Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G03564g5.475ON60560530550.0
Kwal_55.212675.475ON60459614960.0
KLTH0F15004g5.475ON59761414950.0
TDEL0A033905.475ON62261413620.0
Kpol_543.95.475ON64264712581e-166
Skud_15.3025.475ON67865412441e-163
TPHA0J027805.475ON63164312341e-162
YOR138C (RUP1)5.475ON67150212271e-160
Suva_8.1905.475ON66649812231e-160
Smik_15.3185.475ON67250411981e-156
KAFR0E025405.475ON65949611371e-147
NCAS0H022705.475ON69651110611e-135
ZYRO0D11264g5.475ON54759210181e-131
TBLA0A025405.475ON6785259321e-116
NDAI0C013905.475ON7095479241e-115
CAGL0I07205g5.475ON6035268006e-98
KNAG0B040505.475ON6734897925e-96
KLLA0E03169g5.475ON5444847712e-94
TBLA0B022305.475ON7905377701e-91
NDAI0A074103.270ON81070860.085
NDAI0J005307.488ON138936790.59
ZYRO0G17996g7.488ON145534790.69
NCAS0I016203.270ON79548770.95
Suva_2.707.488ON138034751.8
SAKL0F14894g7.488ON129734752.0
NCAS0B036308.331ON2447100752.3
Ecym_71787.488ON126934742.4
KAFR0B005907.488ON126136742.6
YER143W (DDI1)8.185ON42835733.1
Skud_5.2808.185ON42835733.2
KLLA0B11924g3.339ON141290733.4
KAFR0C004103.270ON76936716.1
CAGL0J04642g4.296ON1914104707.2
KLLA0E10341g8.185ON41437697.3
Kwal_55.204257.185ON103672699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G03564g
         (605 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...  1181   0.0  
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   580   0.0  
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   580   0.0  
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   529   0.0  
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   489   e-166
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...   483   e-163
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   479   e-162
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...   477   e-160
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...   475   e-160
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...   466   e-156
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   442   e-147
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   413   e-135
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   396   e-131
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   363   e-116
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   360   e-115
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   312   6e-98
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   309   5e-96
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   301   2e-94
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   301   1e-91
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    38   0.085
NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] ...    35   0.59 
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    35   0.69 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    34   0.95 
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    33   1.8  
SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa...    33   2.0  
NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8....    33   2.3  
Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar ...    33   2.4  
KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {...    33   2.6  
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    33   3.1  
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    33   3.2  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    33   3.4  
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    32   6.1  
CAGL0J04642g Chr10 (439679..445423) [5745 bp, 1914 aa] {ON} simi...    32   7.2  
KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {...    31   7.3  
Kwal_55.20425 s55 complement(394989..398099) [3111 bp, 1036 aa] ...    31   9.3  

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score = 1181 bits (3055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/605 (95%), Positives = 579/605 (95%)

Query: 1   MEQANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDS 60
           MEQANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDS
Sbjct: 1   MEQANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDS 60

Query: 61  ENGIKPGMLNDVIPXXXXXXXXXXXXXXXXIPDDVLAPSGIMDSTTQLLKDSLNDPTVVL 120
           ENGIKPGMLNDVIP                IPDDVLAPSGIMDSTTQLLKDSLNDPTVVL
Sbjct: 61  ENGIKPGMLNDVIPNTDNVTTVETREVENTIPDDVLAPSGIMDSTTQLLKDSLNDPTVVL 120

Query: 121 PLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGYYSKPEYRLQFSSNNN 180
           PLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGYYSKPEYRLQFSSNNN
Sbjct: 121 PLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGYYSKPEYRLQFSSNNN 180

Query: 181 VSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLG 240
           VSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLG
Sbjct: 181 VSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLG 240

Query: 241 SCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHF 300
           SCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHF
Sbjct: 241 SCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHF 300

Query: 301 LPEEYDTNLYRMFNTLLYPXXXXXXXXXXNSLGNLAPMLTVVFDEMDESTENVSLQQGVD 360
           LPEEYDTNLYRMFNTLLYP          NSLGNLAPMLTVVFDEMDESTENVSLQQGVD
Sbjct: 301 LPEEYDTNLYRMFNTLLYPEEDEDGEEVENSLGNLAPMLTVVFDEMDESTENVSLQQGVD 360

Query: 361 VPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVD 420
           VPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVD
Sbjct: 361 VPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVD 420

Query: 421 FAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVV 480
           FAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVV
Sbjct: 421 FAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVV 480

Query: 481 DAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASITEPHEVSESI 540
           DAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASITEPHEVSESI
Sbjct: 481 DAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASITEPHEVSESI 540

Query: 541 KLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVSDD 600
           KLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVSDD
Sbjct: 541 KLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVSDD 600

Query: 601 ILIDL 605
           ILIDL
Sbjct: 601 ILIDL 605

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/596 (50%), Positives = 406/596 (68%), Gaps = 21/596 (3%)

Query: 7   SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL-QATTEHVDLTQDDSDSENGIK 65
           +I+ LLDMGI+ +VA++ALS+TNGD+E SVNYIFSGEL Q   E   L    +D+E G  
Sbjct: 5   AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAEQG-- 62

Query: 66  PGMLNDVIPXXXXXXXXXXXXXXXXIPDDVLAPSGIMDSTTQLLKDSLN-------DPTV 118
           P    D                   + +    P    D T    +++ N       DP V
Sbjct: 63  PQKEEDREDSALLEHTEYASVSNGPLEE----PERYRDYTLSTQEEAANEVKNDQEDPLV 118

Query: 119 VLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGYYSKPEYRLQFSSN 178
           V P   NAL ENYFALFCL+VG+ FPH+FL PDF+DLNY  +W +G + KP++R++F +N
Sbjct: 119 VKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKFETN 178

Query: 179 NNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDK 238
            +V+IVP+  LT QD+LTLQPELLWQFQKF+AV +S  S RK VSA+   K LEP V++K
Sbjct: 179 EDVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEK 238

Query: 239 LGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLL 298
           L + +HL +VLPSFI+SLANDVE+C     ++ I+ LFISTAY+KP+ +   IETLVSLL
Sbjct: 239 LNNAEHLHDVLPSFIRSLANDVELC---PGSQSIKELFISTAYYKPASEPVPIETLVSLL 295

Query: 299 HFLPEEYDTNLYRMFNTLLYP---XXXXXXXXXXNSLGNLAPMLTVVFDEMDESTENVSL 355
           HF+PEEYD+N+Y+MFN LLYP             NSLGNLA M+T+VFDEMDEST+++ L
Sbjct: 296 HFMPEEYDSNIYKMFNALLYPNDADDDDDVEETQNSLGNLASMITIVFDEMDESTDDIRL 355

Query: 356 QQGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFL 415
             GV+VP+KFYPQ+YT+ +K SLI  V     E Q  +H+IL+ LN LKSFQGKHI+SFL
Sbjct: 356 PHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFL 415

Query: 416 NSTVDFAAKD-PLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSH 474
           NST+DF A+D      +    +L+ +L  IK+ ++ KKT+ M EYK ISH ++N WNLSH
Sbjct: 416 NSTLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSH 475

Query: 475 PDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASITEPH 534
           P+L +++  +K+GLIDEPY+LT+A++SP++Y+IRKRD  WY V+ + +   L  + T+  
Sbjct: 476 PELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAE 535

Query: 535 EVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELE 590
            V+ +I+L TR ASETPLMFTY KES I    ++ +++E N GV+ F + DQ+ L+
Sbjct: 536 TVTNTIRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/614 (49%), Positives = 402/614 (65%), Gaps = 36/614 (5%)

Query: 7   SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDSENGI-- 64
           +IQ LLDMGI+ EVA++AL++TNGD+E SVNYIFSGEL          +   D E     
Sbjct: 5   AIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQQGPPPAPEETPEDREKEPES 64

Query: 65  ------KPGMLNDVIPXXXXXXXXXXXXXXXXIPDDVLAPSGIMDSTTQL----LKDSLN 114
                  P  + +  P                  D+     G+  S  +     LK+   
Sbjct: 65  ESELPENPEFIEEAPPSE----------------DEATDQQGVAVSPREQIACQLKNRPE 108

Query: 115 DPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGYYSKPEYRLQ 174
           DP VV P   NAL ENYFALFCL+VG+ FPHHFL+PDFQDL Y ++W+KG + KP YR++
Sbjct: 109 DPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKGQFLKPAYRVK 168

Query: 175 FSSNNNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPL 234
           F +N++VSIVP+  LT QD+L LQPELLWQFQKF+AV NS    RK+V+A+   KVLEP 
Sbjct: 169 FENNDDVSIVPQETLTSQDNLILQPELLWQFQKFLAVQNSPQCRRKYVTARYLTKVLEPQ 228

Query: 235 VLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETL 294
           V++KL + DHL E LPSFIKSLANDVE+C     A  ++ LFISTAY+KP  + + IETL
Sbjct: 229 VVEKLNNSDHLHEALPSFIKSLANDVELC---PGAHSVKELFISTAYYKPVSEPEPIETL 285

Query: 295 VSLLHFLPEEYDTNLYRMFNTLLYPXXXXXXXX--XXNSLGNLAPMLTVVFDEMDESTEN 352
           VSLLHF+PEEYDTN+Y+MFN LLYP            NSLGNLAPM+T+VFDEMDESTE 
Sbjct: 286 VSLLHFMPEEYDTNIYKMFNALLYPDSNEDAEMDDIQNSLGNLAPMITIVFDEMDESTEQ 345

Query: 353 VSLQQGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHIN 412
            +L  GVDVPL+FYPQ+YT+ +K+ LI  V     ++Q+ + +IL++LN LKSFQGK I+
Sbjct: 346 ATLPHGVDVPLEFYPQLYTEEAKNLLIKEVTKLSADSQTQARSILRNLNDLKSFQGKQIH 405

Query: 413 SFLNSTVDFAAKD-PLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWN 471
           SFLNS +DF  KD          +EL+ SL  +K+Q+ +KKT KM +YK +SH ++N+ N
Sbjct: 406 SFLNSALDFITKDMSGVSEQSGVQELVDSLQEVKQQLGSKKTEKMAQYKAVSHRLNNELN 465

Query: 472 LSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASIT 531
           LSHP+L ++  AK +GLIDEPYLLTSA++S  +Y+IR+ +G W+ V+  +N   ++ + T
Sbjct: 466 LSHPELGIIQRAKDLGLIDEPYLLTSAVISASNYFIRQNNGQWFHVVGRSNSEHMDVTKT 525

Query: 532 EPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEA 591
           +   VS +I+  TR ASE+PLMFTY K S I  E  +++++  N+G   F + DQ  +  
Sbjct: 526 DASTVSSAIRFHTRCASESPLMFTYFKPSAIDTEAQVKEAVGHNKGAKLFAEQDQKHINT 585

Query: 592 LQNNKVSDDILIDL 605
           L      D  LIDL
Sbjct: 586 LSAPDEED--LIDL 597

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/614 (45%), Positives = 396/614 (64%), Gaps = 40/614 (6%)

Query: 7   SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTE-------HVDLTQDDSD 59
           +++ L++MGIS +VA DAL RTNGD+EA+ N+IF  +  A          H++L    + 
Sbjct: 6   AVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQISENVEQRAHIELP---AG 62

Query: 60  SENGIKPGMLNDVIPXXXXXXXXXXXXXXXXIPDDVLAPSGIMDSTTQLLKDSLNDPTVV 119
           S +G +PG LN+ I                 + +D +     ++ + +  K  ++DPTVV
Sbjct: 63  SASGFQPGDLNEYI--SNAPDTESEDFEEIDVEEDSVETGPSLECSGR--KGQISDPTVV 118

Query: 120 LPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKG-YYSKPEYRLQFSSN 178
           LPLPPN L E YFALFCL V    PH   +PDF DLNY++NW++G  Y+  EYRL++ S 
Sbjct: 119 LPLPPNFLFEGYFALFCLFVANYMPHLLARPDFIDLNYDKNWYRGDSYTNAEYRLKYLSK 178

Query: 179 NN-----VSIVPKAQLTIQDS-LTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLE 232
           N      + IVPK +LT +D   TLQ ELLWQ QK  +V NS +SDR +V AK+F   +E
Sbjct: 179 NGSDDEQIEIVPKDELTQEDGDYTLQSELLWQLQKLASVANSRMSDRAYVRAKMFAIAVE 238

Query: 233 PLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPS----KDE 288
           P V   +   +HL EVLPSFIKS+A D+EMC   +D  ++R  FIS+A+H PS    ++E
Sbjct: 239 PQVQRNMAEAEHLHEVLPSFIKSVAVDLEMCPNFQD-NEVRECFISSAFHTPSNSAPQEE 297

Query: 289 KTIETLVSLLHFLPEEYDTNLYRMFNTLLYPXXXXXXXXX-------XNSLGNLAPMLTV 341
            T++T +SL HFLPEEY+TNLYRMFN LL+                  NSL  +AP+ T+
Sbjct: 298 STMKTWLSLFHFLPEEYETNLYRMFNALLFADDSVESDQSDSPDGEGENSLSEIAPVFTI 357

Query: 342 VFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLN 401
           VFDEM+E+TE V L +GV++PL+FYPQ+YTK  KD LI H+IAKR+++Q+ S AILQ++ 
Sbjct: 358 VFDEMEETTEAVPLAEGVEMPLEFYPQLYTKECKDKLIKHIIAKRRQSQTDSRAILQEIT 417

Query: 402 GLKSFQGKHINSFLNSTVDFAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKN 461
            LKSFQGK ++ F+NS++D+       Q D+ + EL+K L+ +K+QIT KKT KM EYK 
Sbjct: 418 DLKSFQGKDLSKFINSSLDY------LQKDEKSPELIKGLLDLKDQITNKKTKKMNEYKE 471

Query: 462 ISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEA 521
           I+H + ++WNLS P++ +V  AK++GLID+ YLLT A++SPY YY R RDG W+ V S  
Sbjct: 472 IAHRLQSEWNLSLPEIQIVKTAKELGLIDDSYLLTMAVISPYMYYTRNRDGQWFFVQSTP 531

Query: 522 NGSDLEA-SITEPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSK 580
             +     + + P E+ ++IK  TR  SE PLMF YCK+  I +++++ K+LE+NQG  +
Sbjct: 532 YEASYNVRACSSPLEIQDAIKQHTRRPSEAPLMFIYCKKGFIPDDDTVLKALENNQGCHR 591

Query: 581 FVKMDQTELEALQN 594
           F K DQ +L  +Q+
Sbjct: 592 FAKDDQLQLNKMQD 605

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  489 bits (1258), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 276/647 (42%), Positives = 386/647 (59%), Gaps = 76/647 (11%)

Query: 7   SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTE--------------HVD 52
           SI  L++MGI  ++A+DALSR NG+LEA+VN+IFS EL A  E              HV+
Sbjct: 8   SINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKANHVE 67

Query: 53  LTQDDS--------------------------DSENGIKPGMLNDVIPXXXXXXXXXXXX 86
           ++  +S                          +SEN      ++D I             
Sbjct: 68  ISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMDYYSSDSDY 127

Query: 87  XXXXIPDDVLAPSGIMDSTTQLLKDS-----LNDPTVVLPLPPNALLENYFALFCLSVGI 141
               + D++L PS       Q++K S     L DPTV+LPLPPN+++ENYFAL+ L +  
Sbjct: 128 ITNSVTDNLLPPS------YQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCITN 181

Query: 142 SFPHHFLKPDFQDLNYNRNWFKGY-YSKPEYRL-----QFSSNNNVSIVPKAQLTIQDSL 195
             PH  ++PDF+DL++  +WFKG  +SKP+  L     + +S + + I P   +   D  
Sbjct: 182 YLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQDDD- 240

Query: 196 TLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKS 255
             QPELLWQ QK  +++NS++S+R +V AKIF  +L+     +L   DHL EVLPSFIK 
Sbjct: 241 --QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKY 298

Query: 256 LANDVEMC-LLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFN 314
           L  ++E C   +ED  +IR LFIS+A++ PS D+  I TL+SL HFLP+EYD+NLY+MFN
Sbjct: 299 LVVNLESCPGFEED--EIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFN 356

Query: 315 TLLYPXXXXX------XXXXXNSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQ 368
            LLYP                NSLG+++P+L++VFDE +E +  +SL +GV+VPL+F+PQ
Sbjct: 357 VLLYPDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQ 416

Query: 369 IYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLF 428
           IYTK  K+ LI H+IAKRK+AQ  S  IL D+N +KSFQGK I  F+NS++++  +D   
Sbjct: 417 IYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDN-- 474

Query: 429 QNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGL 488
           ++D  TEELLK    IK  +   KT KM EY++++  + N+WN+S+P+ ++V+  +K+GL
Sbjct: 475 KSDNITEELLK----IKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGL 530

Query: 489 IDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEA-SITEPHEVSESIKLATRHA 547
           I EPYLL  A+LSPY YYIR+R G W  V     G D +    +   EV ++IK ATRHA
Sbjct: 531 IGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHA 590

Query: 548 SETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQN 594
           SETPLMF YC+   I  E  IRKS E N G   F K DQ  L  + N
Sbjct: 591 SETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMNN 637

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score =  483 bits (1244), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 266/654 (40%), Positives = 386/654 (59%), Gaps = 75/654 (11%)

Query: 5   NQSIQPLLDMGISHEVAVDALSR----------------------TNGDLEASVNYIFSG 42
           NQ+++ LL+MGI HEVA+DAL R                      T G+  A    I   
Sbjct: 4   NQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRISEN 63

Query: 43  ELQATTEHVDLT----QDDSD-------------------SENGIKPGMLNDVIPXXXXX 79
            + A +   D+     Q+D D                   +EN       N+  P     
Sbjct: 64  RMMAGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDITENHSGSSSSNERGPAARDY 123

Query: 80  XXXXXXXXXXXIPDDVLAPSGIMDSTTQLLKDSLNDPTVVLPLPPNALLENYFALFCLSV 139
                      I +  +AP           K +++DPTVVLPLP N+L+E+YF LF L V
Sbjct: 124 DHYS-------ISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLV 176

Query: 140 GISFPHHFLKPDFQDLNYNRNWFKGY-YSKPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQ 198
            + FPH FLKPDFQDLNY+ +WFKG  ++ P+YRL +   ++ S   +  L    S  LQ
Sbjct: 177 SVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQ 236

Query: 199 PELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLAN 258
           P LLWQ QK I+V+N+ + +R FVSA++F   LEP +  KL   +HL+EVLP+FIKSLA 
Sbjct: 237 PRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAV 296

Query: 259 DVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLY 318
           D+EMC    D R+ R LFIS+A H P+K+E  +ET +SL HFLPEEYD+NLY+MFN LLY
Sbjct: 297 DLEMCPGIRD-RETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLY 355

Query: 319 PXXXXXXXXXX----------------NSLGNLAPMLTVVFDEMDESTENVSLQQGVDVP 362
           P                          N+L  +AP+LT++F+E++ +TE+++L  GVD+P
Sbjct: 356 PEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIP 415

Query: 363 LKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFA 422
           L+FYPQ+YTK  KD LI HVI+KRK+A+  S  +LQ++N LKS+QGK+I++ L ST+ + 
Sbjct: 416 LEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYL 475

Query: 423 AKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDA 482
              P   N+K      + + S+K+ + + ++ KMEEYK+++  +H +W+LSHP+ +++  
Sbjct: 476 QASPNDANNKAA----RQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKT 531

Query: 483 AKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLE-ASITEPHEVSESIK 541
           AK++ LI+ PY+LT A LSPY Y++R R+G+W  V S A G++ +  +   P  V E+IK
Sbjct: 532 AKQLRLIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIK 591

Query: 542 LATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNN 595
             T++ASETPLMF YC+E KI  E  + K+L++N G SKF K D+  L  L+++
Sbjct: 592 HGTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSH 645

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  479 bits (1234), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 272/643 (42%), Positives = 392/643 (60%), Gaps = 54/643 (8%)

Query: 1   MEQANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL-------------QAT 47
           M     S++ ++DMGI  +VA+DAL+R NGDLEA+VN+IFS EL               T
Sbjct: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60

Query: 48  TEHVDLTQDDSDSENGIKPGMLNDVIPXXXXXXXXXXXXXXXXIPDDVLAPSGIMDSTT- 106
           +EHV+++ D     N  + G L++V+                 +  D ++   I+++   
Sbjct: 61  SEHVNISND-----NNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDIS 115

Query: 107 -------------QLLKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQ 153
                        ++ K SL+DPTVV+PLP N+++E+YF LF + + I  PH  LKPDF+
Sbjct: 116 NNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFK 175

Query: 154 DLNYNRNWFKGY-YSKPEYRLQFSSNNNV------SIVPKAQLTIQD-SLTLQPELLWQF 205
           DLNY+  W+ G  +  P++ ++  +  ++      SI P   LT  D  L  QP+LLWQ 
Sbjct: 176 DLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEP---LTCVDRDLDDQPKLLWQL 232

Query: 206 QKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLL 265
           QK   ++NS++S+R +VS+K+F   L+     KL   +HL+EVLPSFIK L +++EMC  
Sbjct: 233 QKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMC-- 290

Query: 266 KEDAR--DIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPXXXX 323
             D R  +IR   IS+AY+ PS DE  ++TL++L HFLP+EY++NLY+MFN LLY     
Sbjct: 291 -PDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYADDED 349

Query: 324 XXXX--XXNSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLINH 381
                   NSL  LAP LT++FDE+DE +    L +GV +PL+FYPQ+YTK  KD LI H
Sbjct: 350 GDGAIDEGNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKH 409

Query: 382 VIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQND--KDTEELLK 439
           +I KR++AQ  S   L+DLN LKSFQGK I  FLNST+DF  +D   QN   +   +L++
Sbjct: 410 IIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLME 469

Query: 440 SLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAI 499
            L  IKEQ+T KKT KM  YK+++  ++  WNLS+P++ ++  AKK+GLIDEPY L+ A+
Sbjct: 470 GLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAV 529

Query: 500 LSPYHYYIRKRDGIWYRVISEANGSDLE-ASITEPHEVSESIKLATRHASETPLMFTYCK 558
           +SP  YYI+KRDG WY V    NG D +    +   E+ + ++  TRH SETPLMF Y K
Sbjct: 530 MSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTK 589

Query: 559 ESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVSDDI 601
           E  I +++S++K LE N G  +F+K DQ  L  +  N+ SDD+
Sbjct: 590 EGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEMVMNE-SDDV 631

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score =  477 bits (1227), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 234/502 (46%), Positives = 334/502 (66%), Gaps = 21/502 (4%)

Query: 109 LKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGY-YS 167
            K ++ DPTVVLPLP N+L+E+YF LF L   + FPH FLKPDF+DLNY  +WFKG  ++
Sbjct: 143 FKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVFLKPDFKDLNYRADWFKGSSFT 202

Query: 168 KPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIF 227
           +P+YRL +    + S   +  L    +  LQP LLWQ QK I+V+N+   +R FVSAK+F
Sbjct: 203 EPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQLQKLISVVNTRKCERAFVSAKVF 262

Query: 228 HKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKD 287
              LEP +  KL   +HL+EVLP+FIKSLA D+EMC    D R+ R LFIS+A H P+K+
Sbjct: 263 TSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPGIRD-RETRSLFISSALHTPNKN 321

Query: 288 EKTIETLVSLLHFLPEEYDTNLYRMFNTLLYP--------------XXXXXXXXXXNSLG 333
           E  +ET +SL HFLPEEYD+NLY+MFN LLYP                        N+L 
Sbjct: 322 EPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEEDVIRGGEQEEARYVEPENTLK 381

Query: 334 NLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSAS 393
            +AP+LT++F+E++ +TE+VSL  GVD+PL+FYPQ+YTK  KD LI H+I+KRK+A++ S
Sbjct: 382 EVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRS 441

Query: 394 HAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQNDKDTEELLKSLVSIKEQITTKKT 453
             +LQ++N LKS+QGK+I++ L ST+ +    P    D    E  K + S+K+ + + + 
Sbjct: 442 RCLLQEINELKSYQGKNISTILESTLAYLQTIP----DDANNEAAKQIASLKDTLNSARA 497

Query: 454 NKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGI 513
            KMEEYK+++  +H +WNLSHP+ ++++ AK++GLI+ PY+LT A LSPY Y+IR R+G 
Sbjct: 498 AKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILTMAALSPYSYFIRSRNGA 557

Query: 514 WYRVISEANGSDLEA-SITEPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSL 572
           W  + S   G++ +    + P  V E+IK  T++ASETPLMF YC+E KI  E  + ++L
Sbjct: 558 WSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEVVAEAL 617

Query: 573 EDNQGVSKFVKMDQTELEALQN 594
           + N G  KF + DQ  L+ L++
Sbjct: 618 KSNSGCLKFAEDDQNSLKTLRS 639

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 44/60 (73%), Gaps = 3/60 (5%)

Query: 5  NQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDSENGI 64
          NQ+++ LL+MGI HEVAVDAL RT G+LEA+VN+IFS EL    E  ++ +++  S+  I
Sbjct: 4  NQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNEL---PEQAEMGEENDGSQPRI 60

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score =  475 bits (1223), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 233/498 (46%), Positives = 339/498 (68%), Gaps = 18/498 (3%)

Query: 109 LKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGY-YS 167
            K +++DPTVVLPLP N+L+E+YF LF L   + FPH FLKPDFQDLNY  +WFKG  ++
Sbjct: 136 FKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNYRPDWFKGSSFA 195

Query: 168 KPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIF 227
           +P YRL +  +++ S   +  +    S  +QP LLWQ QK I+V+N+ + +R FVSAK+F
Sbjct: 196 EPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISVVNTKMCERAFVSAKLF 255

Query: 228 HKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKD 287
              LEP +  KL   +HL+EVLP+FIKSLA D+EMC    D R+ R LFIS+A H P K+
Sbjct: 256 TLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRD-RETRNLFISSALHTPDKN 314

Query: 288 EKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPXXXX-----------XXXXXXNSLGNLA 336
           E  +ET +SL HFLPEEYD+NLY+MFN LLYP                     N+L  +A
Sbjct: 315 EPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEGEVVYGGDGAHQEPENTLKEVA 374

Query: 337 PMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAI 396
           P+LT++F+E++ +TE+V+L  GVDVPL+FYPQ+YTK  KD LI H+I+KRK+A+  S ++
Sbjct: 375 PVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRSL 434

Query: 397 LQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKM 456
           LQ++N LKS+QGK+I++ L ST+ +   D     D D E   K + S+K+ + + +  KM
Sbjct: 435 LQEINNLKSYQGKNISTILESTLAYLQAD---TKDADNEA-SKQIASLKDTLNSSRAAKM 490

Query: 457 EEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYR 516
           EEYK+++  +H +WNLSHP++++++ AK++GLI+ PY+L+ A+LSPY Y+ R RDG W  
Sbjct: 491 EEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYFTRDRDGEWSW 550

Query: 517 VISEANGSDLEAS-ITEPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDN 575
           + S   G++ + +  + P  V E+I+  T++ASE PLMF YC+E +I  ++ + K+LE+N
Sbjct: 551 IQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALENN 610

Query: 576 QGVSKFVKMDQTELEALQ 593
            G  KF K DQ+ L  L+
Sbjct: 611 TGCVKFAKDDQSTLNTLR 628

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (87%)

Query: 5  NQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL 44
          NQ+++ LL+MGI HEVAVDAL RT G+LEA+VN+IFS EL
Sbjct: 4  NQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNEL 43

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score =  466 bits (1198), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 228/504 (45%), Positives = 336/504 (66%), Gaps = 23/504 (4%)

Query: 109 LKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGY-YS 167
            K +++DPTVVLPLP N+L+E+YF LF L V + FPH FLKPDFQDLN+  +WFKG  ++
Sbjct: 142 FKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFT 201

Query: 168 KPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIF 227
           +P+YR+ +   ++ S      L    S  LQP LLWQ QK I+V+N+ + +R FVSAK+F
Sbjct: 202 EPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLF 261

Query: 228 HKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKD 287
              LEP +  KL + +HL+EVLP+FIKSLA D+EMC    D ++ R LFIS+A H P+K+
Sbjct: 262 TLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGIRD-QETRNLFISSALHTPNKN 320

Query: 288 EKTIETLVSLLHFLPEEYDTNLYRMFNTLLYP----------------XXXXXXXXXXNS 331
           E  +ET +SL HFLPEEYD+NLY+MFN LLYP                          N+
Sbjct: 321 EPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEEEVIRRGGTGQEEERYVEPENT 380

Query: 332 LGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQS 391
           L  +AP+LT++F+E++ +TE+V+L  GVD+PL+FYPQ+YTK  KD LI H+I+KRK+A+ 
Sbjct: 381 LKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARV 440

Query: 392 ASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQNDKDTEELLKSLVSIKEQITTK 451
            S  +L++++ LKS+QGK+  + L ST+ +  + P    D    E    + S+K+ + + 
Sbjct: 441 RSRYLLEEISALKSYQGKNTFTILESTLAYLQESP----DDANNEAASQIASLKDTLNSM 496

Query: 452 KTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRD 511
           ++ KMEEYK+++  +H +WNLSHP+ ++++ AK++GLI+ PY+LT A +SPY Y+IR R+
Sbjct: 497 RSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNRN 556

Query: 512 GIWYRVISEANGSDLEAS-ITEPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRK 570
           G+W  + S   G++ + +  +    V E+I+  T++ASE PLMF YC+E KI  E  + K
Sbjct: 557 GVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEK 616

Query: 571 SLEDNQGVSKFVKMDQTELEALQN 594
           +L+ N G SKF K DQ+ L  L +
Sbjct: 617 ALDSNNGCSKFAKDDQSSLRTLHS 640

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 8/73 (10%)

Query: 5  NQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL-----QATTEHVDLTQDDSD 59
          NQ+++ LL+MGI HEVAV+AL RT G+LEA+VN+IFS EL      +T  +V+L +    
Sbjct: 4  NQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPR---I 60

Query: 60 SENGIKPGMLNDV 72
          SEN I  G   DV
Sbjct: 61 SENRIMAGNSYDV 73

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  442 bits (1137), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 235/496 (47%), Positives = 327/496 (65%), Gaps = 20/496 (4%)

Query: 110 KDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGY-YSK 168
           K  + DPT+VLPLPPN+L+ENY AL+ LS+   F   FLKPDF+DLNY + W++     +
Sbjct: 166 KSDIADPTIVLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDE 225

Query: 169 PEYRLQFSSNNNVS--IVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKI 226
           P YR++F+  +     IVP A+LT  D    QP+LLWQ QK IAV+NS +S+R +VSAKI
Sbjct: 226 PFYRVKFNKADETENEIVPAAELTETDHP--QPKLLWQLQKLIAVVNSDLSERAYVSAKI 283

Query: 227 FHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSK 286
           F+      +  KLG  +HL EVLP FIK+LA D+E C   + + DI+ LFIS+A++KPS+
Sbjct: 284 FNSSSNQQLQSKLGDAEHLNEVLPYFIKALAVDLESCY-GDKSSDIKKLFISSAFYKPSQ 342

Query: 287 DEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPXXXXXXXXXX------NSLGNLAPMLT 340
           +E   ET +S  HFLPEEYDTNLY+MFN LL P                NSL  ++P LT
Sbjct: 343 NEPLQETYLSFFHFLPEEYDTNLYKMFNVLLIPDEDDEESGESDEDQPDNSLNIISPFLT 402

Query: 341 VVFDEMDESTE-NVSLQ---QGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAI 396
           +VF+EMDEST+ N++     QGVD+P +FYPQ+YTK  KD LI H+++KRKE++S    I
Sbjct: 403 IVFNEMDESTDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVI 462

Query: 397 LQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKM 456
           LQ++N LKS+ GK I  FLNST+DF  KD   ++  D  E+ + L  ++ QI  +K    
Sbjct: 463 LQEINALKSYHGKDILMFLNSTIDFLQKDSNAES-TDHLEVAQELNDLRAQINGRKAGLK 521

Query: 457 EEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGI--W 514
           +EYK +S  +HN+WNLS+PDL+++  AK +GLID PYLLT+ ++SPY Y++R R  +  W
Sbjct: 522 DEYKELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQW 581

Query: 515 YRVISEANGSDLE-ASITEPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLE 573
             V S   G+D    +  +   VS +IK  T+  +E+PLMF YCKE+ I +++ I K +E
Sbjct: 582 CLVQSNGLGTDFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIE 641

Query: 574 DNQGVSKFVKMDQTEL 589
           +N+G S F+K DQ  L
Sbjct: 642 ENEGCSSFIKADQLHL 657

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (72%)

Query: 1  MEQANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL 44
          M     S+  LL+MGIS  VA+DAL + +G+LEA++NYIFS ++
Sbjct: 1  MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDM 44

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  413 bits (1061), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 218/511 (42%), Positives = 312/511 (61%), Gaps = 37/511 (7%)

Query: 109 LKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGY-YS 167
           LKD L+ PT++LPLP N+++ENY +LF L+  I+ P  FLK DF+DLNYN+NW+KG  + 
Sbjct: 175 LKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFE 234

Query: 168 KPEYRLQFSSNNN-----------------VSIVPKAQLTIQDSLTLQPELLWQFQKFIA 210
            P++ L+F S+N+                 V I+P    T       QP LLWQ QK  A
Sbjct: 235 MPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIG--TSDKVEKQQPFLLWQLQKLAA 292

Query: 211 VLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDAR 270
           + + S+S+R + SA+IF  V    V   L   D+L +VLP FIKS+  D+++C    D  
Sbjct: 293 INSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDE 352

Query: 271 DIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYP--------XXX 322
             + LFI++A+H P K +  +ET ++  HF+PEEY+ NLY+MFN LLYP           
Sbjct: 353 SPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNG 412

Query: 323 XXXXXXXNSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLINHV 382
                  NSL   A ++TV+F+E D  T  ++   GV++PL FYPQ+Y K  KD LI H+
Sbjct: 413 EQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHI 472

Query: 383 IAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKD--PLFQNDKDTEELLKS 440
           + KR++A + S  +L ++  LKSF+GK I+  L S  ++  K+  P+ +N      L ++
Sbjct: 473 LEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKN------LHET 526

Query: 441 LVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAIL 500
           +  I+  I  KK +KMEEYK +S  +H  WNLSHP+L +++ AK +GLIDEPYLLT+ I+
Sbjct: 527 ITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVII 586

Query: 501 SPYHYYIRKRDGIWYRVISEANGSDLEASITEPH-EVSESIKLATRHASETPLMFTYCKE 559
           SPY YYIRK+DGIWY V     G+D + S  E    V E IK  T   +ETPLMF +C+E
Sbjct: 587 SPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRE 646

Query: 560 SKIGNENSIRKSLEDNQGVSKFVKMDQTELE 590
           S I +E+++RK++E+N G  +F K DQ  LE
Sbjct: 647 SIIPDEDTVRKAMEENLGCLQFAKQDQLSLE 677

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (73%)

Query: 5  NQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEH 50
          N++++ LL+MGI  EVAVDAL RT G+LE +V +IFS EL  T + 
Sbjct: 4  NETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQE 49

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  396 bits (1018), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 242/592 (40%), Positives = 338/592 (57%), Gaps = 63/592 (10%)

Query: 9   QPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDSENGIKPGM 68
           Q L++MGI+ EVA  AL +T+G+LEA+VNYIFSGE+   ++   + Q  S    G  PG 
Sbjct: 5   QSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEV---SDDQPVNQPQSAPMPGFAPGS 61

Query: 69  LNDVIPXXXXXXXXXXXXXXXX------IPDDVLAPSGIMDST---TQLLKDSL-NDPTV 118
           L+ V+                        P D    SG+ +      Q  K SL  DPTV
Sbjct: 62  LSGVMTNQIDDDEDDDSSSSERELSPPLPPRDSPGFSGMSEGVEIEIQSPKKSLVTDPTV 121

Query: 119 VLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGYYSKPEYRLQFSSN 178
           V+PLP ++L ENYFALF LS+    PH   KP+  DL YN  W +G           SS+
Sbjct: 122 VIPLP-HSLFENYFALFSLSMCQYLPHLMAKPELGDLMYNPKWAQG-----------SSD 169

Query: 179 NNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDK 238
            + S +                   Q Q+  +V+N+S SDR +VSAK+F  VL+  +  K
Sbjct: 170 PSTSFI------------------QQLQRLCSVVNASFSDRCYVSAKLFAAVLDAPLKRK 211

Query: 239 LGSCDHLFEVLPSFIKSLANDVEMC-LLKEDARDIRGLFISTAYHKPSKDEKTIETLVSL 297
           L   +HL EVLPSFI+SL + +E C    ED   IR LF+S+A     K      +L+S+
Sbjct: 212 LAEAEHLHEVLPSFIRSLIHALEECGCYAED--QIRSLFVSSALSSECK------SLLSV 263

Query: 298 LHFLPEEYDTNLYRMFNTLLYPXXXXXXXXXXNSLGNLAPMLTVVFDEMDESTENVSLQQ 357
           L F+PEEY+++LY MFN LLYP          NSL +LAP+LT+VFDEMD  TE V+  +
Sbjct: 264 LQFMPEEYESSLYAMFNALLYPELEEGEESG-NSLLDLAPVLTIVFDEMDADTE-VTSNR 321

Query: 358 GVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNS 417
           GVDVPL+FYPQ+YTKS KD+++  +  +RK AQ  S  +L ++NGLKS+QGK    F+NS
Sbjct: 322 GVDVPLEFYPQLYTKSVKDAIVRPLQQQRKAAQERSRQVLAEMNGLKSYQGKDTLKFINS 381

Query: 418 TVDFAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDL 477
           T+D+       Q D  ++E++  L S+K  I   KT +  EYK +S  +H +WNLSHP  
Sbjct: 382 TLDY------LQRDNQSKEIIDKLESLKNSIADHKTQRKNEYKELSQKLHGEWNLSHPT- 434

Query: 478 YVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASITEPHEVS 537
           Y+++ A + GLIDEPYLL   +LSP HY  R R G W  + +++N   +  S   P +V 
Sbjct: 435 YLINEAMERGLIDEPYLLAMVVLSPGHYLQRSRSGQWKMIRTDSNM--IRISDCAPSQVQ 492

Query: 538 ESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTEL 589
            +I+  T   S+TPLM  Y K S +  +  + KSLE N+G++ F+++DQ EL
Sbjct: 493 ATIRQHTTFPSKTPLMLLYVKSSHVSVDTIVSKSLESNEGITNFLRIDQEEL 544

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  363 bits (932), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/525 (38%), Positives = 305/525 (58%), Gaps = 37/525 (7%)

Query: 95  VLAPSGIMDSTTQLLKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQD 154
           +  P      T ++ K   +DPTV+L L P+ LL NYF LF +S+ +  P  F+ PDF +
Sbjct: 157 IFVPPVYSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPDFVN 216

Query: 155 LNYNRNWFKGY-YSKPEYRLQFSSN------NNVSIVPKAQLTIQD-SLTLQPELLWQFQ 206
           LN+N NW KG     PEY ++++ N      + + IV    L+ ++  LT QP +LWQ Q
Sbjct: 217 LNFNDNWNKGLQIDTPEYEVKYTHNLEPGLEDRIEIVNAINLSEKERELTYQPYILWQLQ 276

Query: 207 KFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLK 266
           K I+++NS IS R ++S+ I+   L+     KL    HL+++LP+FI+SL ND +  +  
Sbjct: 277 KVISIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSLMNDCKH-VPD 335

Query: 267 EDARDIRGLFISTAYHK-PSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPXXXXXX 325
            D   ++ +F+S A+H+ P   E T  +L  L HFLPEEYD+NLY+MFN+LLY       
Sbjct: 336 LDQNRMKNMFVSKAFHQIPIHKEPTKVSLF-LFHFLPEEYDSNLYKMFNSLLYRSYDEPI 394

Query: 326 XXXXN-------------------SLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFY 366
               N                   SL  ++ +LTV+FDE+D+ TE ++   GV++P +FY
Sbjct: 395 YPRTNQNSADSSSSDDEISNEEESSLDEISTILTVIFDELDQDTELITQPDGVEIPFEFY 454

Query: 367 PQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDP 426
           P++YTK  K+ LIN ++  R + +     +L DLN LKSF+GK I  FLNST+++     
Sbjct: 455 PELYTKKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRFLNSTLEY----- 509

Query: 427 LFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKM 486
             Q D     ++  L  +KEQ++  KT KM EYK IS  + N+WN+  P+L +++ A+ +
Sbjct: 510 -LQRDGKEGPMVNKLSYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPELSIIEQAQDL 568

Query: 487 GLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASITEPHE-VSESIKLATR 545
           GLI +P+LL  A+LSPY Y+ R R   W++  S   G+D E +  E  + V + IKL T+
Sbjct: 569 GLIGDPHLLVMAVLSPYLYFFRDRRNRWFKFQSSIMGTDFEITKYESDKTVQDEIKLNTK 628

Query: 546 HASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELE 590
            ASETP+MF YCK+  I N++ + +    NQG S F + D+  L+
Sbjct: 629 SASETPIMFVYCKKDAIPNDSLVLQKFAKNQGCSAFAQADEMSLK 673

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 14 MGISHEVAVDALSRTNGDLEASVNYIF 40
          MGI+ +VA   L++  G+LEA++N+IF
Sbjct: 1  MGIAKDVATSTLNKVGGNLEAAINHIF 27

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  360 bits (924), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/547 (38%), Positives = 311/547 (56%), Gaps = 57/547 (10%)

Query: 109 LKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKG-YYS 167
           LK  + DPT++LP+P N+LLENY AL  L++ I+ P  FL+PDF+DLNY  +W+KG   S
Sbjct: 165 LKARVTDPTIILPVPMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYENDWYKGNSLS 224

Query: 168 KPEYRLQFSSNNNVS------------IVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSS 215
            P Y L+  ++++              +  + +   Q +  +QP+LLWQ QK I+V+NS+
Sbjct: 225 IPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNST 284

Query: 216 ISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLL---------- 265
           +S+R ++S K+F   L P V   L + ++L +VLP F KSLA ++E C+           
Sbjct: 285 LSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEND 344

Query: 266 --------------KEDAR-DIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLY 310
                         +E  R ++  LF+STA ++ +   + ++T V+ L F PEEY++NLY
Sbjct: 345 KVDNADNDNNNGNSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLY 404

Query: 311 RMFNTLLYPXXXXXXXXX--------XNSLGNLAPMLTVVFDEMDESTENVSLQQGVDVP 362
           +MFNTLL+P                    L  +AP+ TVVF  MD +T+ V L  GVD+P
Sbjct: 405 KMFNTLLFPEIDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMP 464

Query: 363 LKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFA 422
           ++FYPQ+YT + +D+L+  V  +RKEA   S  +LQ  N L+SFQGK I  FL ST+D+ 
Sbjct: 465 MEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYL 524

Query: 423 AKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDA 482
            KD   +      + L+ +  ++  I   K   ME+YK +S  +    N+SHP++ ++D 
Sbjct: 525 TKDCGSET-----KALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQ 579

Query: 483 AKKMGLI-DEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASITEP---HEVSE 538
           AK   LI DEPYLLT A++SP  Y+IR R G WY V    N    E  ITE      V  
Sbjct: 580 AKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLV--RFNMISTEFQITECESIRNVQT 637

Query: 539 SIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVS 598
           +IK  T HA+E PLMF YC++S I ++  I+K LEDN+G  +F K DQ  L+ L+    S
Sbjct: 638 AIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQQIFS 697

Query: 599 DDILIDL 605
            D + D+
Sbjct: 698 SDDIQDV 704

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 3  QANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDS 60
          ++N S+  L++MGI  EVAV+AL R NG+LEA+V +IFS E+           +D+D+
Sbjct: 2  ESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDT 59

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  312 bits (800), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 198/526 (37%), Positives = 300/526 (57%), Gaps = 64/526 (12%)

Query: 99  SGIMDSTTQLLKDSLNDPTVVLPLP--PNALLENYFALFCLSVGISFPHHFLKPDFQD-- 154
           + I D   Q  K++++ PTVV+P P  PN +   Y ALF L + I  PH+F+K D  D  
Sbjct: 121 TSIDDLIPQQFKNTMDYPTVVIPAPAVPNHIY--YCALFALFISIHLPHYFVKADHDDMP 178

Query: 155 LNYNRNWFKGYYSKPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNS 214
           L ++ +WF     +PE               +  L ++D          Q  K IAV NS
Sbjct: 179 LLFSPDWFNDIDREPE--------------DEPLLVLRD----------QLHKLIAVQNS 214

Query: 215 SI-SDRKFVSAKIFHKVL-------EPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLK 266
           +  S R FV++K+F   L       EP++ +   +  HL+++LPSFIK++AN        
Sbjct: 215 NDHSARAFVTSKMFDVDLQSVIQSNEPMLTNP--NYFHLYQILPSFIKTIANL------- 265

Query: 267 EDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPX-----X 321
             +   + LFIS+A     +   + E+L+SL HFLPEEY++NLY+MFN LLYP       
Sbjct: 266 --SYTEKNLFISSAIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNVLLYPDDDHDIG 323

Query: 322 XXXXXXXXNSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLINH 381
                   NSL  LAP++T++F+E +   EN  +  GV+VPLKFYPQ+YTK  KD LI+H
Sbjct: 324 EDEDEVSENSLKELAPVMTIIFNEAENIDENAPVTNGVEVPLKFYPQLYTKKCKDQLISH 383

Query: 382 VIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQNDKDTEELLKSL 441
           V++KRK+ +     IL+D+  LKS+QGK I SF+NS++D+  K      DKD   + + L
Sbjct: 384 VLSKRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLDYLTK------DKDDSGIAEEL 437

Query: 442 VSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILS 501
             +K+++T KKT KM  YK IS  +H +WN+ +P+L +V+ A K+GLIDEPY L  A++S
Sbjct: 438 HKLKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKLGLIDEPYFLNLAVVS 497

Query: 502 PYHYYIRKRDGIWYRV-ISEANGSDLEASITE---PHEVSESIKLATRHASETPLMFTYC 557
           P+ Y++R R   WY V  +  N ++ + S+ +   P EV + +K +T   + TPLMF Y 
Sbjct: 498 PFFYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVPNSTPLMFVYS 557

Query: 558 KESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVSDDILI 603
           K+S + ++  +++ L  N+ +  F K DQ  L+  +N +   DI I
Sbjct: 558 KDSYMADDTEMQELLSQNKTLLDFFKQDQIYLQNFENARGEGDIRI 603

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 28/35 (80%)

Query: 7  SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFS 41
          ++Q LL+MGI+ +VA  AL   NGD+EA++NYIF+
Sbjct: 6  NVQSLLEMGIARDVAEQALRECNGDVEAALNYIFN 40

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  309 bits (792), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 168/489 (34%), Positives = 272/489 (55%), Gaps = 35/489 (7%)

Query: 130 NYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKG-YYSKPEYRLQ--FSSNNNVSIVPK 186
           NY  LF  +V    P  F++ DF++LNY+  W+ G    +P   +    +   +  IVP+
Sbjct: 176 NYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPE 235

Query: 187 AQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLF 246
            ++T      +QPE+LWQ Q+ I+V +S +S+R +VSAK+F KV +  V   +   DHL+
Sbjct: 236 EEVT--SDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLY 293

Query: 247 EVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYD 306
           E LPSFIKS+  D EMC  +    D++ +F+S+A     +  +  ET + L HF PEEY+
Sbjct: 294 EALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYN 353

Query: 307 TNLYRMFNTLLYPX-------------XXXXXXXXXNSLGNLAPMLTVVFDEMDESTENV 353
            NLY+MFN LLYP                        SL  LAP+LT++F+E D    + 
Sbjct: 354 ANLYKMFNALLYPEDDTIDDNSSDTDSSNDTDVQVEGSLKELAPLLTIIFNEADPGQLSA 413

Query: 354 SLQ-------QGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSF 406
             Q       QGV+VP  FYPQ+YT+  K+ ++  ++ +RK A++     L  +N LKS+
Sbjct: 414 GAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSY 473

Query: 407 QGKHINSFLNSTVDFAAKDPLF-----QNDKDTEELLKSLVSIKEQITTKKTNKMEEYKN 461
           +GK   +FL    +  A  P       +   + +E+++ + SIK Q+  ++    ++Y +
Sbjct: 474 EGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYVD 533

Query: 462 ISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGI--WYRVIS 519
           +S+ + N+WN+S+P+  V+  AK++GL+D+P+LL+  +LSPY Y +R   G   W  V S
Sbjct: 534 LSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQS 593

Query: 520 EANGSD--LEASITEPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQG 577
            + G+D  +   +TE  +V + I+  T+ A++ PLMF YC+E    ++     ++E N G
Sbjct: 594 NSYGTDGLITKHVTE-EKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMG 652

Query: 578 VSKFVKMDQ 586
            S+F K DQ
Sbjct: 653 CSEFNKADQ 661

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 1  MEQANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDS 60
          M +   ++  L +MGI  +VA+DAL R NG+L A+VNYIFS ++ A  EHV+L Q    S
Sbjct: 1  MGEEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPA-GEHVELPQPRESS 59

Query: 61 ENGIKPGMLNDVI 73
          +  +KPG L+ V+
Sbjct: 60 D--LKPGDLDQVL 70

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  301 bits (771), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 176/484 (36%), Positives = 275/484 (56%), Gaps = 20/484 (4%)

Query: 119 VLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGYYSKPEYRLQFSSN 178
           +LP   +ALLE+YF LF L + ++ P  FL  DF++L YN +WFKG   + +YRL    N
Sbjct: 57  ILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKGELVQSDYRL-VHRN 115

Query: 179 NNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDK 238
               ++ K +LT  + L +QPEL+ + Q  I + N   S R+FV++++ +K  +  V   
Sbjct: 116 AGPLLIHKRELTGSEYLEMQPELIPRMQLLIGIANDPESMRRFVASELINKGTDFNVSRA 175

Query: 239 LGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLL 298
           L  CDHL EV P FIK+L ND+++CL  +D +    LF+S A H+P+  E    T +S+L
Sbjct: 176 LSECDHLSEVFPQFIKNLHNDMDLCL--KDDKSTSKLFLSKALHRPNVLEPFQPTSLSVL 233

Query: 299 HFLPEEYDTNLYRMFNTLLYPXXXXXXXXXXNSLGNLAPMLTVVFDEMDESTENVSLQQG 358
           +F PE Y   LY MFN +L P          N+   LAP+ T++FD+MD++TE V+L  G
Sbjct: 234 NFSPENYAYTLYEMFNPMLLPEDSGRGYEIENAFDFLAPVFTIIFDDMDDTTEEVNLSHG 293

Query: 359 VDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNST 418
           V +P++FYPQ+YTK++ + ++  V+ +    ++ +   +  ++ L+SFQGK I+SFLNS+
Sbjct: 294 VQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNKLKVDQMSSLQSFQGKQISSFLNSS 353

Query: 419 VDFAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLY 478
           +++  + PL   DK ++EL+ +L  IK Q++ KK   M +Y      I +  +   P   
Sbjct: 354 INYLEEIPLGDEDK-SKELVDTLEKIKYQLSNKKREMMADYTETQRQI-DLLSFEGPSEK 411

Query: 479 VVDAAKKMGLIDEPYLLTSAILSPYHYYIRKR----DG-----------IWYRVISEANG 523
           ++D AK++G+IDEPYLL   + SP  Y I +     DG            + R I E   
Sbjct: 412 IIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISADDGNTGMETGNNNLQYIRNIIEFGS 471

Query: 524 SDLEASITEPHEVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVK 583
           S L        E  +  K  TRHASETP++F Y K+  I     I  S+ +N+ ++ F+K
Sbjct: 472 SSLTQEELTAQETQDITKSHTRHASETPILFVYIKKDHIDAPQDILASISENETLTNFLK 531

Query: 584 MDQT 587
            + T
Sbjct: 532 EEHT 535

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  301 bits (770), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 191/537 (35%), Positives = 291/537 (54%), Gaps = 73/537 (13%)

Query: 104 STTQLLKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHH-FLKPDFQDLNYNRNWF 162
           S T   K  ++DPTV+LPL  N LLENY +LF  S+ +  P   F    F DL YN+ W+
Sbjct: 172 SYTSTHKLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWY 231

Query: 163 KGYYSKPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFV 222
                         SNNN       + T  DSL LQ       Q+  +++NS +S+R F+
Sbjct: 232 S------------ISNNN-------ENTTTDSLFLQ------LQRVTSIINSRMSERAFI 266

Query: 223 SAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYH 282
           S K+F       +   L   DHL E+   FI+SL   V   + K+       + ++TA +
Sbjct: 267 STKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTVLPPIFKD-------ILVTTAIN 319

Query: 283 KPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPXXXXXXXXXXN------------ 330
           K S+  +   + +S+++FLPEEY++NLY+MFN L+YP          +            
Sbjct: 320 KDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNDDEQSDESLQTDDDDND 379

Query: 331 -----SLGNLAPMLTVVFDEMDES-TENVSLQQGVDVPLKFYPQIYTKSSKDSLINHVIA 384
                +L  ++P+ T++F+E DES + + +L +GV++PL+FYPQ+Y+K   D LI H+I+
Sbjct: 380 DANDSALEEISPIFTILFEEYDESDSSSTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIIS 439

Query: 385 KRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQNDKDTEELLKSLVSI 444
           KRKEAQS S ++L ++N LKSFQGK I   L ST+D+  KD    + ++T+    +L +I
Sbjct: 440 KRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKD----SQRETKS-ANNLTNI 494

Query: 445 KEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAILSPYH 504
             ++   K  KM++YK ++  +H++WNLSHP+  +++ AK++ LID PY L+  I SP  
Sbjct: 495 LTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDL 554

Query: 505 YYIRKRDGIWY----RVISEANGSDLEASITEPH-------------EVSESIKLATRHA 547
           Y I+K +  WY    R I++    +   +    +             E+ + IK  TR+ 
Sbjct: 555 YLIKKANVDWYLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCNSEIEIQDIIKQKTRNP 614

Query: 548 SETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVSDDILID 604
           SETPLMF YCKES + NE+ + KS E N   +KF+K DQ  L     N    DI +D
Sbjct: 615 SETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNESNMNSGESDIDMD 671

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 6  QSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL--QATTEHVDLTQDDSDSENG 63
          + IQ L+DMGI  +VA +AL   NG++EA+VNYIFS EL  QA+       + D +S+N 
Sbjct: 5  EKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIDENSDNN 64

Query: 64 IKPGMLND 71
              + ND
Sbjct: 65 TNTNVYND 72

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 10/70 (14%)

Query: 7   SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFS-----GELQATTEHVDLTQDDSDSE 61
           S+Q +L MG+  +++  AL+  +GD+ AS  ++F+     GEL++  E V     +  +E
Sbjct: 680 SLQTMLAMGLDAKLSRKALTIYSGDVAASTEWVFNNLDDDGELESVHEEV-----EERTE 734

Query: 62  NGIKPGMLND 71
            G +PG L++
Sbjct: 735 GGSEPGNLDN 744

>NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] {ON}
            Anc_7.488 YBL047C
          Length = 1389

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 7    SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSG 42
            +I+ L  MG S E A +AL + N DL+A+ N++  G
Sbjct: 1353 AIEELSGMGFSEEEATNALKKCNWDLDAATNFLLDG 1388

>ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} weakly
            similar to uniprot|P34216 Saccharomyces cerevisiae
            YBL047C EDE1 Key endocytic protein involved in a network
            of interactions with other endocytic proteins binds
            membranes in a ubiquitin-dependent manner may also bind
            ubiquitinated membrane-associated proteins
          Length = 1455

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 7    SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIF 40
            +++ L  MG + + AVDAL R   DLEA+ NY+ 
Sbjct: 1419 AVEELSGMGFTEQEAVDALERCKWDLEAATNYLL 1452

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 31/48 (64%), Gaps = 5/48 (10%)

Query: 6   QSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIF-----SGELQATT 48
           +S+  ++DMG++ ++++ AL    GD+ AS+ ++F     +GEL + T
Sbjct: 668 ESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSET 715

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
            YBL047C (REAL)
          Length = 1380

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 7    SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIF 40
            +++ L  MG + E A +AL R+N DLEA+ N++ 
Sbjct: 1344 AVEELSGMGFTEEEAHNALERSNWDLEAATNFLL 1377

>SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa]
            {ON} similar to uniprot|P34216 Saccharomyces cerevisiae
            YBL047C EDE1 Key endocytic protein involved in a network
            of interactions with other endocytic proteins binds
            membranes in a ubiquitin-dependent manner may also bind
            ubiquitinated membrane-associated proteins
          Length = 1297

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 7    SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIF 40
            +++ L  MG + E A  AL + N DLEA+ NY+ 
Sbjct: 1261 AVEELSSMGFTQEEATKALEQCNWDLEAATNYLL 1294

>NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8.331
           YDR150W
          Length = 2447

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 17/100 (17%)

Query: 456 MEEYKNISHMIHNKWNLSHPDL-YVVDAAKKMGL----IDEPYLLTSAILSPYHYYIR-K 509
           +EEY N+        N + P + ++   AK MG     +DE   L +   SP   ++R K
Sbjct: 796 LEEYNNLQE------NYNQPTMEFLAAKAKSMGQYILPVDEYNTLQTTSTSPPLEFLREK 849

Query: 510 RDGIWYRVISEANGSDLEASITEPHEVSESIKLATRHASE 549
            + I Y++IS A    L+ SIT P     S++     ASE
Sbjct: 850 ANSIDYQIISSAEYKQLQDSITHP-----SLQFLVEKASE 884

>Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar to
            Ashbya gossypii ABR149W
          Length = 1269

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 7    SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIF 40
            +I+ L +MG S E AV AL +   DLEA+ N++ 
Sbjct: 1233 AIEELSNMGFSEEEAVKALEKCKWDLEAATNFLL 1266

>KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {ON}
            Anc_7.488 YBL047C
          Length = 1261

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 7    SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSG 42
            +I+ L  MG + E A +AL + N DLEA+ N +  G
Sbjct: 1225 AIEELSGMGFAEEEAKNALEKCNWDLEAATNLLLDG 1260

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 6   QSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIF 40
           Q+I+ L+D+G   +  V AL +TNG+ E + + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 6   QSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIF 40
           Q+I+ L+D+G   +  V AL +TNG+ E + + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa]
           {ON} similar to uniprot|P22219 Saccharomyces cerevisiae
           YBR097W VPS15 Myristoylated Serine/threonine protein
           kinase involved in vacuolar protein sorting
          Length = 1412

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 404 KSFQGKHINSFLNSTVDFAAKD-----PLFQ-NDKDTEELLKSLVSIKEQITTKKTNKME 457
           K    K++NSF N+TV+F +K+       FQ N K ++  + S+ +I+  +TT+  N ++
Sbjct: 764 KHLPTKNVNSFGNNTVEFISKNFSVNNYGFQTNFKPSKSHVTSIANIEIPLTTEDKNWID 823

Query: 458 EYKNISHMIHNKWNLSHPDLYVVDAAKKMG 487
           + KN+       W L+    YV   +K + 
Sbjct: 824 KIKNVGLSETELWKLAALRPYVFRVSKMLS 853

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 24/36 (66%)

Query: 6   QSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFS 41
           +S+  ++ MG++  ++  AL   NGD+ AS+ ++F+
Sbjct: 643 ESLNSMISMGLAQNLSRKALILNNGDINASIEWVFN 678

>CAGL0J04642g Chr10 (439679..445423) [5745 bp, 1914 aa] {ON} similar
            to uniprot|Q06409 Saccharomyces cerevisiae YLR422w
          Length = 1914

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 5/104 (4%)

Query: 502  PYHYYIRKRDGIWYRVISEANGSDLEASITEPHEVSESIKLATRHASETPLMFTYCKESK 561
            PY YY    D I Y  ++      L  +IT    +   I+L  R+     L+  YCK++ 
Sbjct: 989  PYFYYSDNNDVISYTRVANTVMMTLLENITNVQILRNLIRLIPRYCEYFILIRKYCKKAN 1048

Query: 562  IGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVSDDILIDL 605
                  I   L   Q     + MD     ++ N++V  +IL+++
Sbjct: 1049 FFRTRRIFTKLFPTQTAPFSIPMD-----SIVNDEVVIEILLEI 1087

>KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 414

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 26/37 (70%)

Query: 4   ANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIF 40
           A   I+ L+D+G S + A++AL++T G+++ + + +F
Sbjct: 377 AESDIKKLVDLGFSRKEAINALNKTGGNVDYAASLLF 413

>Kwal_55.20425 s55 complement(394989..398099) [3111 bp, 1036 aa]
           {ON} YFR030W (MET10) - subunit of assimilatory sulfite
           reductase [contig 149] FULL
          Length = 1036

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 13/72 (18%)

Query: 394 HAILQDLNGLKSFQ------GKHINSFLNSTVDFAAKDPLFQNDKDTEELLKSLVSIKEQ 447
           H IL+    L++F       GK   SF  S V+FA+ D       D +  L++LVS +  
Sbjct: 725 HQILESRTVLQAFTENLDIFGKPAKSFYQSLVEFASND-------DEKRKLEALVSPEGA 777

Query: 448 ITTKKTNKMEEY 459
           +T KK   +E Y
Sbjct: 778 VTLKKYQDVEYY 789

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,580,707
Number of extensions: 2885754
Number of successful extensions: 10884
Number of sequences better than 10.0: 72
Number of HSP's gapped: 11170
Number of HSP's successfully gapped: 85
Length of query: 605
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 490
Effective length of database: 40,294,809
Effective search space: 19744456410
Effective search space used: 19744456410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)