721 TTGMIGSQTIDSTQSTVFEGTSDDFVYTFPVYTIIPTSGLDSATLTASISENSVQPTSSS 780

Query: 781 EEQKVSFXXXXXXXXXXXXXXXXLAYLPIPSSKGTQXXXXXXXXXXXXXXXXXXXEKASQ 840
           EEQKVSF                LAYLPIPSSKGTQ                   EKASQ
Sbjct: 781 EEQKVSFTNEKTKSTNSKSTESTLAYLPIPSSKGTQFKSSSFTTRTVSTTSFGSTEKASQ 840

Query: 841 PTKSNDLRPESFTDNQSIPPKSESRGSTLTKSVKPSNSIIL 881
           PTKSNDLRPESFTDNQSIPPKSESRGSTLTKSVKPSNSIIL
Sbjct: 841 PTKSNDLRPESFTDNQSIPPKSESRGSTLTKSVKPSNSIIL 881

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score =  194 bits (494), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 136/412 (33%), Positives = 196/412 (47%), Gaps = 61/412 (14%)

Query: 1775 KMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGAFY 1834
            K++  ITKRL+I+L V +F   LW + +LY  +RLY I  +  ++   +K    S G FY
Sbjct: 1751 KITFKITKRLLIFLTVLTFGVFLWRLVFLYLFRRLYRINKVKSKIVLGEKKIPPSLGLFY 1810

Query: 1835 NHHYNSHYSDPN-NPFY--DPERSLREKCSFXXXXXXXXXXXXXXGYLYDD-LVVTGDNT 1890
            +H +N+  SD   +  Y  DPE+                      GY  DD ++VTG+NT
Sbjct: 1811 SHQFNNRLSDLKPSALYEGDPEK--------QDGTATDGSSGSVHGYATDDDIIVTGENT 1862

Query: 1891 VYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHN------QLQSMEHIYEGHDS 1944
            VYS S+G++Y IDE GNYYYAG+D   +  EQ  + + H        + +++H+      
Sbjct: 1863 VYSLSQGIAYHIDEEGNYYYAGIDPFTDAFEQEADCLYHESEVESVNVNNLDHL------ 1916

Query: 1945 IAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTDTVESYNNNQYYK 2004
                       + DI   ++D +GNIEL DSDF+   T  D     T+T+E YNNNQYYK
Sbjct: 1917 -----------SSDIKEENIDLDGNIELYDSDFD--HTSLDQVPKATETIEKYNNNQYYK 1963

Query: 2005 MNTLITTESSEQQVGNSLSVSG----AGLALVSSSNEGSNGIIQLKSH-DENYEDYFYDS 2059
            MNTLIT  S+ Q  GN++++S       + + + SNE S G I+L+    ENY+DY Y+ 
Sbjct: 1964 MNTLITDSSNCQ--GNTVALSSDYGTTSVHVENVSNENSLGFIRLQGDIPENYDDYLYEG 2021

Query: 2060 SHEDEGLPNVENTGTTKYNRTHALSLNINSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 2119
              +D      +N      + + A  L   SN                             
Sbjct: 2022 DEDD-----FDN------DSSAAAQLTQVSNLASQGIHLAASVQEPEYEDFDFARSEDDD 2070

Query: 2120 XXXXXXXGELDELDEEMYRRLSNFNELHGLQNRSSGTNTY---ESTVNQQIF 2168
                   G+ DELDEEMYR LS  N      +R  G N     +S+V Q+ F
Sbjct: 2071 DVSDVMLGDFDELDEEMYRHLSMIN---AFDSRFGGFNNMAAQDSSVYQRTF 2119

 Score =  121 bits (304), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 123/243 (50%), Gaps = 33/243 (13%)

Query: 1473 NWLPYSLIVESKDTSTQSSTTVDLGATSTL-PQAITPPTAVPQPAGHSLITIGFKEALNY 1531
            +WLP ++I ES      ++ +   G ++TL P AI P + V    G+ LI+IGF + LNY
Sbjct: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556

Query: 1532 PFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDTC 1591
             F+ S  LSSAQIF+FLP VL YPF S       +  + +++    ++R           
Sbjct: 1557 VFVTSFALSSAQIFTFLPPVLTYPFES-------HTEETVKIHDPTEKR----------- 1598

Query: 1592 SLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQIV 1651
                +    +   S          R  ++  +L   + +  ++V   TSD  ++ +  + 
Sbjct: 1599 --QLERPPPVSFYS----------RASRDTTTLSSFTHSQVIAVQKETSDVPDLSF--VK 1644

Query: 1652 VKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPS 1711
            VKQ+ P VS    YI ++A VYFP   +  LQ L+ +  S LY NP+ +LK  ASLIDP+
Sbjct: 1645 VKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPT 1704

Query: 1712 VPL 1714
            + +
Sbjct: 1705 IKV 1707

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 36/67 (53%), Gaps = 15/67 (22%)

Query: 2376 HKS-RSSWTKSITESVRHSVVLSTSHSRRGSLSKVIPATGPRGHTREELKKIRISGPIFS 2434
            HK  R SW K I   VR S  LS  H ++ S              ++++ K+RISGPI +
Sbjct: 2283 HKHHRHSW-KHIVTGVRSSKSLSKMHQKQSSR-------------KDKISKLRISGPIHT 2328

Query: 2435 ENSLGWS 2441
            E+SLGWS
Sbjct: 2329 EHSLGWS 2335

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  177 bits (449), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 147/418 (35%), Positives = 218/418 (52%), Gaps = 68/418 (16%)

Query: 1312 TTVLTKIYSTDSTVLMGSN--FQSTGSDSRVRPTKTESTDPKQTGSTYLTESTQHQGQST 1369
            T ++T+ +S     L GS   +QS  S   +   KT         +T L++ST+ +  ST
Sbjct: 1064 TNIVTQSFSETHERLTGSTRTYQS-NSQPSISNVKTTVNTQSHVLTTALSKSTKSKAGST 1122

Query: 1370 ISVTGLQSTGTSTRAQLTITASRAYKGSSEVELQPVTSGSDDNTFRDVSKTGDSRSGFST 1429
             S   L  T T +R +L++T ++    SS                    KTG+S SG ST
Sbjct: 1123 SSSNKLPETITDSRGKLSLTTTKTSHDSSL-------------------KTGESNSGVST 1163

Query: 1430 RYVTGMQHSQKAFSTQSPYTVLETSVTP---SSNDGPLHTSTISTHNWLPYSLIVESKDT 1486
            +  TG      + +TQ+      TS+T    +    P  TS  + + WLP ++IVE   +
Sbjct: 1164 KLSTGT----ISIATQTQAITASTSITAVPFTYATNPYTTS--NDYAWLPTAIIVEPTKS 1217

Query: 1487 STQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFS 1546
             T S+T+ +   T++LP  I P  AV +PA H+LITIGF   LNY FL+ +PLSSAQIF+
Sbjct: 1218 DT-STTSFNPSITASLPNVIAPAIAVTEPANHTLITIGFTAGLNYVFLVQNPLSSAQIFN 1276

Query: 1547 FLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDTCS--LSFQNYDKIQLV 1604
            FLP VL+YPFS T                   ++  SS  E+ + S  LS+Q+      +
Sbjct: 1277 FLPLVLKYPFSDTTS-----------------QQEESSTYEMGSSSFVLSYQSGSSTTTL 1319

Query: 1605 SVK----LALLKSTNRTDQENNSLHRRSVNDKVSVMNSTS-DSSNIDYSQIVVKQIIPLV 1659
            S +    + +++   +   +N            SVM++ + D  +I  S IVVKQI+P++
Sbjct: 1320 SPESVSSIPIVRKKKKKGGKN------------SVMSTANLDLPSIGNSSIVVKQIVPMI 1367

Query: 1660 SSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPSVPLTGL 1717
             SS +Y+++VAEVYFP  +I +LQ L+ + NS LY NP+ SL+ LA LID SVPL GL
Sbjct: 1368 DSSRSYVIAVAEVYFPTEAISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVPLGGL 1425

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 107/252 (42%), Gaps = 64/252 (25%)

Query: 1776 MSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKR------LKPNDKTW--- 1826
            M   ITKR IIYL   +   +L  +    F  R   + ++G+R        PN++     
Sbjct: 1475 MPWRITKRFIIYLTCLT-AGVLLWLLLALFAFRHRNV-LLGRRPSNCIEKTPNNERGLEG 1532

Query: 1827 ---SSSPGAFYNHHYNSHYSDPN---NPFYDPERSLREKCSFXXXXXXXXXXXXXXGYLY 1880
               S+S  +  NH+YN     PN     FY  E                           
Sbjct: 1533 VGVSTSRSSSDNHNYNEK--KPNTESESFYSMED-------------------------- 1564

Query: 1881 DDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHNQLQSM--EHI 1938
            D  + TG+NTVYS + GL Y +DE+G+ +Y     + N+ ++ NE  D   + S+  E +
Sbjct: 1565 DQYIPTGENTVYSATHGLHYTVDEDGDLFY--RKSMPNDIDEINENEDSG-IDSILRECV 1621

Query: 1939 YEGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDS-----DFNVPTTVTDVEGGKTDT 1993
            Y+ H       L DEE    I  +DVDE GNI L DS     + N P    +V       
Sbjct: 1622 YDRHQDTTEVYLNDEESMSSI--LDVDENGNIRLYDSYSEDDEPNCPHLQEEV------- 1672

Query: 1994 VESYNNNQYYKM 2005
            +E YNN+  YKM
Sbjct: 1673 IEDYNNSHVYKM 1684

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] {ON}
            some similarities with uniprot|P41809 Saccharomyces
            cerevisiae YDR420W HKR1 Serine/threonine rich cell
            surface protein that contains an EF hand motif involved
            in the regulation of cell wall beta-1 3 glucan synthesis
            and bud site selection overexpression confers resistance
            to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  176 bits (447), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 153/269 (56%), Gaps = 60/269 (22%)

Query: 1451 LETSVTPSSNDGPLHTSTISTHNWLPYSLIVE-SKDTSTQSSTTVDLGATSTLPQAITPP 1509
            + TSV+ + +   +++   S +NWLP +L++E +   +T ++T+ DLGATSTLPQAI P 
Sbjct: 699  MATSVSATLDGSIVNSGLTSNNNWLPTTLVIEPTAAHATSAATSADLGATSTLPQAINPA 758

Query: 1510 TAVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFS-STAGSVPIYRR 1568
            + VP P G+++IT+GFKE LNYPFLI++PL+SAQIF+FLP+VL  PF  +T G+ P+YRR
Sbjct: 759  SDVPLPDGYTVITVGFKEPLNYPFLIANPLASAQIFNFLPKVLVRPFQLTTTGAAPVYRR 818

Query: 1569 QDIEVMTLLQRRLTSSAAEIDTCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRS 1628
                   + ++ + +        S S   YD +Q+                         
Sbjct: 819  S----WNIFKKGINTHL-----LSSSLPTYDDVQV------------------------- 844

Query: 1629 VNDKVSVMNSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRN 1688
                                    K I+PLV  +++YIVS+AEVYFP  S+ TLQ LV +
Sbjct: 845  ------------------------KSIVPLVIQNVSYIVSIAEVYFPTESVHTLQELVLD 880

Query: 1689 QNSELYKNPENSLKALASLIDPSVPLTGL 1717
             +S LY NP + L  LASLI+P++PLTGL
Sbjct: 881  SSSILYSNPVSYLADLASLINPAIPLTGL 909

 Score =  133 bits (334), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 104/386 (26%), Positives = 173/386 (44%), Gaps = 44/386 (11%)

Query: 1783 RLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGAFYNHHYNSHY 1842
            R +  + V +   +  +   L FLK LY      +R+   +K W   P  FY+HH N   
Sbjct: 974  RFVCMVTVLTAFILCLVGLILVFLKNLYKRTNCAQRMHLTEKNWPEIP-TFYSHHMNGST 1032

Query: 1843 SDP-NNPFYDPERSLREKCSFXXXXXXXXXXXXXXGYLYDDLVVTGDNTVYSTSRGLSYF 1901
              P  N FY          S                Y+ DDL++TG+NTVYS S+G++Y+
Sbjct: 1033 DSPMRNMFY--------SGSQFSDSDTTEEDSHSAEYIDDDLIITGENTVYSISQGITYY 1084

Query: 1902 IDENGNYYYAGM--DFIVNENEQANEFV-DHNQLQSMEHIYEGHDSIAGGALIDEEGAFD 1958
            +DE+GN+++AG+  D   +E E+  + + D  +  ++E I   ++      L DE   FD
Sbjct: 1085 VDEDGNFFFAGVGKDVHTSEPEKLEKIIHDKTETVTVEPILPYYNE-KDDDLTDETEPFD 1143

Query: 1959 INAVDVDEEGNIELPDSDFN--VPTTVTDVEGGKTDTVESYNNNQYYKM---NTLITTES 2013
            +  ++VDE+GNI LP+SD    +    +D E  ++ +    N+  Y +    N   +  S
Sbjct: 1144 MGELEVDEDGNIALPESDLENTILQVASDREEIRSRSPIGTNDGSYLQHQIPNIFPSVTS 1203

Query: 2014 SEQQVGNSLSVSGAGLALVSSSNEGSNGIIQLKSHDENYEDYFYDSSHED-EGLPNVENT 2072
            +   V +    +     L+SS+  GS GI+ L  ++  Y++Y YD++ ++ +  P + N+
Sbjct: 1204 NSAHVNSDTMATAVTQTLLSSN--GSGGILDLTGNNGTYDEYLYDATQDEIDDPPIITNS 1261

Query: 2073 GTTKYNRTHALSLNINSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGELDEL 2132
            G  +++  H  S                                          G+ DE 
Sbjct: 1262 GLEEFSSGHISS-------------------IDLDDEIDIDIEDYDDDVSDVNVGDYDEF 1302

Query: 2133 DEEMYRRLSNFNELHGLQNRSSGTNT 2158
            DEEMYR LS  +    LQN  SG++T
Sbjct: 1303 DEEMYRHLSRSD---ILQNFGSGSST 1325

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  170 bits (431), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 150/265 (56%), Gaps = 37/265 (13%)

Query: 1455 VTPSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQ 1514
            + P SN  P  TS      WLP +++  S  TS + STTV   AT TLP+AITP T V +
Sbjct: 1310 IAPKSN--PSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAK 1367

Query: 1515 PAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVM 1574
            P  + LITIGF + LNY FL+S+P++SAQIFSFLP +L YP+        I  ++     
Sbjct: 1368 PDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPY--------IENKE----- 1414

Query: 1575 TLLQRRLTSSAAEI--DTCSLS---FQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSV 1629
             LL R +  S   I  +  S+S   F  Y  + L        K TN T+     + RR  
Sbjct: 1415 ALLLRHINESNNNILGNRGSVSGSYFNIYGNLSLEH------KHTNSTEP----VKRRQN 1464

Query: 1630 NDKVSVMNSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQ 1689
            N++      TSD     YSQIVVKQI+P +    +Y  SVAEVYFP  ++ +L+++V ++
Sbjct: 1465 NEE-----DTSDEHG--YSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADK 1517

Query: 1690 NSELYKNPENSLKALASLIDPSVPL 1714
            NS+LY NP  +L  LASL+DP +P+
Sbjct: 1518 NSKLYLNPVATLNQLASLVDPRIPV 1542

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 108/301 (35%), Positives = 164/301 (54%), Gaps = 27/301 (8%)

Query: 1776 MSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGAFYN 1835
            MS A  KR++I+ L FSF  +LWI+ +L+ LKRLY +  I  ++   +K+  ++ G  YN
Sbjct: 1588 MSPATRKRILIFSLAFSFGVLLWILIFLFLLKRLYKVSKIRSKIVLREKSIPNNLGISYN 1647

Query: 1836 HHYNSHYSD-PNNPFY--DPERSLREKCSFXXXXXXXXXXXXXXGYLYDDLVVTGDNTVY 1892
            H +N   SD   + FY  DPER+   + +                +  DD++VTG+NTVY
Sbjct: 1648 HQFNDRLSDLKTDAFYDGDPERNFNSQSTNSSSNHDSVPDS----FTDDDMIVTGENTVY 1703

Query: 1893 STSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHNQLQSMEHIYEGHDSIAGGALID 1952
            S S+G++Y IDE GNYYYA ++   N  E   + +         +I E     +G   ID
Sbjct: 1704 SLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQESGGETININEAQYMSSG---ID 1760

Query: 1953 EEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTD-TVESYNNNQYYKMNTLITT 2011
             E        D+D+EGNIE+ + +F+ P  ++ ++  K D  +E YN NQYY M+T++ T
Sbjct: 1761 LE--------DIDQEGNIEISELEFHHPELLSHLQ--KDDGIIEHYNKNQYYNMSTIV-T 1809

Query: 2012 ESSEQQVGNSLSVS---GAGLALVSSSNEGSNGIIQLK-SHDENYEDYFYDSSHEDEGLP 2067
            ESS  Q  N++ +S   G  + +   SNE S G I+L  S  +NY+DY Y+   +D  L 
Sbjct: 1810 ESSNPQC-NTVGLSSEPGMSVNVEDLSNENSVGFIRLHGSSSDNYDDYLYEGDEDDIELV 1868

Query: 2068 N 2068
            N
Sbjct: 1869 N 1869

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  166 bits (421), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 142/248 (57%), Gaps = 28/248 (11%)

Query: 1471 THNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALN 1530
            ++ WLP ++IVES +T   ++ + +   T +LP AI P  AV +P  H+LITIGF  ALN
Sbjct: 1207 SYAWLPTAIIVESSETG-PTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALN 1265

Query: 1531 YPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDT 1590
            Y FL+ +PLSSAQIF+FLP VL+YPFS+T+                    L +S  E+ T
Sbjct: 1266 YVFLVQNPLSSAQIFNFLPLVLKYPFSNTSS------------------ELDNSIGELST 1307

Query: 1591 CSLSFQNYDKIQLVSVK-LALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQ 1649
              LS+++      +S K ++ L    +   +      +S  D             +D S 
Sbjct: 1308 FILSYRSGSSTTTLSPKSISSLSVVKKKKNQQKKNATKSTEDL--------HPPQVDTSS 1359

Query: 1650 IVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLID 1709
            I VK+I+P+V SS  YIVSVAEVYFP  ++  LQ+L+ ++NS LY NP+  L++LA LID
Sbjct: 1360 IAVKKIVPMVDSSKAYIVSVAEVYFPTEAVTYLQQLILDENSTLYSNPQTPLRSLAGLID 1419

Query: 1710 PSVPLTGL 1717
              +PL GL
Sbjct: 1420 SGIPLGGL 1427

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 101/242 (41%), Gaps = 68/242 (28%)

Query: 1783 RLIIYLLVFSFVTILWI-VAWLYF------LKRLYGIEVIGK------RLKPNDKTWSSS 1829
            ++II+L+V +   +LW+ VA+  F      LKR +    IGK       L+  + + SSS
Sbjct: 1485 KIIIFLIVLTIGVLLWLFVAFFAFRHRNILLKR-HPRNCIGKSLNNERELESTELSRSSS 1543

Query: 1830 PGAFYNHHYNSHYSDPNNPFYDPERSLREKCSFXXXXXXXXXXXXXXGYLYDDLVVTGDN 1889
                YN                P  S  E                    + D  +VTG+N
Sbjct: 1544 GNQVYNEK--------------PPESENESV---------------YSAVDDHYIVTGEN 1574

Query: 1890 TVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHNQLQSM--EHIYEGHDSIAG 1947
            TVY+T   L Y I+++G+  Y   D I  + +Q N   D + + S+  + +Y+ +     
Sbjct: 1575 TVYNTIHRLHYTINDDGDLLY--RDAIPLDFDQTNG-DDGSGIDSIVRDCVYDKNQDATE 1631

Query: 1948 GALIDEEGAFDINAVDVDEEGNIELPDS--------DFNVPTTVTDVEGGKTDTVESYNN 1999
              L DEE    I  +DVDE G+I L DS         F++P  V          +E+YN 
Sbjct: 1632 AFLNDEESISGI--LDVDENGDIRLYDSYSDNEESNSFHLPDEV----------IENYNK 1679

Query: 2000 NQ 2001
            N 
Sbjct: 1680 NH 1681

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  164 bits (416), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 135/482 (28%), Positives = 197/482 (40%), Gaps = 70/482 (14%)

Query: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533
            WLP ++I+ S   ST    T    +T++LP AI P   +  P    LITIGF   LNY F
Sbjct: 888  WLPTNIIIASNADSTH---TARAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAF 944

Query: 1534 LISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEI-DTCS 1592
            L+ +PLSSAQ+F FLP VL +P    A      + Q  ++ T L   L  +   + D   
Sbjct: 945  LVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRKNRKTVTDMTR 1004

Query: 1593 LSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQIVV 1652
             +  N ++    S+ LA                       VS   + S+   + +  I V
Sbjct: 1005 ANVVNQNEATSSSLNLA-----------------------VSSEATGSNDVELIFKNIRV 1041

Query: 1653 KQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPSV 1712
            KQIIPLV    +YI SVAEVYFP   ID+L  L+ + NS LY NP+ +   LASLID ++
Sbjct: 1042 KQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAI 1101

Query: 1713 PLTGLVDSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1772
            PLT L  +D                                                   
Sbjct: 1102 PLTSLRKND--------GQSNTSTDSSSDVNSNESTGDDAFQNAEEYLRVSGAMDLSNIK 1153

Query: 1773 YGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGA 1832
              K++  I  R+I++L   +    LWI  +L   +    I    ++LK ++    S P  
Sbjct: 1154 VSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFR----ITNKSRKLKDSNLKKGSLP-- 1207

Query: 1833 FYNHHYNSHYSDPNNPFYDPERSLREKCSFXXXXXXXXXXXXXXGYLYDDLVVT----GD 1888
             Y            NP+       RE   F                 Y D   +    G+
Sbjct: 1208 LYQQ----------NPY-------RENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGE 1250

Query: 1889 NTVYSTSRGLSYFIDENGNYYYAG---MDFIVNENEQANEFVDHNQ---LQ--SMEHIYE 1940
            N +  +++G+ Y +D  GNYYY G    + +  E+E++  +   NQ   LQ  S++H Y 
Sbjct: 1251 NIIVDSAQGIQYKVDNEGNYYYNGNHLAEGMPEEDEESARYKQENQSTELQSDSIDHFYG 1310

Query: 1941 GH 1942
             H
Sbjct: 1311 SH 1312

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score =  164 bits (415), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/247 (39%), Positives = 144/247 (58%), Gaps = 23/247 (9%)

Query: 1473 NWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYP 1532
            +WLP  L+  S   S  + ++ D  AT+TLPQ I P T V  PA +S ITIGF++ALNYP
Sbjct: 1303 DWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYP 1362

Query: 1533 FLISHPLSSAQIFSFLPRVLQYPFSSTAG-SVPIYRRQDIEVMTLLQRRLTSSAAEIDTC 1591
            FLI +PL+SAQIF FLP VL+YPF S    +  +   Q         R        ++  
Sbjct: 1363 FLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRD-----GHLENT 1417

Query: 1592 SLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQIV 1651
            +LS    D+ +L   K  L   TN   ++  +L  R        M++ + + + ++S++V
Sbjct: 1418 NLS---EDERKL---KNGL---TNHIFEDGQALQYR--------MHNRTGAFSANFSEVV 1460

Query: 1652 VKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPS 1711
            V  IIPL+ S  +YI SVA VYFP  +++ LQ+++ N  S LY NP+++ ++LA LIDP 
Sbjct: 1461 VSSIIPLIISGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPK 1520

Query: 1712 VPLTGLV 1718
            +P+TGLV
Sbjct: 1521 IPITGLV 1527

 Score =  130 bits (327), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 117/408 (28%), Positives = 180/408 (44%), Gaps = 51/408 (12%)

Query: 1776 MSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGAFYN 1835
            MS ++ K+LII+L VF     LW++  L F   L G +   K+    DK WS    A  +
Sbjct: 1582 MSFSVAKKLIIFLPVFLVSIALWVLLGLLFFGGLVGSKNKNKQDPLPDKKWSVDEKALQS 1641

Query: 1836 HHYNSHYSDPNNPFYDPERSLREKCSFXXXXXXXXXXXXXXGYL-YDDLVVTGDNTVYST 1894
                         ++DP   + +   +               +   +DL+  G+   +S 
Sbjct: 1642 -------------YFDPHPDVEK---YPGSAWSSTSDSNSDDFRSEEDLLAVGNGLFFSR 1685

Query: 1895 SRGLSYFIDENGNYYYAGM-DFIVNENE---QANEFVDHNQ-LQSMEHIY-EGHDSIAGG 1948
            S GL+Y +  +GN+YYAG  D +  +N+   QA    D ++ L ++  ++ EG   +   
Sbjct: 1686 STGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEGE--VNNE 1743

Query: 1949 ALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTDTVESYNNNQYYKMNTL 2008
            AL   +   D++ + VDE+GN+ELP +D    +     E   TDT+ESYNN QYYKMN L
Sbjct: 1744 ALHLSQVGQDLDEIIVDEDGNVELPLADLEQLS----FEENNTDTIESYNNQQYYKMNQL 1799

Query: 2009 IT-----------TESSEQQVGNSLSVSGAGLALVSSSNEGSNGIIQLKSHDENYEDYFY 2057
            ++           T S  +  G  +  +   +     S+E SN + QL   DEN EDYFY
Sbjct: 1800 LSAITGADIQDALTSSGHETTGEGIPSNYNEVKDAPLSSESSNLVAQLSGGDENLEDYFY 1859

Query: 2058 DSSH--EDEGLPNVENTGTTKYNRTHALSLNINSNXXXXXXXXXXXXXXXXXXXXXXXXX 2115
                  ED    ++  + +   N       N++S+                         
Sbjct: 1860 SEIEPLEDPEEAHIAQSDSEDSNDVE--DFNVDSD-------TEEEWEREEHYEEGDEEG 1910

Query: 2116 XXXXXXXXXXXGELDELDEEMYRRLSNFNELHGLQNRSSGTNTYESTV 2163
                       GE DELDEEMYRRLS+ + + G +  SSG+NT+ S V
Sbjct: 1911 DEADDVNDIHIGEFDELDEEMYRRLSSVSGITGFRGGSSGSNTFPSVV 1958

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 4/100 (4%)

Query: 2340 VHATTAKTPSVALDSKDHRQAEFQVDAISRKSTKNGHKSRSSWTKSITESVRHSVVLSTS 2399
            +H    K       S   +Q+ F+       S K   K R+S+ +SI +++  + V   +
Sbjct: 2064 IHTALRKHKKSVGGSSAQKQSAFERTRSVTVSEKEKSK-RASFRRSIADTLHSANVFGGT 2122

Query: 2400 HSRRGSLSKVIPATGPRGHTREELKKIRISGPIFSENSLG 2439
              +R   S  +   GPRGHTREE+  IRISGPI+SENSLG
Sbjct: 2123 GRKR---SSTVNEVGPRGHTREEVHNIRISGPIYSENSLG 2159

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  155 bits (393), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 150/279 (53%), Gaps = 51/279 (18%)

Query: 1451 LETSVTPSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPT 1510
            L T + PSS +    TS     +WLP +++  S   S  + ++ D  AT+TLPQAI PPT
Sbjct: 1209 LATVLAPSSTNSEGSTS----MDWLPSNIVTASYTGSAHTQSSFDADATATLPQAIMPPT 1264

Query: 1511 AVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQD 1570
             V  P  +S ITIGFKE+LNYPFLI +PL+SAQIF FLP +L+YPFS       +   + 
Sbjct: 1265 PVTMPPNYSQITIGFKESLNYPFLIENPLASAQIFGFLPEILRYPFS-------VRASRS 1317

Query: 1571 IEVMTLLQRRLTSSAAEIDTCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVN 1630
                + ++R L   +  +                     LL        +N++L    +N
Sbjct: 1318 NSSTSSVKRDLVGDSGNL---------------------LL--------DNSTLILDKLN 1348

Query: 1631 DKVSVM-----------NSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSI 1679
             K S+M           N + ++   ++S + V  I+PL+ S  +YI SVA VYFP  ++
Sbjct: 1349 WKTSIMNSLSSNVSVSRNGSHNAFRANFSGVAVSSIVPLIVSGNDYITSVAVVYFPTEAV 1408

Query: 1680 DTLQRLVRNQNSELYKNPENSLKALASLIDPSVPLTGLV 1718
            + LQ+++ N  S +YKNP+ SL+ +A LID  +P+TG++
Sbjct: 1409 EVLQKMIINGASRIYKNPDQSLRDMALLIDSKIPITGII 1447

 Score =  111 bits (278), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 112/447 (25%), Positives = 172/447 (38%), Gaps = 112/447 (25%)

Query: 1781 TKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGAFYNHHYNS 1840
            TKRL+I+L VF     +WI   L F   L+    +       +K W++      N+   +
Sbjct: 1506 TKRLVIFLPVFIVAVTMWISLGLLFFGSLFRKGSLQGMAGNLEKKWNTDQKTLDNYFGIT 1565

Query: 1841 HYSDPNNPFYDPERSLREKCSFXXXXXXXXXXXXXXGYLYDDLVVTGDNTVYSTSRGLSY 1900
             +        D E++L    SF                    L+  G+   +S S GL+Y
Sbjct: 1566 EFIGKRQS-ADLEKNL--AGSFHNDESSSDAFDDDD------LLAVGNGMFFSKSTGLTY 1616

Query: 1901 FIDENGNYYYAGMDFIVNENEQANEFV------DHNQLQSMEHIYEGHDS---------- 1944
             +D  GN++YAG          AN+ V        ++L++   +  G             
Sbjct: 1617 HVDREGNFFYAGT---------ANKAVLPLKSKSTSKLEASNMVPNGESDPKNEANEANE 1667

Query: 1945 ------------------IAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDV 1986
                               + G   D+    ++   DVDE+GN+EL  SD         +
Sbjct: 1668 AKEEGEENEERKENEEKPCSNGEFRDDA---EVEEFDVDEDGNVELSVSDLE----RLSL 1720

Query: 1987 EGGKTDTVESYNNNQYYKMNTLI------------TTESSEQQVGNSLSVSGAGLALVSS 2034
            +   +DT+ESYNN QYYKM  L+            +TE +E   GN +S +G    L+  
Sbjct: 1721 DEHNSDTIESYNNQQYYKMKQLLQNLNNDDIEGAFSTE-NEGAAGN-ISSTGNESKLMPL 1778

Query: 2035 SNEGSNGIIQLKSHDENYEDYFYDSSHEDEGL---------PNVENTGTTKYNRTHALSL 2085
            S+E S  ++QL + D+N E+YFY    + EG+         P  E+    +         
Sbjct: 1779 SSESSKLLVQLSTDDDNLEEYFYSEEAQLEGIGKTTSPQPEPESEDNDDVE-------DF 1831

Query: 2086 NINSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGELDELDEEMYRRLSNFNE 2145
            NI+S+                                    GE DELDE MYRR S+ + 
Sbjct: 1832 NIDSD-----------------------SEEEGEDVNDVHVGEFDELDEVMYRRFSSASG 1868

Query: 2146 LHGLQNRSSGTNTYESTVNQQIFAQLP 2172
            L   Q  SS +NT+ S + Q+    LP
Sbjct: 1869 LTRFQGGSSSSNTFISLMQQRNSNMLP 1895

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 47/71 (66%), Gaps = 5/71 (7%)

Query: 2370 KSTKNGHKSRSSWTKSITESVRHSVVLSTS-HSRRGSLSKVIPATGPRGHTREELKKIRI 2428
            K +K     RSS+ KS+ E++  + V S S   R  +L+ V    GPRGHTREEL KIRI
Sbjct: 2019 KISKKEKSRRSSFRKSVAETLHSANVFSGSTRGRSSTLNDV----GPRGHTREELNKIRI 2074

Query: 2429 SGPIFSENSLG 2439
            SGPI+SENSLG
Sbjct: 2075 SGPIYSENSLG 2085

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  155 bits (391), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 98/252 (38%), Positives = 144/252 (57%), Gaps = 38/252 (15%)

Query: 1472 HNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNY 1531
            + WLP ++IVE   T + S+   +   T +LP  I P  AV +PA H+LIT+GF   LNY
Sbjct: 916  YAWLPTTIIVEPSQTGS-STAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNY 974

Query: 1532 PFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDTC 1591
             FL+ +PLSSAQIF+FLP VL YPFS+T        R +++          SS   + + 
Sbjct: 975  EFLVQNPLSSAQIFNFLPLVLGYPFSNT--------RLEVQ----------SSTQGLSSF 1016

Query: 1592 SLSFQNYDKIQLVSVK----LALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSD--SSNI 1645
             LS+Q+      +S K    L+++K   + ++ N                ST+D    +I
Sbjct: 1017 VLSYQSGTSTTTLSPKSVSSLSIVKKKKKGEKRN-------------ATASTADLYLPSI 1063

Query: 1646 DYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALA 1705
            + S IVVKQI+P+V+SS  Y+++VAEVYFP  +I  LQ+L+ + +S +Y NP+  L+ LA
Sbjct: 1064 ETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLA 1123

Query: 1706 SLIDPSVPLTGL 1717
             LID  +PL GL
Sbjct: 1124 GLIDSRIPLGGL 1135

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 15/130 (11%)

Query: 1881 DDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHN-QLQSMEHIY 1939
            D  +VTG+NT+YST+ GL Y ++++G+ +Y   + + N+  Q N   D    +   E +Y
Sbjct: 1273 DHYIVTGENTIYSTTHGLHYTMNDDGDLFY--REAVPNDLNQLNGGEDLEIDVIVRECVY 1330

Query: 1940 EGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGK----TDTVE 1995
            +         L D E    I  +DVDE GNI L DS  +      D E  +     + ++
Sbjct: 1331 DKDQDTTEAYLNDGESVSSI--LDVDENGNIRLHDSYSD------DGESNRYHLQDEVID 1382

Query: 1996 SYNNNQYYKM 2005
             YNN+  YK+
Sbjct: 1383 DYNNSHLYKI 1392

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score =  154 bits (388), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 117/308 (37%), Positives = 164/308 (53%), Gaps = 43/308 (13%)

Query: 1417 VSKTGDSRSGFSTRYVTG----MQHSQKAFSTQSPYTVLE---TSVTPSSNDGPLHTSTI 1469
            +SKT +S S  ST+  TG       +Q   + +SP  VL    T++  SSN         
Sbjct: 914  LSKTSESYSRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSN--------- 964

Query: 1470 STHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEAL 1529
             ++ WLP ++IV+S +T T S+T  +   T +LP  I P     +P  H+LIT+GF  AL
Sbjct: 965  -SYAWLPTAIIVQSSETDT-STTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAAL 1022

Query: 1530 NYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEID 1589
            NY FL+ +PLSSAQIF+FLP VL+YPFS T+  V      ++    L  R  TS      
Sbjct: 1023 NYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVE-SSNGELSSFILSYRSGTS------ 1075

Query: 1590 TCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQ 1649
            T +LS Q+   + +V  K    K    T   +  L+  S+N                 S 
Sbjct: 1076 TTTLSPQSKSSLSIVRKKKKGDKEKPPTSTMD--LYFPSINA----------------SS 1117

Query: 1650 IVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLID 1709
            I VKQI+P++ SS  YI++VAEVYFP  ++  LQ L+ + NS LY NP++ L+ LA LID
Sbjct: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177

Query: 1710 PSVPLTGL 1717
             S+PL  L
Sbjct: 1178 NSIPLGSL 1185

 Score = 73.2 bits (178), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 107/240 (44%), Gaps = 56/240 (23%)

Query: 1783 RLIIYLLVFSFVTILWIV-AWLYF------LKRLYGIEVIGKRLKPNDKTWSSSPGAFYN 1835
            R I++L + +   +LW++ A+  F      LKR Y  + I K L  N++ + S+  +   
Sbjct: 1243 RTIVFLAILTIGALLWLLFAFFVFHYRNILLKR-YPKDCIEKSLG-NERKFDSTALS--- 1297

Query: 1836 HHYNSHYSDPNNPFYDPERSLREKCSFXXXXXXXXXXXXXXGYLYDDLVVTGDNTVYSTS 1895
                   S   N  ++ + S  E  S                   D  ++TG+NTVYST+
Sbjct: 1298 ------RSSSGNQIFNEKPSGSENESVHSVTD-------------DHYIITGENTVYSTT 1338

Query: 1896 RGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHNQLQSM--EHIYEGHDSIAGGALIDE 1953
             GL Y I+++G+ +Y   +  +N+ E+  E  D   + S+  + +Y+ H       L DE
Sbjct: 1339 HGLHYTINDDGDLFYK--EATLNDLEETAEREDSG-IDSILRDCVYDEHQESTEAYLNDE 1395

Query: 1954 EGAFDINAVDVDEEGNIELPDS--------DFNVPTTVTDVEGGKTDTVESYNNNQYYKM 2005
            E    I  VDVDE GNI L DS         F +P  V          +E YNNN  YK+
Sbjct: 1396 ESISSI--VDVDENGNIRLYDSYSDDEEPNSFYLPNEV----------IEEYNNNNVYKI 1443

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  147 bits (371), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/277 (36%), Positives = 144/277 (51%), Gaps = 41/277 (14%)

Query: 1445 QSPYTVLETSVTPSSNDGPLHTSTIS-THNWLPYSLIVESKDTSTQSSTTVDLGATSTLP 1503
            QS  ++L T  T ++N G   +S    T  WLP S+ V+S  T + +S+  D   T+TLP
Sbjct: 1039 QSTGSLLTTGQTTAANTGARSSSVGGRTTFWLPSSIQVQSDPTRSGTSS-FDPAVTATLP 1097

Query: 1504 QAITPPTAVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSV 1563
            Q I PPTAVP P   S IT+GFK+ LNY FL+S   ++AQIF FLP VL +PF       
Sbjct: 1098 QLIAPPTAVPVPENASKITVGFKKNLNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKD 1157

Query: 1564 PIYRRQDIEVMTLLQRRLTSSAAEIDTCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNS 1623
              Y+R+     TLL              S  F N   +                      
Sbjct: 1158 FSYKRRG----TLL------------VSSFEFNNTTTLMPA------------------Q 1183

Query: 1624 LHRRSVNDKVSVMNSTSDSS-NIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTL 1682
             H+ +    V+ ++  SDS    + S + V QI+P++    NY+ S+A +YFP   +  L
Sbjct: 1184 FHQET----VTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSEL 1239

Query: 1683 QRLVRNQNSELYKNPENSLKALASLIDPSVPLTGLVD 1719
            Q +V +  S+L+ NP+ +L ALA+LIDPS+PLTGL+D
Sbjct: 1240 QSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLID 1276

 Score =  118 bits (296), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 111/232 (47%), Gaps = 16/232 (6%)

Query: 1776 MSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGAFYN 1835
            +S A+ KRL+IYL    F T+LWI+ +++  K LYG  VI KR    D            
Sbjct: 1318 LSSAVKKRLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEE------K 1371

Query: 1836 HHYNSHYSDPNNPFYDPERSLREKCSFXXXXXXXXXXXXXXGYLYDDLVVTGDNTVYSTS 1895
             HYN  ++D  +          +K                   L +DL++TG+NTVYS S
Sbjct: 1372 QHYN--FADITSVHSAETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVYSVS 1429

Query: 1896 RGLSYFIDENGNYYYAG-MDFIVNENE-QANEFVDHNQLQSMEHIYEGHDSIAGGALIDE 1953
            +GL YF+ E+G++YYAG +     ENE    +  D   +    +  +   SI    + +E
Sbjct: 1430 QGLQYFVAEDGSFYYAGPLQSTSEENETTKGDSADIEDINDYLYSADQERSI----VTNE 1485

Query: 1954 EGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTDTVESYNNNQYYKM 2005
            + + DI ++ +DEEGN  + D   N      ++    + T+E YNNN  YKM
Sbjct: 1486 QSSCDIGSLQIDEEGNFVVSDPSPNEEE--HEITSSNSATIELYNNNNLYKM 1535

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  147 bits (370), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 97/266 (36%), Positives = 146/266 (54%), Gaps = 50/266 (18%)

Query: 1454 SVTPSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVP 1513
            S  PS+   P  ++T    NWLPYS+I++S   S  S+ + +   T+TLP AI P T V 
Sbjct: 1632 SSVPSATSAPTESNT----NWLPYSIIMQST-PSPSSAPSFNPEVTATLPHAIAPQTPVS 1686

Query: 1514 QPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEV 1573
            +P   S ITIGFK  ++Y FL+++PLSSAQIF+FLP VL YPF+           Q+I+ 
Sbjct: 1687 EPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFN---------YDQNIDK 1737

Query: 1574 MTLLQRRLTSSAAEIDTCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKV 1633
             T      T+ ++     + + Q Y  + +            RT++++          KV
Sbjct: 1738 GT-----HTNESSHYKRKTTTLQPYRDVMV------------RTNKKH----------KV 1770

Query: 1634 SVMNSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSEL 1693
             +         I  + + V QI+P++S   +Y+V+VAE+YFP   ++ L+  ++N NS L
Sbjct: 1771 QM---------ISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSML 1821

Query: 1694 YKNPENSLKALASLIDPSVPLTGLVD 1719
            Y N   +L ALA LIDPS+PLTG+VD
Sbjct: 1822 YNNTNPTLFALADLIDPSIPLTGMVD 1847

 Score =  112 bits (280), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 125/248 (50%), Gaps = 33/248 (13%)

Query: 1780 ITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIE------------VIGKRLK------P 1821
            ITKRL I+L  F+F  +LWI+++L+  +++  ++              G  LK       
Sbjct: 1898 ITKRLAIFLNCFAFGVLLWILSFLFIFRKIRKVQPPEEGESYAELDTSGDVLKLPSGSGE 1957

Query: 1822 NDKTWSSSPGAFYNHHYNSHYSDPNNPFYDPERSLREKCSFXXXXXXXXXXXXXXGYLYD 1881
            ++ + SSS   F+     ++  D  N     + ++    +                 + D
Sbjct: 1958 DNASGSSSGPQFFQEKATNN--DSQN-----QETVDRNATPKLENSNEGIGGNAQSPISD 2010

Query: 1882 DLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHNQLQSME-HIYE 1940
            DL+VTG+NTVYST  GL YF+DE+G ++YAG   I +E+    +  +H+++   + ++Y 
Sbjct: 2011 DLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQISDESGTTKD--EHDEIDDFDKYMYA 2068

Query: 1941 GHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDSDF--NVPTTVTDVEGGK-TDTVESY 1997
            G + ++    + E    D+++++VDEEGN  L + +   N+        G K +DTVESY
Sbjct: 2069 GSEEMS--VHVSEAPEVDMSSLEVDEEGNFVLMNDEIYDNLQENSRSGSGNKNSDTVESY 2126

Query: 1998 NNNQYYKM 2005
            NNN  YKM
Sbjct: 2127 NNNHLYKM 2134

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score =  145 bits (366), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 94/249 (37%), Positives = 126/249 (50%), Gaps = 63/249 (25%)

Query: 1470 STHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEAL 1529
            S  NWLP  +I +S D +T  S++ +  AT +LPQ I PP    +    +L+TIG K+ L
Sbjct: 713  SDENWLPSGIIFQS-DFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGL 771

Query: 1530 NYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEID 1589
            NY FLI +PLSSAQIF+FLP VL YPFSS       Y   D  + +L           ID
Sbjct: 772  NYQFLIDNPLSSAQIFNFLPSVLTYPFSS-------YAPNDFPINSL-----------ID 813

Query: 1590 TCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQ 1649
              +L+F                                             DS+  + S 
Sbjct: 814  DNALAFL--------------------------------------------DSNLFNAST 829

Query: 1650 IVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLID 1709
            I V  I+PL+     + VSV EVYFP+  +D+L  L++++NS LY NP +SL ALA LID
Sbjct: 830  ISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLID 889

Query: 1710 PSVPLTGLV 1718
            PS+PLTGL+
Sbjct: 890  PSIPLTGLI 898

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score =  139 bits (351), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 147/565 (26%), Positives = 247/565 (43%), Gaps = 79/565 (13%)

Query: 1473 NWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYP 1532
            +WLP  + ++S D++ +S     L  TS LP  IT PTA+  P+  +LIT+ FK  LNY 
Sbjct: 515  DWLPSEIAIQS-DSTAESMEPSFLIDTSGLPNIITAPTAITIPSNTTLITVAFKRELNYA 573

Query: 1533 FLISHPLSSAQIFSFLPRVLQYPFSSTAG--------SVPIYRRQDIEVMTLLQRRLTSS 1584
            FL+++  SSAQIF+FLP ++++PF++             P++      ++        SS
Sbjct: 574  FLVNNFYSSAQIFNFLPIIIKHPFTALVSESCNDDSVCSPLFTEY---ILNSYASSAASS 630

Query: 1585 AAEIDTCSLSFQNYDKIQLVSVKLALLKSTNRTD------QENNSLHRRSVNDKVSVMNS 1638
             +     ++ FQ+  K   V++ L+L  +  +T       Q N +    S+  K    N+
Sbjct: 631  MSTSSVNNVDFQSGGK-HSVNINLSLHSTIVQTAISPTGFQTNMTSQIPSLAKKDLSKNA 689

Query: 1639 TSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPE 1698
            +     I    I V +IIP +  +  YI+S+AEVY P+  ++TLQ L+ N  S  Y +  
Sbjct: 690  SLQKQEISM-DITVARIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFYNSES 748

Query: 1699 NSLKALASLIDPSVPLTGLVDSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1758
            +SLK LA LIDP++PLTG++DS+                                     
Sbjct: 749  SSLKTLAFLIDPNIPLTGMLDSN------GNLISGGLSSSNGNIQNSSTKHSHGSGISDI 802

Query: 1759 XXXXXXXXXXXXXXYGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKR 1818
                          Y  +S  + KRL I+++ F+   +L+I   L+ L  +Y  + +  +
Sbjct: 803  SSQTLKLGTLDSSAYKGLSTNLKKRLSIFIVCFTVGAVLYIQLSLFGLNFMY--KKLSMK 860

Query: 1819 LKP-NDKTWSSSPGAFYNHHYNSH--------YSDPNNPFYDPERSLREKCSFXXXXXXX 1869
              P +DK  SS P         S+        +S P+NPF D  +      S        
Sbjct: 861  ADPESDK--SSLPQYHITRDSTSNIEGRSSKSFSTPSNPFSDKYQKSSSDSSKS------ 912

Query: 1870 XXXXXXXGYLYDDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVN---------EN 1920
                          +      VY+ S+ ++Y +DE GN+YY  +D +           E 
Sbjct: 913  --------------ITLPGKAVYNRSQDMTYLVDEQGNFYYTNLDNVQGRTVHIMRTPEG 958

Query: 1921 EQANEFVDHNQLQSMEHIYEGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVP 1980
               ++ V +N+     ++Y+ ++S +   L D+   +  N V+  ++  I  PD   N  
Sbjct: 959  SIYSKDVSYNK-----YVYDSNNSTSNTYLDDQ---YHENTVNKGDDLEITYPDFLLN-- 1008

Query: 1981 TTVTDVEGGKTDTVESYNNNQYYKM 2005
              V +      + V+ +NNN  YKM
Sbjct: 1009 -EVKESHTNIIENVKRFNNNGLYKM 1032

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score =  137 bits (344), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 103/287 (35%), Positives = 144/287 (50%), Gaps = 40/287 (13%)

Query: 1447 PYTVLETSVTPSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAI 1506
            P +V+  S   S    P  T T +T++WLP S+I  S D S  + ++++   T+TLP  I
Sbjct: 565  PPSVVTRSRKTSITQKPASTGTQNTNDWLPNSMIFAS-DQSDSTFSSLNPEITATLPAEI 623

Query: 1507 TPPTAVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIY 1566
              PT   QP   +L+TIGFK+ LNY FLI +PL+SAQIF FLP  L YPF  T      Y
Sbjct: 624  AAPTEAVQPPNTTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFLLTQ-----Y 678

Query: 1567 RRQDIEVMTLLQRRL-----------TSSAAEIDTCSLSFQNYDKIQ-----LVSVKLAL 1610
                 E+ +L    L           T  +  +D+     Q   KI      L++ +LA 
Sbjct: 679  NASSEEITSLCSSSLYYEDDGRTILTTHESTTVDST----QFVKKIMGPASNLLTAQLAS 734

Query: 1611 LKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVA 1670
              S++ T +     H R           +S     + S +VVK I+P++S+  +YIVSVA
Sbjct: 735  SPSSSPTQRP----HPR----------ESSPPPFFNSSNVVVKHILPMISNQRDYIVSVA 780

Query: 1671 EVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPSVPLTGL 1717
            EVYFP  ++  LQ+ +   NS LY NP      L  LIDP + LT L
Sbjct: 781  EVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDL 827

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 52/160 (32%), Gaps = 57/160 (35%)

Query: 1775 KMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSS---PG 1831
            K S  I  RL I+  VF FV   WI  WL+    L   +   KR++        +   P 
Sbjct: 880  KFSSKIKDRLAIFTTVFLFVVFFWI--WLF----LVAFKHWNKRIENKKAKKLLNKTLPT 933

Query: 1832 AFYNH-------------------HYNSHYSDPNNPFYDPERSLREKCSFXXXXXXXXXX 1872
            A +N                    +    YS   NPF D                     
Sbjct: 934  ARFNRVDLVTLSTASSMSSSSISPNEKQTYSSLENPFKD--------------------- 972

Query: 1873 XXXXGYLYDDLVVTGDNTVYSTSRGLSYFIDENGNYYYAG 1912
                       V + +  VY  S G+ Y +D +GN+YY G
Sbjct: 973  --------GTTVNSKEGVVYDQSNGMQYTVDYDGNFYYFG 1004

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
            (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score =  125 bits (315), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 130/250 (52%), Gaps = 24/250 (9%)

Query: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533
            WLP +++V+S +T   +S   +   TS LP  I  PTAV QPA   LI+IGFK  LNYPF
Sbjct: 520  WLPTNIVVQSSNTDMTNSPETNTN-TSGLPVRI-APTAVTQPADSILISIGFKIELNYPF 577

Query: 1534 LISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDTCSL 1593
            LI    +SAQIF+FLP +L YPF   + +  +     ++             ++    S 
Sbjct: 578  LIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQ-------------SDTSVIST 624

Query: 1594 SFQNYDKIQLVSVKLALLKST--NRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQIV 1651
             +Q+Y  I      L+ L  T  + +D E + L     +  V+ MN        D S I 
Sbjct: 625  EYQDYSSIFSYETTLSNLGLTLYDLSDGETSVLE---ASPTVASMNKYQR----DTSSIS 677

Query: 1652 VKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPS 1711
            VKQIIP++     YI S+AE  FP   +D LQ  + N  S +Y+NP+  LK +A+LID +
Sbjct: 678  VKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDST 737

Query: 1712 VPLTGLVDSD 1721
            +P+   +D D
Sbjct: 738  IPIFSTIDPD 747

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score =  110 bits (275), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 71/101 (70%), Gaps = 6/101 (5%)

Query: 1473 NWLPYSLIVESKDT------STQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFK 1526
            NWLP +++VES  T      +  S T +   AT TLPQAI   T V QP G++LITIGFK
Sbjct: 901  NWLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFK 960

Query: 1527 EALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYR 1567
            ++LNYPF++SHP+SSAQ+FS+LP VL YPF+ T   V +Y+
Sbjct: 961  KSLNYPFVVSHPVSSAQLFSYLPNVLNYPFNYTFSDVQVYQ 1001

 Score = 82.4 bits (202), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 55/75 (73%)

Query: 1644 NIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKA 1703
            N  +S + V Q++PL SSS +Y+++VA+VYFP   ++ LQ+L+ N  + LY N   + K+
Sbjct: 991  NYTFSDVQVYQLVPLKSSSRDYLITVAKVYFPSEQVEVLQKLISNTAANLYFNSNPTEKS 1050

Query: 1704 LASLIDPSVPLTGLV 1718
            LASLIDP++PLTG++
Sbjct: 1051 LASLIDPTIPLTGII 1065

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score =  107 bits (266), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (68%), Gaps = 4/108 (3%)

Query: 1470 STHNWLPYSLIVESKDTS-TQSSTTVDLG---ATSTLPQAITPPTAVPQPAGHSLITIGF 1525
            ST NWLP +L+  S DT+ TQS +T   G   AT TLPQAI  PT V QP G++LITIGF
Sbjct: 1175 STSNWLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIGF 1234

Query: 1526 KEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEV 1573
            K+ALNYPF++++ ++SAQIF++LP  L +PF      + + R   ++V
Sbjct: 1235 KQALNYPFVVTNAVTSAQIFAYLPETLNFPFDDAFSDITVARLGPLKV 1282

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELY-KNPENSLKALA 1705
            +S I V ++ PL  S+ +Y++++AEVYFP   ++ LQ L++N  S+ Y KN   +L  LA
Sbjct: 1269 FSDITVARLGPLKVSNRDYLLTIAEVYFPSAQVENLQTLIQNDESKFYAKNATKNL--LA 1326

Query: 1706 SLIDPSVPLTGLV 1718
            + +D ++PLTGLV
Sbjct: 1327 AFVDATIPLTGLV 1339

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 104/184 (56%), Gaps = 18/184 (9%)

Query: 1441 AFSTQSPYTVLETSV--TPSSNDGPLHTSTISTHNWLPYSLIVESKDTS----TQSSTTV 1494
            A S  SPY  L T +  TP++       S+ ++ NWLP ++I  + +T     T SS   
Sbjct: 1196 APSPSSPYPALTTDLISTPTA-------SSATSSNWLPTAMITANANTESASPTDSSDPK 1248

Query: 1495 DLG-ATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQ 1553
            D   AT TLPQAI  PT V QP G++LIT+GFK+ALNYPF++ +P++SAQIF+FLP  L 
Sbjct: 1249 DAQQATKTLPQAIGAPTEVVQPEGYTLITVGFKKALNYPFVVGNPVTSAQIFAFLPDTLN 1308

Query: 1554 YPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDTCSLSFQNYDK-IQLVSVKLALLK 1612
             PF +   ++ + R   ++V +   R    + AE+   S   +N  K IQ  + K   + 
Sbjct: 1309 SPFDNAFTNITVARLGPLKVSS---RDYLLTVAEVYFPSAQVENLQKLIQNDASKFYFVN 1365

Query: 1613 STNR 1616
             T+R
Sbjct: 1366 GTSR 1369

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (66%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALAS 1706
            ++ I V ++ PL  SS +Y+++VAEVYFP   ++ LQ+L++N  S+ Y     S   +AS
Sbjct: 1315 FTNITVARLGPLKVSSRDYLLTVAEVYFPSAQVENLQKLIQNDASKFYFVNGTSRNVVAS 1374

Query: 1707 LIDPSVPLTGLVDSD 1721
            L+D ++PLTGL+  D
Sbjct: 1375 LVDATIPLTGLLQDD 1389

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa] {ON}
            some similarities with uniprot|P32334 Saccharomyces
            cerevisiae YGR014W MSB2 Mucin family member at the head
            of the Cdc42p- and MAP kinase-dependent filamentous
            growth signaling pathway also functions as an osmosensor
            in parallel to the Sho1p-mediated pathway potential
            Cdc28p substrate
          Length = 908

 Score = 96.3 bits (238), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 76/111 (68%), Gaps = 7/111 (6%)

Query: 1474 WLPYSLIVESKDTSTQSSTTVDLG-ATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYP 1532
            WLP +++ E + + TQS++T     AT TLPQAIT  T + QPAG++LIT+GFK+ LNYP
Sbjct: 535  WLPTTMVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQPAGYTLITVGFKKELNYP 594

Query: 1533 FLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTS 1583
            F +++P+S+AQIF FLP+VL YPF+         +  +  V+ L+  ++TS
Sbjct: 595  FTVNNPVSNAQIFEFLPKVLNYPFNGAQ------KFDNTSVLELVPLKVTS 639

 Score = 72.8 bits (177), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 50/67 (74%)

Query: 1652 VKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPS 1711
            V +++PL  +S++Y+V+VA+VYFP+ S+ TLQ  + N +S +Y N   +LK L+S ID S
Sbjct: 629  VLELVPLKVTSLDYLVTVAKVYFPEDSVSTLQAQILNSSSVIYNNDVTALKQLSSYIDAS 688

Query: 1712 VPLTGLV 1718
            +PLTGLV
Sbjct: 689  IPLTGLV 695

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
            Anc_4.150 YGR014W
          Length = 826

 Score = 94.4 bits (233), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 60/87 (68%)

Query: 1470 STHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEAL 1529
            S++ W+P  +I ES  T    S+T  +  T   P+AI  PT +P P+G++LITIGFKEAL
Sbjct: 484  SSNWWVPTRIITESDKTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGFKEAL 543

Query: 1530 NYPFLISHPLSSAQIFSFLPRVLQYPF 1556
            NY F++ +P+SSAQIF+FLP  L  PF
Sbjct: 544  NYDFVLDNPVSSAQIFAFLPEALDLPF 570

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 48/74 (64%)

Query: 1648 SQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASL 1707
            S + + +++P   S+ NY V VAEVYFP  SID L  L+++ +S LY     S  AL +L
Sbjct: 576  SSVSILKLVPYSLSNYNYTVLVAEVYFPSDSIDELSSLIKDSDSPLYTLNTGSRLALVNL 635

Query: 1708 IDPSVPLTGLVDSD 1721
            ID ++PLTGLV+ D
Sbjct: 636  IDQNIPLTGLVNLD 649

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score = 94.0 bits (232), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/83 (51%), Positives = 58/83 (69%)

Query: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533
            W+P  LI ++ + ++ +S+TV    T TLP AI   T VP+P G++LITIGFK+ALNY F
Sbjct: 961  WIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKKALNYEF 1020

Query: 1534 LISHPLSSAQIFSFLPRVLQYPF 1556
            ++S P SSAQIF +LP  L  PF
Sbjct: 1021 VVSEPKSSAQIFGYLPEALNTPF 1043

 Score = 77.0 bits (188), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 50/72 (69%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALAS 1706
            ++ I V QI+PL   S+NY+VSVAEVYFP   I+ L  L+ N +S  Y +   + K++A+
Sbjct: 1047 FTNITVLQIVPLQDDSLNYLVSVAEVYFPTAEIEELSNLITNSSSAFYTDGMGTAKSMAA 1106

Query: 1707 LIDPSVPLTGLV 1718
            ++D S+PLTGL+
Sbjct: 1107 MVDSSIPLTGLL 1118

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
            Anc_4.150
          Length = 985

 Score = 94.0 bits (232), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 71/114 (62%), Gaps = 1/114 (0%)

Query: 1455 VTPSSNDGPLHTSTISTHNW-LPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVP 1513
            ++PS    P  T   S  NW +P  LI +S   S  +S      AT TLPQ I   T +P
Sbjct: 586  ISPSVTTTPTQTRASSDTNWWIPTVLITQSNQPSESASVPTSNTATKTLPQVIAVGTTIP 645

Query: 1514 QPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYR 1567
            +P G+SLITIGFK+ LNY F++++P SSAQIFSFLP VL  PF++T  ++ + +
Sbjct: 646  EPEGYSLITIGFKKPLNYEFIVANPKSSAQIFSFLPDVLNAPFNNTFNNITVLQ 699

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 93.6 bits (231), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 69/102 (67%), Gaps = 2/102 (1%)

Query: 1466 TSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGF 1525
            +ST + + W+P  +I +    +T SST+    AT+TLPQAI   T   +P G+SL+TIGF
Sbjct: 1151 SSTTNDNWWVPTKIITQPAPNTTASSTSSQ--ATATLPQAIAAATQQVRPKGYSLLTIGF 1208

Query: 1526 KEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYR 1567
            K ALNY FLIS PLSSAQIF+FLP +L  PF +   +V IY+
Sbjct: 1209 KSALNYNFLISSPLSSAQIFAFLPSILNDPFQNQFNNVSIYQ 1250

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 48/72 (66%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALAS 1706
            ++ + + QI+PL S S++Y+ +VAEVYFP   I  L  L+ N  S LY +   S K LA 
Sbjct: 1243 FNNVSIYQIVPLKSESLDYLATVAEVYFPTKHISDLNSLITNNASSLYTDAHGSAKYLAE 1302

Query: 1707 LIDPSVPLTGLV 1718
            LIDP++PLTGLV
Sbjct: 1303 LIDPTIPLTGLV 1314

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4.150
          Length = 785

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 63/107 (58%), Gaps = 8/107 (7%)

Query: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533
            W+P  LI  S  T    S  V   AT TLPQ I   T+VP P G+++ITIGFKEALNY F
Sbjct: 452  WIPTQLITAS--TQVTGSAMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNYEF 509

Query: 1534 LISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRR 1580
            ++S P SSAQIFSFLP VL  PF        IY    +  +  LQ++
Sbjct: 510  IVSSPKSSAQIFSFLPYVLNTPFDD------IYDNITVSRLVPLQKK 550

 Score = 73.6 bits (179), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 49/72 (68%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALAS 1706
            Y  I V +++PL    I Y ++VAEV FP+ +I  L   +++ NS LY   +++L++LA 
Sbjct: 536  YDNITVSRLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTNSSLYTKNDDALRSLAL 595

Query: 1707 LIDPSVPLTGLV 1718
            LIDPS+PLTGLV
Sbjct: 596  LIDPSIPLTGLV 607

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
            Anc_4.150 YGR014W
          Length = 1123

 Score = 89.0 bits (219), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 77/121 (63%), Gaps = 9/121 (7%)

Query: 1468 TISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKE 1527
            T + + W+P  ++ ++  T+  SS TV   AT+TLPQAI   T V +P G++LIT+GFK 
Sbjct: 790  TTANNWWVPTQIVTQTSQTT--SSGTVG-QATATLPQAIAAATQVARPDGYTLITLGFKR 846

Query: 1528 ALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAE 1587
            ALNY F++S+P+SSAQIF+FLP +L+ PF ++      Y    ++ +  LQ +  S  A 
Sbjct: 847  ALNYNFVVSNPISSAQIFAFLPEMLRTPFENS------YENITVQQLVPLQSKAVSYLAT 900

Query: 1588 I 1588
            +
Sbjct: 901  V 901

 Score = 80.9 bits (198), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALAS 1706
            Y  I V+Q++PL S +++Y+ +VAEVYFP   I  L +L+ N +S LY + E   K LA 
Sbjct: 879  YENITVQQLVPLQSKAVSYLATVAEVYFPTSEISALSKLISNTSSNLYTDVEGPAKYLAY 938

Query: 1707 LIDPSVPLTGLVDSD 1721
            LID S+PLTGL+ SD
Sbjct: 939  LIDASIPLTGLLGSD 953

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
            (REAL)
          Length = 1169

 Score = 86.7 bits (213), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 56/83 (67%)

Query: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533
            W+P  LI ++ +T++  S+ +    T TLPQA+   T +P+  G+SLIT+GFK+ LNY F
Sbjct: 823  WIPTELITQAPETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITVGFKKPLNYEF 882

Query: 1534 LISHPLSSAQIFSFLPRVLQYPF 1556
            ++S P SSAQIF +LP  L  PF
Sbjct: 883  VVSEPKSSAQIFGYLPAALNTPF 905

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 51/72 (70%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALAS 1706
            ++ I V QI+PL   S+NY++SVAEVYFP   ++ L  L+ N +S  Y +   + K++A+
Sbjct: 909  FTNITVLQIVPLQDDSLNYLISVAEVYFPTAEVEELSNLIMNTSSTFYTDGTGTAKSMAA 968

Query: 1707 LIDPSVPLTGLV 1718
            ++DPS+PLTGL+
Sbjct: 969  MVDPSIPLTGLL 980

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
            similar to Ashbya gossypii AGR019C
          Length = 1129

 Score = 86.3 bits (212), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 72/123 (58%), Gaps = 14/123 (11%)

Query: 1455 VTPSSNDGPLHTSTISTHNWLPYSLIVESK----------DTSTQSSTTVDLGATSTLPQ 1504
            VTP+ + GP HT T     WLP +++ ES           DT T+ +T++   A  TLP+
Sbjct: 761  VTPNYSWGP-HTPT---STWLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLPK 816

Query: 1505 AITPPTAVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVP 1564
             I+          ++LIT+GFK  LNYPF++S+P+SSAQIF FLP VL YP+     +V 
Sbjct: 817  FISSANGKIPEGNYTLITVGFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPYGFRCANVS 876

Query: 1565 IYR 1567
            ++R
Sbjct: 877  VWR 879

 Score = 71.2 bits (173), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 13/108 (12%)

Query: 1626 RRSVNDKVSVMNSTSDSSNIDY-------------SQIVVKQIIPLVSSSINYIVSVAEV 1672
            +R +N    V N  S +   D+             + + V +++PL S S +Y+V+VA V
Sbjct: 838  KRRLNYPFVVSNPVSSAQIFDFLPNVLNYPYGFRCANVSVWRLLPLKSGSRDYLVTVAAV 897

Query: 1673 YFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPSVPLTGLVDS 1720
            +FP   +D L RLV +  S LY + + + K +ASLIDP +PLTG+++S
Sbjct: 898  FFPTEHLDELARLVADNTSSLYSSYDETGKTMASLIDPMIPLTGIINS 945

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
            complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 59/94 (62%), Gaps = 1/94 (1%)

Query: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533
            W+P SLI ES D +  + TT  L AT ++P AI   T    P G SL+TIGFKEALNY F
Sbjct: 643  WVPTSLITES-DVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQF 701

Query: 1534 LISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYR 1567
            ++S  ++ AQIF+FLP  L  PF     +V +YR
Sbjct: 702  VLSSSVTVAQIFAFLPGGLIAPFEEQLANVTVYR 735

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 42/70 (60%)

Query: 1648 SQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASL 1707
            + + V ++ PL   + NY ++VAEVYFP   ID L   V +  S LY N   + + L SL
Sbjct: 729  ANVTVYRLSPLNYGNFNYTLTVAEVYFPTSKIDELAAFVADSESALYVNASGTEEELVSL 788

Query: 1708 IDPSVPLTGL 1717
            IDP +P+TGL
Sbjct: 789  IDPRIPITGL 798

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score = 85.5 bits (210), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 56/83 (67%)

Query: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533
            W+P  LI +  + ++ +STT     T TLP AI   T + +P G+SLITIGFK+ALNY F
Sbjct: 790  WIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALNYEF 849

Query: 1534 LISHPLSSAQIFSFLPRVLQYPF 1556
            ++S P SSAQIF++LP  L  PF
Sbjct: 850  VVSEPKSSAQIFAYLPEALNTPF 872

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALAS 1706
            ++ I V QI+PL     +Y+VSVAEVYFP   I+TL  L+ N +S  Y +   + K++A+
Sbjct: 876  FTNISVLQIVPLQDDLFSYLVSVAEVYFPTAEIETLSSLITNTSSSFYTDGMGTAKSMAA 935

Query: 1707 LIDPSVPLTGLV 1718
            ++D S+PLTGL+
Sbjct: 936  MVDASIPLTGLL 947

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR014W
            (MSB2)
          Length = 1105

 Score = 83.2 bits (204), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 54/75 (72%)

Query: 1644 NIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKA 1703
            N +Y+ I V Q++PL ++S +YI ++A+VYFP   +D L +LV + NSELY + + ++K 
Sbjct: 849  NFEYADISVIQLVPLKANSKDYIATIAQVYFPSEKVDELAKLVVDTNSELYSSYDANMKV 908

Query: 1704 LASLIDPSVPLTGLV 1718
             ASLIDP +PLTGL 
Sbjct: 909  FASLIDPQLPLTGLA 923

 Score = 73.2 bits (178), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 17/120 (14%)

Query: 1473 NWLPYSLIV--ESKDTSTQS--STTVDLGATST-----LPQAITPPTAVPQPAGHSLITI 1523
            NWLP  +I   E +  ST+S  +T      T+T     LPQ I  P  V     ++LITI
Sbjct: 756  NWLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTLITI 815

Query: 1524 GFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTS 1583
            GFK+ LNYPF+  +P ++AQIF +LP +L YPF+        +   DI V+ L+  +  S
Sbjct: 816  GFKKQLNYPFIAMNPFANAQIFDYLPGILNYPFN--------FEYADISVIQLVPLKANS 867

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
            (REAL)
          Length = 1189

 Score = 83.2 bits (204), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 77/127 (60%), Gaps = 11/127 (8%)

Query: 1433 TGMQHSQKAFSTQSPYTVLETSVTPSSNDGPLHTSTISTHN---WLPYSLIVESKDTSTQ 1489
            T +Q S  A ST    TVL+    PS+ +G  + S++++ +   W+P  LI ++ + ++ 
Sbjct: 806  TNVQTSLTAEST----TVLQ----PSTTNGTDNYSSVTSSDNNWWIPTELITQAPEAAST 857

Query: 1490 SSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLP 1549
            +S+T     T TLP AI   T +P   G+SLIT+GFK ALNY F++S P SSAQIF +LP
Sbjct: 858  ASSTASGTQTMTLPHAIAAATQIPASEGYSLITVGFKRALNYEFVVSEPKSSAQIFGYLP 917

Query: 1550 RVLQYPF 1556
              L  PF
Sbjct: 918  EALNTPF 924

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 51/72 (70%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALAS 1706
            ++ I V QI+PL   S++Y+VSVAEVYFP   ++ L  L+ N +S  Y +   + K++A+
Sbjct: 928  FTNISVLQIVPLQDDSLSYLVSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMAA 987

Query: 1707 LIDPSVPLTGLV 1718
            ++DPS+PLTGL+
Sbjct: 988  MVDPSIPLTGLL 999

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
            YGR014W
          Length = 949

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 77/123 (62%), Gaps = 4/123 (3%)

Query: 1449 TVLETSVTPSSNDGPLHTS-TISTH---NWLPYSLIVESKDTSTQSSTTVDLGATSTLPQ 1504
            TVL  S  P S+   L TS T ++H   NW   S ++ + + ++ ++      AT +LPQ
Sbjct: 561  TVLPASNVPVSSSITLVTSATTTSHSNPNWWVASDLMTASEEASTTTRASATTATGSLPQ 620

Query: 1505 AITPPTAVPQPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVP 1564
            AI  PT V  P  +SLITIGFK+ALNY F+++ P SSAQ+FS+LP  L  PF+++  ++ 
Sbjct: 621  AIAAPTEVTAPDDYSLITIGFKKALNYEFVVNTPESSAQLFSYLPIALNTPFNNSFTNIS 680

Query: 1565 IYR 1567
            +Y+
Sbjct: 681  VYQ 683

 Score = 80.9 bits (198), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 54/75 (72%)

Query: 1644 NIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKA 1703
            N  ++ I V QI+PLV SS+NY ++VAEVYFP+  I +LQ+++++ +S L+     + K 
Sbjct: 673  NNSFTNISVYQIVPLVESSLNYYITVAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKT 732

Query: 1704 LASLIDPSVPLTGLV 1718
            L SLIDPS+PL GL+
Sbjct: 733  LVSLIDPSIPLVGLL 747

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
            YGR014W
          Length = 994

 Score = 80.1 bits (196), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (70%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALAS 1706
            +S I V Q++PL  SSI+Y V+VAEVYFP   I  L +LV++ +S LY     SLK LA 
Sbjct: 734  FSNISVLQLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVKDTSSILYTEVSESLKTLAD 793

Query: 1707 LIDPSVPLTGLV 1718
            +IDPS+P+TGLV
Sbjct: 794  MIDPSIPITGLV 805

 Score = 73.9 bits (180), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 53/85 (62%), Gaps = 2/85 (2%)

Query: 1474 WLPYSLIVESKDTSTQSST--TVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNY 1531
            W+P  L+ E+    T S+T  T+   AT  +PQ I  P  V    G++LITIGFK+ L+Y
Sbjct: 646  WIPTRLLTETAAVETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIGFKKPLHY 705

Query: 1532 PFLISHPLSSAQIFSFLPRVLQYPF 1556
             F+++ P SSAQI SFLP +L  P+
Sbjct: 706  EFVVTQPKSSAQIISFLPNLLNQPY 730

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 55/95 (57%), Gaps = 4/95 (4%)

Query: 1462 GPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLI 1521
             P  T T  ++ W+P SL V S   ST +ST      T  +PQAI      P P  HSLI
Sbjct: 1486 APSSTITRQSNWWIPTSLAVASTMNSTDTSTL----PTQAIPQAIGSVEQPPAPENHSLI 1541

Query: 1522 TIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPF 1556
            TIGFK+ LNY F++SHP+S AQI ++LP  L   F
Sbjct: 1542 TIGFKKELNYEFVVSHPMSGAQIINYLPNTLVNAF 1576

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 44/68 (64%)

Query: 1650 IVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLID 1709
            I V  ++P   +  +Y++++A VYFP   I  L+ L+ +++S  Y   ++  + LA+L+D
Sbjct: 1583 ISVNNLVPYNDTKSDYLITIATVYFPTDEIKHLRELIHDKSSSFYTASQDVARQLANLVD 1642

Query: 1710 PSVPLTGL 1717
            PS+PLTGL
Sbjct: 1643 PSIPLTGL 1650

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 multicopy suppressor of a CDC24 bud
            emergence defect
          Length = 936

 Score = 65.9 bits (159), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 7/105 (6%)

Query: 1474 WLPYSLIVESKDTSTQSSTTVDLGAT--STLPQAITPPT---AVPQPAGHSLITIGFKEA 1528
            W+P SLI+   +T ++S+ T     T  S+LP+ I       +VP+  G+S+ITIGFK+ 
Sbjct: 591  WIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESVPE--GYSVITIGFKKP 648

Query: 1529 LNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEV 1573
            LNYPF++S   SSAQI  +LP++L   F S    +   +   +E+
Sbjct: 649  LNYPFVVSESKSSAQIMYYLPKLLNANFESIFSDIKTVQLMPLEI 693

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 1/74 (1%)

Query: 1647 YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSL-KALA 1705
            +S I   Q++PL      Y+ +VA ++FP   I +L  +V+N +S LY     ++ ++L+
Sbjct: 680  FSDIKTVQLMPLEIQDSGYLSTVALLFFPTSEIQSLSNMVKNTSSSLYSTQYETITQSLS 739

Query: 1706 SLIDPSVPLTGLVD 1719
            +LIDP +P+TGL D
Sbjct: 740  ALIDPRIPVTGLTD 753

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 99/240 (41%), Gaps = 63/240 (26%)

Query: 1775 KMSLAITKRLI-IYLLVFSFVTILW-IVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGA 1832
            K +L  +K  I I  ++F F+++L+ I+  + F+K  Y  E I K ++P +K W +   +
Sbjct: 1906 KTTLETSKAWIYIVAMIFGFISLLFSILFSMTFMKFSYQFEFITKIIRPTEKIWPTKDAS 1965

Query: 1833 FYNHHYNSHYSDPNNPFYDPERSLREKCSFXXXXXXXXXXXXXXGYLYDDLVVTGDNTVY 1892
                H                 +L+ K                 G ++    +     VY
Sbjct: 1966 IGASH-----------------ALKNKNILPIVHTPIMEK----GEIFPSPSINDCEIVY 2004

Query: 1893 STSRGLSYFIDENGNYYY-----AGMDFIVNENEQANEFVDHNQLQSMEHIYEGHDSIAG 1947
              + GL+Y +D+ GNYYY      G DFI         F  +  LQ  ++  EGHD I  
Sbjct: 2005 DNNNGLAYTVDKEGNYYYHHNLTTGKDFIT--------F--NTSLQ--DYRKEGHDDIF- 2051

Query: 1948 GALIDEEGAFDINAVDVDEEGNIELPDSD--FNVPTTVTDVEGGKT---DTVESYNNNQY 2002
                            +D++GNIE+ DS   +++PT+ +   G      D +  Y NNQY
Sbjct: 2052 ----------------IDQDGNIEIEDSHGIYDIPTSSSISHGSSIKNLDNIRKY-NNQY 2094

 Score = 64.7 bits (156), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 82/319 (25%), Positives = 136/319 (42%), Gaps = 71/319 (22%)

Query: 1461 DGPLHTSTIST----------HNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPT 1510
            DG  ++STI +           NWLP +L+VE  + S  ++   +   T   P+AITP  
Sbjct: 1533 DGSTYSSTIKSTFTTKSVSNGSNWLPSTLVVE-NNPSGSANMQFNPSETFKWPRAITPEN 1591

Query: 1511 --AVPQPAGHSLITIGFKEALNY-----------------PFLISHPL---SSAQIFSFL 1548
                P P    LI +     LNY                 PF++S+ L   S A   S+ 
Sbjct: 1592 QNEKPAPVDSQLILVALDRPLNYPFLIENLVSSAQVMNYIPFILSYSLIDFSPAAPSSYS 1651

Query: 1549 PRVLQYPFSSTAGS--------VPIYRRQDIEVMTLLQR----RLTSSAAEIDTCSLSFQ 1596
                 Y  SS   S        +   +++D++   L +     + T S + ID   L+  
Sbjct: 1652 LSGTAYDISSEINSGTTTLSPVIATNKKRDVKTWQLNKMNSISQNTVSHSLIDVSFLT-A 1710

Query: 1597 NYDKIQL---------VSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNID- 1646
            N   I++             L L  + N+T  +   L  ++  ++++     S++S+I  
Sbjct: 1711 NQSNIEIQASSSSSTNSIASLQLQATDNKTPSQ--ILPTKTSGNEIT----NSETSDITP 1764

Query: 1647 ---------YSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNP 1697
                     Y  I VKQIIPL+    +Y V+  +VY P++ +D LQ  + + +S LY NP
Sbjct: 1765 TSSSLYPSLYPGIEVKQIIPLLIEDRDYWVAGVQVYVPNNVVDQLQAYIYDLDSILYHNP 1824

Query: 1698 ENSLKALASLIDPSVPLTG 1716
                + L++ ID S+P+ G
Sbjct: 1825 VYIARELSNFIDSSIPIVG 1843

>Kpol_163.1 s163 (208..1008) [801 bp, 266 aa] {ON} (208..1008) [801
            nt, 267 aa]
          Length = 266

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 1890 TVYSTSRGLSYFIDENGNYYYAGMDFIVNE 1919
            TVYS    +++ ID  GNYYY G    VNE
Sbjct: 53   TVYSKEHEMTFIIDHQGNYYYGGSQDTVNE 82

>Smik_12.85 Chr12 complement(170982..171734) [753 bp, 250 aa] {ON}
            YLR022C (REAL)
          Length = 250

 Score = 34.7 bits (78), Expect = 2.4,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 1650 IVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLID 1709
            +V KQIIP+V + +   V++ E Y     I+ + RL+    ++L  NP+ +      LID
Sbjct: 161  LVSKQIIPIVRAKMKVKVAICEPYNQSELIEKVSRLIATSPTDL-ANPDLNPWTCVGLID 219

Query: 1710 P 1710
            P
Sbjct: 220  P 220

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.122    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 219,745,585
Number of extensions: 9463182
Number of successful extensions: 60251
Number of sequences better than 10.0: 1238
Number of HSP's gapped: 48963
Number of HSP's successfully gapped: 4577
Length of query: 2444
Length of database: 53,481,399
Length adjustment: 126
Effective length of query: 2318
Effective length of database: 39,033,483
Effective search space: 90479613594
Effective search space used: 90479613594
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 74 (33.1 bits)