Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G03520g5.473ON36936918330.0
YOR136W (IDH2)5.473ON36936916030.0
NDAI0C014105.473ON36936915960.0
Skud_15.3005.473ON36936915910.0
Smik_15.3165.473ON36936915880.0
Suva_8.1885.473ON36936915780.0
Kwal_55.212735.473ON36836915710.0
KLTH0F15048g5.473ON36836915660.0
Ecym_23135.473ON37036015650.0
KLLA0E03125g5.473ON36836915630.0
TDEL0A033705.473ON37137115600.0
CAGL0I07227g5.473ON36836915570.0
NCAS0H022505.473ON42236915540.0
AFR137C5.473ON36736915450.0
KNAG0B040705.473ON37337315350.0
Kpol_440.125.473ON36836915010.0
ZYRO0D11220g5.473ON36836914430.0
Kpol_543.85.473ON36836914370.0
TBLA0B022405.473ON37337314350.0
KAFR0B063705.473ON37837814300.0
TPHA0J027705.473ON37635414270.0
TPHA0E014805.473ON37735813160.0
Ecym_33162.278ON3623726822e-86
ADL223W2.278ON3623566822e-86
KLLA0F04103g2.278ON3613436813e-86
Smik_14.2902.278ON3603666752e-85
NDAI0B035902.278ON3593436752e-85
KLTH0G10186g2.278ON3603456701e-84
ZYRO0D02838g2.278ON3613446692e-84
Skud_14.2932.278ON3613666692e-84
SAKL0E07876g2.278ON3613456673e-84
CAGL0G02673g2.278ON3583676664e-84
YNL037C (IDH1)2.278ON3603666631e-83
Kwal_23.50122.278ON3613456604e-83
TBLA0B069102.278ON3653446492e-81
TDEL0C038402.278ON3613766343e-79
TPHA0D015602.278ON3603556318e-79
KNAG0A052802.278ON3613636249e-78
NCAS0B062902.278ON3593436231e-77
Kpol_1039.352.278ON3593626195e-77
KAFR0J014102.278ON3503715891e-72
Suva_14.3022.278ON3002865181e-62
KLLA0E08339g2.287ON3693964029e-45
TBLA0B059402.287ON3693903993e-44
Kpol_1003.392.287ON3703963976e-44
CAGL0G02585g2.287ON3723593968e-44
TPHA0C034102.287ON3713873942e-43
SAKL0E07656g2.287ON3683963905e-43
KNAG0A054202.287ON3723613872e-42
ADL214C2.287ON3673533844e-42
NDAI0B035502.287ON3723543845e-42
ZYRO0A01914g2.287ON3683963836e-42
NCAS0B062502.287ON3733873828e-42
YIL094C (LYS12)2.287ON3713603829e-42
Smik_9.852.287ON3713603783e-41
Suva_9.1052.287ON3713603757e-41
Skud_9.792.287ON3713603741e-40
Ecym_33262.287ON3663743741e-40
KAFR0J013602.287ON3733913565e-38
Kwal_27.115282.287ON3673963547e-38
TDEL0G021802.287ON3693903548e-38
KLTH0G10384g2.287ON3673593549e-38
AAL012C1.402ON3723492267e-20
TBLA0C015001.402ON3652702115e-18
Kwal_0.2251.402ON3643652081e-17
Smik_3.661.402ON3643632072e-17
Ecym_12961.402ON3632762063e-17
KLLA0D04906g1.402ON3623572053e-17
Skud_3.431.402ON3643592054e-17
ZYRO0E04796g1.402ON3622682036e-17
NDAI0G042301.402ON3633632011e-16
TDEL0B060001.402ON3622682002e-16
SAKL0D08690g1.402ON3642681983e-16
YCL018W (LEU2)1.402ON3643591983e-16
CAGL0H03795g1.402ON3653581965e-16
Kpol_1048.631.402ON3643691922e-15
KNAG0I012801.402ON4473611922e-15
KLTH0H12188g1.402ON3642681895e-15
NCAS0C048701.402ON3652681877e-15
Suva_3.31.402ON3642701879e-15
KAFR0I022001.402ON3652681861e-14
TPHA0B037301.402ON3652681762e-13
Suva_14.303singletonON53511162e-07
KLTH0G12474g8.314ON22992731.1
Kwal_26.7784singletonOFF16744711.2
KNAG0H010303.302ON443140722.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G03520g
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   710   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   622   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   619   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   617   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   616   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   612   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   609   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   607   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   607   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   606   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   605   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   604   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    603   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   599   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   595   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   582   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   560   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   558   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   557   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   555   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   554   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   511   0.0  
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   267   2e-86
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   267   2e-86
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   266   3e-86
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   264   2e-85
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   264   2e-85
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   262   1e-84
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   262   2e-84
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   262   2e-84
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   261   3e-84
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   261   4e-84
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   259   1e-83
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   258   4e-83
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            254   2e-81
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   248   3e-79
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   247   8e-79
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              244   9e-78
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   244   1e-77
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   243   5e-77
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   231   1e-72
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   204   1e-62
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   159   9e-45
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   158   3e-44
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   157   6e-44
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   157   8e-44
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   156   2e-43
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   154   5e-43
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              153   2e-42
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   152   4e-42
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   152   5e-42
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   152   6e-42
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   151   8e-42
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   151   9e-42
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   150   3e-41
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   149   7e-41
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   148   1e-40
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   148   1e-40
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   141   5e-38
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   140   7e-38
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   140   8e-38
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   140   9e-38
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    92   7e-20
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    86   5e-18
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    85   1e-17
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    84   2e-17
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    84   3e-17
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    84   3e-17
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    84   4e-17
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    83   6e-17
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    82   1e-16
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    82   2e-16
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    81   3e-16
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    81   3e-16
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              80   5e-16
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    79   2e-15
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    79   2e-15
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    77   5e-15
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    77   7e-15
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       77   9e-15
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    76   1e-14
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    72   2e-13
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    49   2e-07
KLTH0G12474g Chr7 (1059087..1059776) [690 bp, 229 aa] {ON} simil...    33   1.1  
Kwal_26.7784 s26 (509503..510006) [504 bp, 167 aa] {OFF} [contig...    32   1.2  
KNAG0H01030 Chr8 complement(172427..173758) [1332 bp, 443 aa] {O...    32   2.1  

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/369 (95%), Positives = 351/369 (95%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV
Sbjct: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVVSNPGAYADTVSVCPNLYGDI                  ANIGHKVSIFEAVHGSAP
Sbjct: 241 LNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/369 (80%), Positives = 325/369 (88%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLR+   R   RRFL++ KQPSIGR+TGKPNPSTGKYTVSFIEGDG+GPEISKSVK IF+
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VP+EWESCDV+P+F+NGLTTIP PAV SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEYARA+GRP+V+VVHKSTIQRLADGLFV+VAKELS EYPD+ L+ +L+DN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSV 240

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L VV+NP AY D VSVCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGL   AD I+ AVLSTIASGPENRT DLAG+A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/369 (80%), Positives = 327/369 (88%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           M R+ +LR   RRFLS K QPSIG+FTGKPNPSTGK+TVSFIEGDG+GPEIS+SVK IF 
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP++WE CDV+PLFINGLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EGFKT Y+NVDLV+IRENTEGEYSGIEHVV+PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYA+EYARA+GRP+V+VVHKSTIQRLADGLFVDVAKELS EYPDIQL+ +L+DNTV
Sbjct: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVVSNP +Y++ VSVCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 241 LNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGL   AD IEKAVLSTIASGPE RT DLAG A+TSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360

Query: 361 FTEAVIKRL 369
           FT+AVI RL
Sbjct: 361 FTDAVIGRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/369 (80%), Positives = 322/369 (87%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLRS + R   RRFL++ KQPSIGRFTGKPNPSTG+YTVSFIEGDG+GPEISKSVK IF 
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VP+EWESCDV P+F+NGLTTIP  AV SI  NLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEYARA+GRP+V+VVHKSTIQRLADGLFV+VAKELS EYPDI L+ +L+DN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L VV+NP AY + VSVCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGL   AD I+ AVLSTIASGPENRT DLAG+A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/369 (80%), Positives = 323/369 (87%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLR+   R   RRFL++ KQPSIG++TGKPNPSTGKYTVSFIEGDG+GPEISKSVK IF+
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VP+EWE CDV P+F+NGLTTIP PAV SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEYARA+GRP+V+VVHKSTIQRLADGLFV+VAKELS EYPDI L+ +L+DN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDNSV 240

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L VV+NP AY + VSVCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGL   AD I+ AVLSTIASGPENRT DLAG+A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/369 (79%), Positives = 323/369 (87%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLR+  LR   RRFLS+ KQPSIGR+TGKP+PSTG+YTVSFIEGDG+GPEISKSVK IF+
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP+ WE CDV P+F+NGLTTIP PAV SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEYARA+GRP+++VVHKSTIQRLADGLFV+VAKELS EYPDI  + +L+DN V
Sbjct: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVV+NP AY + VSVCPNLYGDI                  ANIGHKVSIFEAVHGSAP
Sbjct: 241 LNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAG++KANPTALLLSSVMMLNHMGL   AD I+ AVLSTIASGPENRT DLAG+A+TSS
Sbjct: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/369 (80%), Positives = 323/369 (87%), Gaps = 1/369 (0%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           M RSQ  R    RF ++KKQPSIGR+TGKP+P+TGKYTVSFIEGDGVGPEISK+VKDIFA
Sbjct: 1   MFRSQFGRNT-LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+ P++WE+CDVTPLFINGLTTIPQPA DSINKNLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS++GFKT Y+NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT+DAS
Sbjct: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEYARAV RPKV+VVHKSTIQRLADGLFV VA++L+ EYPDI+LQ +L+DNTV
Sbjct: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L+ V +P  Y+D V VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGL E AD IEKAV STIASGPENRT DLAGSASTSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359

Query: 361 FTEAVIKRL 369
           F EAVI RL
Sbjct: 360 FAEAVISRL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/369 (79%), Positives = 323/369 (87%), Gaps = 1/369 (0%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           M +S  +R    RFL++KKQPSIGR+TGKP+P+TGKYTVSFIEGDGVGPEISK+VKDIFA
Sbjct: 1   MFKSSFVRN-SARFLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+ P++WESCDV+PLFINGLTTIPQPA DSINKNLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSV+G+KT Y+NVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT+DAS
Sbjct: 120 TFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEYARAV RPKV+VVHKSTIQRLADGLFV VA++LS EYPDI+LQ +L+DNTV
Sbjct: 180 ERVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDNTV 239

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L+ V +P  Y+D V VCPNLYGDI                  ANIGHKVSIFEAVHGSAP
Sbjct: 240 LHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGL E AD IEKAV +TIA+GPE+RT DL GSASTSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSS 359

Query: 361 FTEAVIKRL 369
           F EAVI RL
Sbjct: 360 FAEAVISRL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/360 (81%), Positives = 323/360 (89%), Gaps = 2/360 (0%)

Query: 12  RRFLSS--KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWE 69
           RR+L+S  +KQPSIGRFTGKPNP TGKYTVSFIEGDG+GPEIS+SVKDIF+AA+VPVEWE
Sbjct: 11  RRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIFSAAKVPVEWE 70

Query: 70  SCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVR 129
            CDVTP+FINGLTTIP PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVR
Sbjct: 71  YCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVR 130

Query: 130 PAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFE 189
           PAKS+EGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFE
Sbjct: 131 PAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFE 190

Query: 190 YARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGA 249
           YARAVGRPKV+VVHKSTIQRLADGLFV+VA+E+  EYPDI+LQ +L+DNTVLNVVS P  
Sbjct: 191 YARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDNTVLNVVSKPEK 250

Query: 250 YADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKAN 309
           Y+D+V+VCPNLYGDI                  ANIGH VSIFEAVHGSAPDIAGQN AN
Sbjct: 251 YSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCAN 310

Query: 310 PTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           PTALLLSSVMMLNHMGL+E AD IE AVL+T+AS  +NRTADLAG+A+TSSFT+AVI+RL
Sbjct: 311 PTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/369 (80%), Positives = 323/369 (87%), Gaps = 1/369 (0%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           M R  +++Q   RFL++KKQPSIGR+TGKPNP TGKYTVSFIEGDGVGPEISKSVK IF+
Sbjct: 1   MFRQSIVKQ-SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP+EWESCDV+P+F+NGLTTIP PAV SINKNLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EG+KTTYENV+LVLIRENTEGEYSGIEHVV+PGVVQSIKLIT+DAS
Sbjct: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEYARAV R KV+VVHKSTIQRLADGLFVDVAK+LSSEYPDI+LQ +LLDNTV
Sbjct: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L  V +P AY D V VCPNLYGDI                  ANIGH VSIFEAVHGSAP
Sbjct: 240 LKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGL E AD IEKAVL+TIAS  +NRT DL GSASTSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359

Query: 361 FTEAVIKRL 369
           FT+AVI+RL
Sbjct: 360 FTDAVIERL 368

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/371 (79%), Positives = 325/371 (87%), Gaps = 2/371 (0%)

Query: 1   MLRSQVLRQLPRRFLSS--KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI 58
           MLRSQ+ R+   R L+S   KQPSIG++TGKP+P TGKYTVSFIEGDGVGPEISKSVKDI
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 59  FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTL 118
           FAAA+VP+ WESC VTPL +NG+TTIP+ A +SIN+NL+ALKGPLATPIGKGHRS+NLTL
Sbjct: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120

Query: 119 RKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRD 178
           RKTFGLFANVRPAKSVEGFKTTYE+VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLITR+
Sbjct: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180

Query: 179 ASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDN 238
           ASERVIRYA+EYARAVGRPK++VVHKSTIQRLADGLFV VAKEL+ E+PDIQLQ +L+DN
Sbjct: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240

Query: 239 TVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGS 298
           TVLNVVSNP  Y+D V VCPNLYGDI                   NIGHKVSIFEAVHGS
Sbjct: 241 TVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGS 300

Query: 299 APDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSAST 358
           APDIAGQNKANPTALLLSSVMMLNHMGL+E A  IEKAVL+TIA+GPE+RT DLAGSAST
Sbjct: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360

Query: 359 SSFTEAVIKRL 369
           SSFTEAVI RL
Sbjct: 361 SSFTEAVISRL 371

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/369 (79%), Positives = 322/369 (87%), Gaps = 1/369 (0%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           ML  +  R   RRFL++  QPSIGRFTGKPNPSTGK+TVSFIEGDG+GPEIS SVK IF 
Sbjct: 1   MLGIRSFRLNARRFLATA-QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQ 59

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VPVEWE+CDVTP+F+NGLTTIP PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TF LFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEH+VSPGVVQSIKLITRDAS
Sbjct: 120 TFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDAS 179

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYA+EYARA+GRP+++VVHKSTIQRLADGLFV+VAKEL++EYPDIQL+ +L+DNT 
Sbjct: 180 ERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTC 239

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVVSNP +Y D VSVCPNLYGDI                  ANIGHKVSIFEAVHGSAP
Sbjct: 240 LNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQNKANPTALLLSSVMMLNHMG+ E AD IEKAVL TIA G E RT DL GSAST+S
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTS 359

Query: 361 FTEAVIKRL 369
           FT+A+IK+L
Sbjct: 360 FTDAIIKKL 368

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/369 (78%), Positives = 324/369 (87%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           M RS +LR   RR LS K QPSIG++TGKPNPSTGKYTVSFIEGDG+GPEIS SVK IF+
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP+EWE+CDVTPLFI+GLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 114 AAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 173

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPA+SV+GFKTTY NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLITR+AS
Sbjct: 174 TFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREAS 233

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEY RA+GRP+++VVHKSTIQRL+DGLFV+VAKELS EYPDIQ + +L+DNTV
Sbjct: 234 ERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTV 293

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L VVSNP +Y D VSVCPNLYGDI                   NIG+++SIFEAVHGSAP
Sbjct: 294 LKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAP 353

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAG+N ANPTALLLSSVMMLNHMGL + AD IE AVLSTIASGPE+RT DLAG+A+TS+
Sbjct: 354 DIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTST 413

Query: 361 FTEAVIKRL 369
           FT+AVIK+L
Sbjct: 414 FTDAVIKKL 422

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/369 (80%), Positives = 323/369 (87%), Gaps = 2/369 (0%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLR Q L Q  RR+L+S +QPSIGR+ GKPN + GKYTVSFIEGDGVGPEIS+SVKDIF+
Sbjct: 1   MLR-QKLFQGSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VPVEWE CDVTPL +NGLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EG+KTTY +VDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITR+AS
Sbjct: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEYAR VGRPKV+VVHKSTIQRLADGLFV+VA+EL  EYPDI+LQ +LLDNTV
Sbjct: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVV+ P AY D V+VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 239 LNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAP 298

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQN+ANPTALLLSSVMMLNHMGL+E A  IEKAVLSTIAS  ENRTADLAG+ASTSS
Sbjct: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358

Query: 361 FTEAVIKRL 369
           FT AVI+RL
Sbjct: 359 FTNAVIERL 367

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/373 (77%), Positives = 324/373 (86%), Gaps = 4/373 (1%)

Query: 1   MLRSQVLRQ--LPRRFLSS--KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVK 56
           MLR+ +LR     RRFL++  K QPSIGRFTGKPNP+TGK+ VSFIEGDG+GPEIS+SVK
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 57  DIFAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNL 116
           DIF AAEVP+ WE CDVTP+F+NGLTTIP PAV SINKNLIALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120

Query: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 176
           TLRKTF LFANVRPAKS+EGFKTTY +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 177 RDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLL 236
           RDASERVIRYAFEYA+A+GRP+V+VVHKSTIQRLADGLFV+VAKELS EYP+I+L+ +L+
Sbjct: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240

Query: 237 DNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVH 296
           DNTVLNVVSNP  Y D VSVCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVH 300

Query: 297 GSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSA 356
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL ++A  IE+AVL+TIAS  +NRT DL GSA
Sbjct: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360

Query: 357 STSSFTEAVIKRL 369
           +TSSFT+AVIK L
Sbjct: 361 TTSSFTDAVIKNL 373

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/369 (76%), Positives = 318/369 (86%), Gaps = 1/369 (0%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLR+ + R    R +++  QP+IGRFTGKPNP TGKYTV FIEGDGVGPEISKSVKDIFA
Sbjct: 1   MLRNTIYRGSFARMMTTG-QPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFA 59

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP+EWE CDV P+F+NGLTTIP  AV SINK+L+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TF LFANVRPA+SV  +KTTY+NVDLVLIRENTEGEYSGIEHV+SPGV+QSIKLIT+DAS
Sbjct: 120 TFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDAS 179

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIRYAFEY RA+GRP+++VVHKSTIQR+ADGLFV+VAKEL+SEYPDI+LQ +L+DNT+
Sbjct: 180 ERVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDNTI 239

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVV++P +Y D VSVCPNLYGDI                  ANIG KVSIFEAVHGSAP
Sbjct: 240 LNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGL E A  IE A+LSTIASG ENRT DLAG+A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSS 359

Query: 361 FTEAVIKRL 369
           FTEAVI +L
Sbjct: 360 FTEAVINKL 368

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/369 (73%), Positives = 314/369 (85%), Gaps = 1/369 (0%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           M +SQV R+   R  SSK QPSIG+FTGKP+P TG Y VSFIEGDG+GPEISKSVKDIFA
Sbjct: 1   MFKSQVCRRAVARMFSSK-QPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFA 59

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VPV++ES  V P+ +NG+T+IP+ A  SIN NL+ALKGPLATP+GKGHRS+NLTLRK
Sbjct: 60  AAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TFGLFAN+RPAKSVEGFKT Y+NV+LVLIRENTEGEY+GIEH + PGVVQSIKLITR+AS
Sbjct: 120 TFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREAS 179

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERVIR+A+EYARA  RP+++VVHKSTIQRL+DGLFVDVAKEL SE+PDI+L+ +L+DN V
Sbjct: 180 ERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDNAV 239

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LN V++P  Y+D VSVCPNLYGDI                   NIGHKVSIFEAVHGSAP
Sbjct: 240 LNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAG++KANPTALLLSSVMML+HMGL+E A  IEKAVL+TIA+GPE+RT DL GSASTSS
Sbjct: 300 DIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSS 359

Query: 361 FTEAVIKRL 369
           FTEAVIK+L
Sbjct: 360 FTEAVIKKL 368

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/369 (72%), Positives = 316/369 (85%), Gaps = 1/369 (0%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           M  S++  +   RFLS+  QPSIGRFTGKP+P+TGK+TV FIEGDGVGPEIS+SVK IF+
Sbjct: 1   MFNSRLQLRTVSRFLSTG-QPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFS 59

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP+EW  CDV P+F+NG TTIP+PAV+ INK+LIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
           TF LFANVRPA+S+  +K+TYENVDLVLIRENTEGEYSGIEHV++PGV+QSIKLITR+A+
Sbjct: 120 TFNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREAT 179

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240
           ERV+RYAFEY +A+GRP+++V+HKSTIQR+ADGLFV VA+EL+SEYPDI+L+ +++D ++
Sbjct: 180 ERVVRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSI 239

Query: 241 LNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVVS P  Y+D VSVCPNLYGDI                  ANIG KVSIFEAVHGSAP
Sbjct: 240 LNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360
           DIAGQNKANPTALLLSSVMML HMGL E A+ IE AVL+TIASG ENRTADL+G+ASTSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSS 359

Query: 361 FTEAVIKRL 369
           FTE VI+RL
Sbjct: 360 FTEEVIQRL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/373 (71%), Positives = 315/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRSQVLRQLPRRFLSS----KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVK 56
           MLR+   +Q  RR  S+    +    +G++ G PNPSTG++TV FIEGDGVGPEISKSVK
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 57  DIFAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNL 116
           DIF AA+VPV+WE CDV+PL INGLTTIP+PAV  INK+ IALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120

Query: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 176
           TLRKTFGLFANVRPA+S+ G++TTY+NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 177 RDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLL 236
           RDASERVIRYA+EYARA+GRP+++VVHKSTIQ+LADGLFV++AKEL+ E+PDI+L+ +L+
Sbjct: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240

Query: 237 DNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVH 296
           DNTVLNVV +P +Y D V+VCPNLYGDI                  ANIG++VSIFEAVH
Sbjct: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVH 300

Query: 297 GSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSA 356
           GSAPDIAGQNKANPTALLLSS MMLN+MGL   ++ IE A+L+TIASG ENRT DLAG+A
Sbjct: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360

Query: 357 STSSFTEAVIKRL 369
           +TSSFTE+VIK L
Sbjct: 361 TTSSFTESVIKNL 373

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/378 (73%), Positives = 313/378 (82%), Gaps = 9/378 (2%)

Query: 1   MLRSQVLRQ----LP-RRFLSSK--KQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISK 53
           MLR  +L +    +P +RFLS +  +QPSIGRFTGKP+ +TGKYTVSFIEGDG+GPEIS+
Sbjct: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60

Query: 54  SVKDIFAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRS 113
           SVKDIF AA VP+ WE+CDV+P+ ++GLTTIP  AV SINKNL+ LKGPLATPIGKGHRS
Sbjct: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120

Query: 114 LNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIK 173
           LNLTLRKTF LFANVRPAKSV GFKTTY+NVDLVLIRENTEGEYSGIEHVV+PGVVQSIK
Sbjct: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180

Query: 174 LITRDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSE--YPDIQL 231
           LITRDASERVIRYAFEYA+A+GRPKV+VVHKSTIQRL+DGLFV+VAKEL  E  + +I+L
Sbjct: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240

Query: 232 QLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSI 291
             +L+DNTVLNVV NP  Y+D V VCPNLYGDI                  ANIG K+SI
Sbjct: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISI 300

Query: 292 FEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTAD 351
           FEAVHGSAPDIAGQNKANPTALLLSSVMML+HMGL E  D IE AVL TIA+  +NRT D
Sbjct: 301 FEAVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGD 360

Query: 352 LAGSASTSSFTEAVIKRL 369
           L G+A+T+SFTEAVI  L
Sbjct: 361 LGGTATTTSFTEAVIDNL 378

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/354 (76%), Positives = 301/354 (85%), Gaps = 1/354 (0%)

Query: 16  SSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTP 75
           S   QP+IGRFTGK N S+G YTV FIEGDGVGPEISKSVKDIF+AA VP++W+ CDV P
Sbjct: 24  SISNQPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEISKSVKDIFSAANVPIQWQPCDVGP 82

Query: 76  LFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSVE 135
           +F+NGLTTIP+PAV +I ++L+ALKGPLATP+GKGHRSLNLTLRKTF LFANVRPAKSV 
Sbjct: 83  IFVNGLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLNLTLRKTFDLFANVRPAKSVP 142

Query: 136 GFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVG 195
            +K+TYENVDLVLIRENTEGEYSGIEH+V+PGVVQSIKLITR+ASE+VIRYA+EYA AVG
Sbjct: 143 NYKSTYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAVG 202

Query: 196 RPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVS 255
           RP+++VVHKSTIQRL DGLFV +A EL SEYP I+L+ Q+LDNTVLNVVSNP  Y D VS
Sbjct: 203 RPRLIVVHKSTIQRLGDGLFVQIANELQSEYPSIKLETQILDNTVLNVVSNPTLYKDAVS 262

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 315
           VCPNLYGDI                  ANIG KVSIFEAVHGSAPDIAGQNKANPTALLL
Sbjct: 263 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLL 322

Query: 316 SSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           SSVMMLNHMGL E A  IE AVLSTIASGPE+RT DL GSA+TSSFTE VIK+L
Sbjct: 323 SSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/358 (68%), Positives = 290/358 (81%), Gaps = 1/358 (0%)

Query: 12  RRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESC 71
           R F+++  + SIG F GKPNP TG YTV FIEGDGVGPEISKSV+ IF AA+VP++W +C
Sbjct: 20  RYFMTAADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNC 79

Query: 72  DVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA 131
           D+ PL ING TTIPQ AVD IN +LIALKGPLATP+G+GHRS+NLTLRKTFGLFANVRPA
Sbjct: 80  DIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPA 139

Query: 132 KSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA 191
           KS+    +TYENVDL++IRENTEGEYSGIEH + PGVVQSIKLITR ASE+VI+YAFEY 
Sbjct: 140 KSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYT 199

Query: 192 RAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYA 251
           R++GR  ++VVHK+TIQR  DGLFV  A+E++ +YPD+ L+L+L+DNTVLN + NP  YA
Sbjct: 200 RSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYA 259

Query: 252 DTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPT 311
           D+VSVCPNLYGDI                  ANIG  V ++EAVHGSAPDIAGQ+KANPT
Sbjct: 260 DSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV-LYEAVHGSAPDIAGQDKANPT 318

Query: 312 ALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           ALLLSSVMMLNHMGL + AD IE AVL+TI SG E RTADL GSA+T+SFT+AVI+ L
Sbjct: 319 ALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  267 bits (682), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 155/372 (41%), Positives = 222/372 (59%), Gaps = 16/372 (4%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLR+  ++   RRF  +  Q         P    G+YTV+ I GDGVG E++ SV +IF 
Sbjct: 1   MLRNTFVQISKRRFALASGQLL-------PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFE 53

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGK-GHRSLNLTLR 119
           A  VP++WES +++ L  N      Q AV+S+ +N + LKG  +TP  + GH SLN+  R
Sbjct: 54  AENVPIDWESVELSGLEEN--MEGVQKAVESLKRNKVGLKGIWSTPADQTGHGSLNVAFR 111

Query: 120 KTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDA 179
           K   +FANV   KS  G KT  ++VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAK 171

Query: 180 SERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSS-EYPDIQLQLQLLDN 238
           SER+ R+AF++A    R  V  VHK+ I +L DGLF +   E+ + EYP+++++  ++DN
Sbjct: 172 SERIARFAFDFALKNNRRSVCAVHKANIMKLGDGLFRNTVNEIGAKEYPELEVKSIIVDN 231

Query: 239 TVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHG 297
             +  V+ P  +   V V PNLYG I                  AN G + ++FE     
Sbjct: 232 ASMQAVAKPHQF--DVLVTPNLYGSI-LGNVGAALIGSPGLVPGANFGREYAVFEPGSRH 288

Query: 298 SAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSAS 357
              DI GQ+ ANPTA++LSS +ML H+GL + AD I KA    IA G ++ T D+ G AS
Sbjct: 289 VGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEG-KHTTKDIGGHAS 347

Query: 358 TSSFTEAVIKRL 369
           T+ FT+A++ +L
Sbjct: 348 TTQFTKAIVDKL 359

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  267 bits (682), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 212/356 (59%), Gaps = 9/356 (2%)

Query: 17  SKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPL 76
           +K+  + GR    P    G+YTV+ I GDG+G E++ SV  IF A  VPV+WES +++ L
Sbjct: 10  TKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVPVDWESVELSAL 69

Query: 77  FINGLTTIPQPAVDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVE 135
             N      Q AV+S+ +N + LKG   TP  + GH SLN+  RK   +FANV   KS  
Sbjct: 70  EENHEGV--QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKSFP 127

Query: 136 GFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVG 195
           G KT  ++VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A    
Sbjct: 128 GVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFALKNN 187

Query: 196 RPKVMVVHKSTIQRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVVSNPGAYADTV 254
           R  V  VHK+ I +L DGLF +   E+ + EYP++ +   ++DN  +  V+ P  +   V
Sbjct: 188 RKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDNASMQAVAKPHQF--DV 245

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTAL 313
            V PNLYG I                  AN G + ++FE        DI GQ+ ANPTA+
Sbjct: 246 LVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAM 304

Query: 314 LLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           +LSS +ML H+GL E AD I +A   TIA G    T D+ G+A+T+ FT AVI +L
Sbjct: 305 ILSSTLMLRHLGLNEYADRISRATYETIAEGKRT-TKDIGGTATTTEFTNAVIDKL 359

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  266 bits (681), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 209/343 (60%), Gaps = 10/343 (2%)

Query: 30  PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLFINGLTTIPQPAV 89
           P    G+YTV+ I GDGVG E++ SV  IF    +P++WE+ D++ L     T   Q AV
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDISGL---ENTENVQRAV 79

Query: 90  DSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVL 148
           +S+ +N + LKG   TP  + GH SLN+ LRK   +FANV   KS+ G KT   N+D+V+
Sbjct: 80  ESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVI 139

Query: 149 IRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKSTIQ 208
           IRENTEGEYSG+EH   PGVV+S+K++TR  SER+ R+AF++A    R  V  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKANIM 199

Query: 209 RLADGLFVDVAKEL-SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXX 267
           +L DGLF +   E+ ++EYP++ ++  ++DN  +  V+ P  +   V V PNLYG I   
Sbjct: 200 KLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQF--DVLVTPNLYGSI-LG 256

Query: 268 XXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 326
                          AN G + ++FE        DI GQN ANPTA++LSS +ML H+GL
Sbjct: 257 NIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGL 316

Query: 327 YEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
              AD I KA    I+ G ++ T D+ GSASTS FT AVI++L
Sbjct: 317 NAYADRISKATYDVISEG-KSTTRDIGGSASTSEFTNAVIEKL 358

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  264 bits (675), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 153/366 (41%), Positives = 219/366 (59%), Gaps = 16/366 (4%)

Query: 8   RQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVE 67
           R + +R L++  Q         P    G++TV+ I GDGVG EI+ SVK IF A ++PV+
Sbjct: 4   RTIAKRTLATAAQAE----RALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAEKIPVD 59

Query: 68  WESCDVTPL-FINGLTTIPQPAVDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLF 125
           WE+ ++       G+      AV+S+ +N I LKG   TP  + GH SLN+ LRK   ++
Sbjct: 60  WETVNIKQTDHKEGV----YEAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIY 115

Query: 126 ANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIR 185
           ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R
Sbjct: 116 ANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKIMTRPKTERIAR 175

Query: 186 YAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVV 244
           +AF++A+   R  V  VHK+ I +L DGLF ++  E+   EYPDI +   ++DN  +  V
Sbjct: 176 FAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAV 235

Query: 245 SNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIA 303
           + P  +   V V P++YG I                  AN G   ++FE        DI 
Sbjct: 236 AKPHQF--DVLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIK 292

Query: 304 GQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTE 363
           GQN ANPTA++LSSV+MLNH+GL E A  I KAV  TIA G ++ T D+ GS+ST+ FT 
Sbjct: 293 GQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEG-KHTTKDIGGSSSTTDFTN 351

Query: 364 AVIKRL 369
            +I +L
Sbjct: 352 EIINKL 357

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  264 bits (675), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 209/343 (60%), Gaps = 10/343 (2%)

Query: 30  PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLFINGLTTIPQPAV 89
           P    G++TV+ + GDGVG EI+ SV  IF +  VP++WE+ D++ L     T   + AV
Sbjct: 21  PKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENVPIDWETVDISGL---DHTEGVKAAV 77

Query: 90  DSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVL 148
           DS+ +N I LKG   TP  + GH SLN+  RK   ++ANV   KS+EG KT   NVDLV+
Sbjct: 78  DSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 149 IRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKSTIQ 208
           IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A+   R  V  VHK+ I 
Sbjct: 138 IRENTEGEYSGLEHESVPGVVESLKIITKSKSERIARFAFDFAKRNNRKSVTAVHKANIM 197

Query: 209 RLADGLFVD-VAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXX 267
           +L+DGLF + V+K    EYP+IQ    ++DN  +  V+ P  +   V V P++YG I   
Sbjct: 198 KLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNASMQAVAKPHQF--DVMVTPSMYGTI-VG 254

Query: 268 XXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 326
                           N G   ++FE        DI GQN ANPTA+LLS+ ++L+H+GL
Sbjct: 255 NIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSATLLLDHLGL 314

Query: 327 YEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
            + A+ I+ AV   IA G    T D+ GSAST+ FT+AVI +L
Sbjct: 315 EKSANRIKSAVYDVIAEGKAT-TQDIGGSASTTEFTQAVINKL 356

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  262 bits (670), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 151/345 (43%), Positives = 210/345 (60%), Gaps = 14/345 (4%)

Query: 30  PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLFINGLTTIP--QP 87
           P    G+YTV+ I GDGVG E++ SV  IF +  VP++WE+ +     I+GL      Q 
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVE-----ISGLDNEEGVQK 76

Query: 88  AVDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDL 146
           AVDS+ +N + LKG   TP  + GH SLN+ LRK   +FANV   K+V G  + + NVDL
Sbjct: 77  AVDSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDL 136

Query: 147 VLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  S+R+ R+AF++A    R  V  VHK+ 
Sbjct: 137 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDFALKNNRKSVCAVHKAN 196

Query: 207 IQRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIX 265
           I +L DGLF +   E+ + EYP+I+++  ++DN  +  V+ P  +   V V PNLYG I 
Sbjct: 197 IMKLGDGLFRNCINEIGAKEYPEIEVKNIIVDNASMQAVAKPHQF--DVLVTPNLYGSI- 253

Query: 266 XXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 324
                            AN G + ++FE        DI GQN ANPTA++LSS +ML H+
Sbjct: 254 LGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHL 313

Query: 325 GLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           GL   AD I KA    IA   +N T D+ GSAST+ FT+A+I++L
Sbjct: 314 GLNSYADRISKATYDVIAEA-KNTTKDIGGSASTTDFTQAIIEKL 357

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  262 bits (669), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 150/344 (43%), Positives = 215/344 (62%), Gaps = 11/344 (3%)

Query: 30  PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLFINGLTTIPQPAV 89
           P    G+YTV+ I GDGVG E++ SV  IF A  VPV+W+  D++ +         + AV
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVPVDWDRVDISGV---DRAEDVKSAV 78

Query: 90  DSINKNLIALKGPLAT-PIGK-GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLV 147
           +S+ +N I LKG   T P  + GH SLN+ LRK   ++ANV   KS+ G +    +VDLV
Sbjct: 79  ESLKRNRIGLKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLV 138

Query: 148 LIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKSTI 207
           +IRENTEGE+SG+EH   PGVV+S+K++T+D  ER+ R+AF+YA+   R +V+ VHK+ I
Sbjct: 139 VIRENTEGEFSGLEHESVPGVVESLKIMTQDNIERIARFAFDYAKKNDRKQVVAVHKANI 198

Query: 208 QRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXX 266
            ++ DGLF ++ +E+   EYP++Q+   ++DN  +  V+NP  +   V V P++YG I  
Sbjct: 199 MKMGDGLFKNLVQEVGEKEYPELQVGNIIVDNASMQTVANPHQF--DVLVTPSMYGTI-L 255

Query: 267 XXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMG 325
                           AN G  V++FE        DI GQN ANPTA++LSSV++LNH+G
Sbjct: 256 GNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLG 315

Query: 326 LYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           L   AD I KAV + IA G ++ T D+ G+AST+ FTEAVI +L
Sbjct: 316 LNTSADRISKAVHAVIAEG-KSVTRDIGGTASTTEFTEAVINKL 358

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  262 bits (669), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 152/366 (41%), Positives = 219/366 (59%), Gaps = 16/366 (4%)

Query: 8   RQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVE 67
           R + +R L++  Q         P    G++TV+ I GDGVG EI+ SV+ IF A  +PV+
Sbjct: 4   RTIAKRTLATAAQAE----RTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAERIPVD 59

Query: 68  WESCDVTPL-FINGLTTIPQPAVDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLF 125
           WE+ ++       G+      AV+S+ +N I LKG   TP  + GH SLN+ LRK   ++
Sbjct: 60  WETINIKQTDHKEGV----YEAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIY 115

Query: 126 ANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIR 185
           ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R
Sbjct: 116 ANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTKPKTERIAR 175

Query: 186 YAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKEL-SSEYPDIQLQLQLLDNTVLNVV 244
           +AF++A+   R  V  VHK+ I +L DGLF ++  E+  +EYPDI +   ++DN  +  V
Sbjct: 176 FAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQTEYPDIDVSSIIVDNASMQAV 235

Query: 245 SNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIA 303
           + P  +   V V P++YG I                  AN G   ++FE        DI 
Sbjct: 236 AKPHQF--DVLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIK 292

Query: 304 GQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTE 363
           GQN ANPTA++LSSV+MLNH+GL E A  I KAV  TIA G ++ T D+ GS+ST+ FT 
Sbjct: 293 GQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTN 351

Query: 364 AVIKRL 369
            VI +L
Sbjct: 352 EVINKL 357

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  261 bits (667), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 151/345 (43%), Positives = 210/345 (60%), Gaps = 14/345 (4%)

Query: 30  PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLFINGLTTIP--QP 87
           P    G+YTV+ I GDGVG E++ SV  IF A  VP++WE+ ++T     G+ +    Q 
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENVPIDWETINIT-----GVDSEEGVQK 77

Query: 88  AVDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDL 146
           AV+S+ +N I LKG   TP  + GH SLN+  RK   +FANV   K+V G KT   N+DL
Sbjct: 78  AVESLKRNKIGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDL 137

Query: 147 VLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A    R  V  VHK+ 
Sbjct: 138 VVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFALKNNRKSVCAVHKAN 197

Query: 207 IQRLADGLFVDVAKEL-SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIX 265
           I +L DGLF +   E+ +SEYP+I ++  ++DN  +  V+ P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNTVNEVGASEYPEIDVKNIIVDNASMQAVAKPHQF--DVLVTPNLYGSI- 254

Query: 266 XXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 324
                            AN G + ++FE        DI G++ ANPTA++LSS +ML H+
Sbjct: 255 LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHL 314

Query: 325 GLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           GL   AD I KA    IA G ++ T D+ GS+ST+ FT++VI +L
Sbjct: 315 GLNGYADRISKATYDVIAEG-KHTTKDIGGSSSTTEFTKSVIDKL 358

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  261 bits (666), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 155/367 (42%), Positives = 216/367 (58%), Gaps = 15/367 (4%)

Query: 6   VLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVP 65
           + R + RR ++S  +  +      P    G+YTV+ I GDGVG EI+ SV  IF A  +P
Sbjct: 1   MFRTVQRRGMASMAKELV-----LPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIP 55

Query: 66  VEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIG-KGHRSLNLTLRKTFGL 124
           V+WE  D++    + +  + Q AV+S+ +N I LKG   T      H S N+ LRK   +
Sbjct: 56  VDWERVDISTS--DNIQDVSQ-AVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDM 112

Query: 125 FANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVI 184
           FA+V   KSV G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ 
Sbjct: 113 FAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIA 172

Query: 185 RYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKEL-SSEYPDIQLQLQLLDNTVLNV 243
           R+AF++A+   R  V  VHK+ I ++ DGLF +   E+ ++EYPDIQ    ++DN  +  
Sbjct: 173 RFAFDFAKKYNRKSVCAVHKANIMKMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASMQA 232

Query: 244 VSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDI 302
           V+ P  +   V V P++YG I                  A+ G + ++FE        DI
Sbjct: 233 VAKPHQF--DVMVTPSMYGTI-IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDI 289

Query: 303 AGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFT 362
            G+N ANPTA++LSS +ML H+GL E A  I KA    I+ G +  T D+ GSAST+ FT
Sbjct: 290 KGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLG-QVTTKDIGGSASTTEFT 348

Query: 363 EAVIKRL 369
           EA+IKRL
Sbjct: 349 EAIIKRL 355

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  259 bits (663), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 150/366 (40%), Positives = 217/366 (59%), Gaps = 16/366 (4%)

Query: 8   RQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVE 67
           R + +R L++  Q         P    G++TV+ I GDGVG EI+ SV+ IF A  +P++
Sbjct: 4   RTIAKRTLATAAQAE----RTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPID 59

Query: 68  WESCDVTPL-FINGLTTIPQPAVDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLF 125
           WE+ ++       G+      AV+S+ +N I LKG   TP  + GH SLN+ LRK   ++
Sbjct: 60  WETINIKQTDHKEGV----YEAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIY 115

Query: 126 ANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIR 185
           ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R
Sbjct: 116 ANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIAR 175

Query: 186 YAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVV 244
           +AF++A+   R  V  VHK+ I +L DGLF ++  E+   EYPDI +   ++DN  +  V
Sbjct: 176 FAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAV 235

Query: 245 SNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIA 303
           + P  +   V V P++YG I                  AN G   ++FE        DI 
Sbjct: 236 AKPHQF--DVLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIK 292

Query: 304 GQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTE 363
           GQN ANPTA++LSS +MLNH+GL E A  I KAV  TIA G ++ T D+ GS+ST+ FT 
Sbjct: 293 GQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTN 351

Query: 364 AVIKRL 369
            +I +L
Sbjct: 352 EIINKL 357

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  258 bits (660), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 207/345 (60%), Gaps = 14/345 (4%)

Query: 30  PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLFINGLTTIP--QP 87
           P    G+YTV+ I GDGVG E++ SV  IF +  +P++WE+ +     I+GL      Q 
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIPIDWETVE-----ISGLDNQEGVQK 77

Query: 88  AVDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDL 146
           AV+S+ +N + LKG   TP  + GH SLN+ LRK   +FANV   KSV G  + + NVD+
Sbjct: 78  AVESLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDM 137

Query: 147 VLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A    R  V  VHK+ 
Sbjct: 138 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIGRFAFDFAVKNNRKSVCAVHKAN 197

Query: 207 IQRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIX 265
           I +L DGLF +   E+ + EYP+I ++  ++DN  +  V+ P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNCINEVGAKEYPEIDVKNIIVDNASMQAVAKPHQF--DVLVTPNLYGSI- 254

Query: 266 XXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 324
                            AN G + ++FE        DI GQN ANPTA++LSS +ML H+
Sbjct: 255 LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHL 314

Query: 325 GLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           GL   AD I KA    IA   +  T D+ GSAST+ FTEA+I +L
Sbjct: 315 GLNAYADRISKATYDVIAEA-KTTTQDIGGSASTTEFTEAIISKL 358

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  254 bits (649), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 209/344 (60%), Gaps = 12/344 (3%)

Query: 30  PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPL-FINGLTTIPQPA 88
           P    G+YTV+ I GDGVG E++ SV  IF A  +P++WE  D++ L    G+    + A
Sbjct: 27  PKEYGGRYTVTLIPGDGVGKEVTDSVVSIFNAENLPIDWERVDISGLDHEEGV----EAA 82

Query: 89  VDSINKNLIALKGPLATPIGKG-HRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLV 147
           V+S+ +N I LKG   T  G+  H SLN+ LRK   ++ANV   K++ G KT   +VDLV
Sbjct: 83  VNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 148 LIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKSTI 207
           +IRENTEGEYSG+EH   PGVV+S+K+IT++ SER+ R+AF++A+   R  V  VHK+ I
Sbjct: 143 IIRENTEGEYSGLEHESVPGVVESLKIITKEKSERIARFAFDFAKRFDRKLVTAVHKANI 202

Query: 208 QRLADGLFVDVAKELS-SEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXX 266
            +L DGLF +    +  +EYPDI++   ++DN  +  V+ P  +   V V P++YG I  
Sbjct: 203 MKLGDGLFRNSVTSIGETEYPDIKVSSIIVDNASMQSVAKPHQF--DVLVTPSMYGTI-L 259

Query: 267 XXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMG 325
                           AN G + ++FE        DI GQN ANPTA++LSS ++L H+G
Sbjct: 260 GNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLKHLG 319

Query: 326 LYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           L  +A  IE AV  TIA G +  T D+ GSAST+ FT  +IK+L
Sbjct: 320 LNNEAKKIEDAVYKTIAEG-KVTTRDIGGSASTTEFTNEIIKKL 362

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  248 bits (634), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 153/376 (40%), Positives = 219/376 (58%), Gaps = 25/376 (6%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLRS V +++     +++K          P    G++ V+ I GDGVG E++ SV  IF 
Sbjct: 1   MLRSAVGKRMFASVAAAEKVL--------PKKYGGRFVVTLIPGDGVGKEVTDSVVSIFE 52

Query: 61  AAEVPVEWESCDVTPL-FINGLTTIPQPAVDSINKNLIALKG----PLATPIGKGHRSLN 115
           A  +P++W+  D++ L    G+    Q AVDS+ +N I LKG      A   GKG  SLN
Sbjct: 53  AENLPIDWDRVDISGLDHEEGV----QAAVDSLKRNKIGLKGIWHTSAADQAGKG--SLN 106

Query: 116 LTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLI 175
           + LRK   ++ANV   KSV G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K++
Sbjct: 107 VALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIM 166

Query: 176 TRDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELS-SEYPDIQLQLQ 234
           T D +ER+ R+AF++A+   R  V  VHK+ I +L DGLF +V   +   EYPD+++   
Sbjct: 167 TEDKTERIARFAFDFAKKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGEQEYPDVKVGSI 226

Query: 235 LLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE- 293
           ++DN  +  V+ P  +   V V P++YG I                  AN G + ++FE 
Sbjct: 227 IVDNASMQTVAKPHQF--DVLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGREYAVFEP 283

Query: 294 AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLA 353
                  DI  +N ANPTA++LS+ +ML+H+GL   A  I  AV   IA G ++ T D+ 
Sbjct: 284 GSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEG-KSTTPDIG 342

Query: 354 GSASTSSFTEAVIKRL 369
           GSAST+ FT+AVI++L
Sbjct: 343 GSASTTEFTQAVIEKL 358

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  247 bits (631), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 149/355 (41%), Positives = 211/355 (59%), Gaps = 14/355 (3%)

Query: 22  SIGRFTGK----PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLF 77
           SI  FT      P    G+YTV+ I GDG+G E++ SV  IFA+  +P++WE  DV P  
Sbjct: 10  SIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQGLPIDWERIDV-PGM 68

Query: 78  INGLTTIPQPAVDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVEG 136
            N      + AV+S+ +N I LKG   T   + G+ SLN+ LRK   +FANV   KS++G
Sbjct: 69  SN--ENEVKKAVESLKRNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKG 126

Query: 137 FKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGR 196
            KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  +ER+ R+AF++A    R
Sbjct: 127 VKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKPKTERIARFAFDFALENNR 186

Query: 197 PKVMVVHKSTIQRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVVSNPGAYADTVS 255
             V  VHK+ I +L+DGLF +   E+   EYPDI++   ++DN  +  V+ P  +   V 
Sbjct: 187 STVTAVHKANIMKLSDGLFKNTVAEVGEKEYPDIKVNTIIVDNASMQAVAKPHQF--DVM 244

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTALL 314
           V P++YG I                  AN G + ++FE        DI  QN ANPTA++
Sbjct: 245 VTPSMYGTI-LGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMI 303

Query: 315 LSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           LS+ +MLN +GL E++  I  AV + I  G +  T D+ G+AST+ FT+AVI +L
Sbjct: 304 LSATLMLNQLGLREESKRISNAVYAVIEEG-KTTTKDIGGNASTTEFTDAVIDKL 357

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  244 bits (624), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 148/363 (40%), Positives = 208/363 (57%), Gaps = 14/363 (3%)

Query: 12  RRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESC 71
           RR +S +   ++   T  PN   G+YTV+ + GDGVG E + SV  +F A  +P++WE  
Sbjct: 3   RRLVSKRSLATLPE-TLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIPIDWEIV 61

Query: 72  DVTPL-FINGLTTIPQPAVDSINKNLIALKGPLATPIG--KGHRSLNLTLRKTFGLFANV 128
           +++ L    G+      AV S+ +N I LKG   T      GH SLN+  RK   ++ANV
Sbjct: 62  NISGLDHKEGVAA----AVQSLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANV 117

Query: 129 RPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAF 188
              KS++G KT   +VDLV+IRENTEGE+SG+EH    GVV+S+K+ T   +ER+ R+AF
Sbjct: 118 AVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTERIARFAF 177

Query: 189 EYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVVSNP 247
            YA+  GR  V  VHK+ I +L DGLF +    +   EYPDI+    ++DN  +  V+ P
Sbjct: 178 NYAQKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASMQAVAKP 237

Query: 248 GAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQN 306
             +   V V P++YG I                  AN G + ++FE        DI GQN
Sbjct: 238 HQF--DVLVTPSMYGTI-IGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQN 294

Query: 307 KANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVI 366
            ANPTA+LLSS +MLNH+GL +    I  AV   IA G + RT D+ G A+T+ FT+AVI
Sbjct: 295 IANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEG-DVRTKDIGGDATTTEFTQAVI 353

Query: 367 KRL 369
           ++L
Sbjct: 354 EKL 356

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  244 bits (623), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 200/343 (58%), Gaps = 11/343 (3%)

Query: 30  PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPL-FINGLTTIPQPA 88
           P    G+ TV+ + GDGVG EI+ SV  IF A  VP++WE+ D++ L   +G+      A
Sbjct: 22  PKKYGGRMTVTLLPGDGVGKEITDSVVSIFQAENVPIDWETVDISQLDHEDGV----NAA 77

Query: 89  VDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLV 147
           V+S+ +N I LKG   T   + GH SLN+  RK   ++ANV   KS+ G KT   NVDLV
Sbjct: 78  VESLKRNKIGLKGIWHTSADQVGHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLV 137

Query: 148 LIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKSTI 207
           +IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ ++AF++A    R  V  VHK+ I
Sbjct: 138 IIRENTEGEYSGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMRHDRKMVTAVHKANI 197

Query: 208 QRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXX 267
            +L+DGLF +    +   YP I+    ++DN  +  V+ P  +   V V P++YG I   
Sbjct: 198 MKLSDGLFRNTVARVGEAYPQIKNDSIIVDNASMQAVAKPHQF--DVMVTPSMYGTI-LG 254

Query: 268 XXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 326
                           N G + ++FE        DI GQN ANPTA++LSS ++L H+GL
Sbjct: 255 NIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLQHLGL 314

Query: 327 YEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
            + A  I KAV   I  G    T D+ G+AST+ FT+AVI +L
Sbjct: 315 NDTASRISKAVYDVIKEGNAT-TKDIGGNASTTEFTKAVIDKL 356

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  243 bits (619), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 147/362 (40%), Positives = 206/362 (56%), Gaps = 12/362 (3%)

Query: 12  RRFLSSKKQPSIG-RFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWES 70
           R  +S +   SI  R    P    G+YTV+ + GDGVG EI+ SV  IF A  +P++WE 
Sbjct: 3   RNLISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDWER 62

Query: 71  CDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVR 129
            +++ L    + T    AV+S+ +N I LKG   T     GH S N+ LRK   ++ANV 
Sbjct: 63  VELSGLEQEDVHT----AVESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVA 118

Query: 130 PAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFE 189
             KS +G  T   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T   +ER+ R+AF+
Sbjct: 119 IFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQKTERIARFAFD 178

Query: 190 YARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVVSNPG 248
           YA    R  V  VHK+ I +L DGLF ++  E+ + EYP++ +   ++DN  +  V+ P 
Sbjct: 179 YAMKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNASMQAVAKPH 238

Query: 249 AYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNK 307
            +   V V P++YG I                  AN G   ++FE        DI  QN 
Sbjct: 239 QF--DVMVAPSMYGTI-LGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNI 295

Query: 308 ANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIK 367
           ANPTA++LS+ +MLNH+G    A  I KAV   IA G +  T D+ GSA+T+ FT AVI 
Sbjct: 296 ANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEG-KTTTRDIGGSATTTEFTNAVIA 354

Query: 368 RL 369
           +L
Sbjct: 355 KL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  231 bits (589), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 145/371 (39%), Positives = 211/371 (56%), Gaps = 27/371 (7%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLR+ +LR    R +S          T  P    G++ ++ I G+G+G E++ SV+ IF 
Sbjct: 1   MLRNTLLR----RSIS----------TISPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQ 46

Query: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120
           A  +P++WE  ++     +G+ T    AVDSI +N IALKG  ++    G  SLN+ LRK
Sbjct: 47  AENLPIDWEIVNIES-HRDGIKT----AVDSIKRNKIALKGIWSSDPIDG--SLNVALRK 99

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180
              +FANV   KS +   T   NVDLV+IRENTEGE+SG+EH    GVV+S+K++T+  +
Sbjct: 100 QLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDGVVESLKIVTKPKT 159

Query: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKEL-SSEYPDIQLQLQLLDNT 239
           ER+ R+AF++A+   R  V  VHK+ I +L DGLF ++   + ++EYP+I+    ++DN 
Sbjct: 160 ERIARFAFDFAKKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNEYPEIKNSSIIVDNA 219

Query: 240 VLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGS 298
            +  V+ P  +   V V P++YG I                  AN G   ++FE      
Sbjct: 220 SMQAVAKPHQF--DVLVSPSMYGTI-LGNIGAALIGGPGLVPGANFGRDYAVFEPGSRHV 276

Query: 299 APDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSAST 358
             DI GQN ANPTA++LS+  ML H+GL   A+ I  AV   IA G    T D+ G+AST
Sbjct: 277 GLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQG-TTVTKDIGGTAST 335

Query: 359 SSFTEAVIKRL 369
           + FT+AVI  L
Sbjct: 336 TEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  204 bits (518), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 168/286 (58%), Gaps = 11/286 (3%)

Query: 30  PNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPL-FINGLTTIPQPA 88
           P    G++TV+ I GDGVG E++ SVK IF A  +P++WE+ ++       G+      A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQTDHKEGV----NEA 77

Query: 89  VDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLV 147
           V+S+ +N I LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 148 LIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKSTI 207
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 208 QRLADGLFVDVAKELSS-EYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXX 266
            +L DGLF ++  E+   EYPDI +   ++DN  +  V+ P  +   V V P++YG I  
Sbjct: 198 MKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQF--DVLVTPSMYGTI-L 254

Query: 267 XXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGQNKANPT 311
                           AN G   ++FE        DI GQN ANPT
Sbjct: 255 GNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT 300

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  159 bits (402), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 129/396 (32%), Positives = 187/396 (47%), Gaps = 55/396 (13%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI-- 58
           M+R++ + QL RR  +S  +                 T+  I GDG+G E+  + K I  
Sbjct: 1   MMRTRFI-QLSRRAYASNAK---------------NLTIGLIPGDGIGKEVIPAGKKILE 44

Query: 59  ---------FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSI-NKNLIALKGPLATPIG 108
                    F   ++   WE+      F N    +P   +D + N+   AL G + +P  
Sbjct: 45  SLNPKYGLSFKFIDLQAGWET------FQNTGKALPDETIDILKNQCEGALFGAVQSPTT 98

Query: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161
           K  G+ S  + LRK  GLFANVRP KSV+G K     VDLV++RENTE  Y     S I+
Sbjct: 99  KVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYID 156

Query: 162 HVVSPGVVQSIKLITRDASERVIRYAFEYARAV----GRPKVMVVHKSTIQRLADGLFVD 217
                 V  + K IT  A++ +   A + A+      G   + V HKS +   +DGLF +
Sbjct: 157 EATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFRE 216

Query: 218 VAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXX 273
           V +E       +Y  +Q   Q++D+ V  +   P  +   V V PNLYGDI         
Sbjct: 217 VCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF--DVVVAPNLYGDILSDGAAALV 274

Query: 274 XXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSI 333
                    AN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  E A  I
Sbjct: 275 GSLGVVPS-ANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDI 333

Query: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
            KAV + I  G +  T DL G+++T    E V+ +L
Sbjct: 334 HKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  158 bits (399), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 191/390 (48%), Gaps = 42/390 (10%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLR+ V     R+F  S +  S          S    T+  I GDG+G E+  + K +  
Sbjct: 1   MLRTSV-----RQFSVSARNAS----------SLKTLTIGLIPGDGIGKEVIPAGKQVLQ 45

Query: 61  A--AEVPVEWESCDVTP---LFINGLTTIPQPAVDSI-NKNLIALKGPLATPIGK--GHR 112
               +  + +E  D+      F++    +P+  VD + NK   AL G + +P  K  G+ 
Sbjct: 46  NLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYS 105

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVS-----PG 167
           S  + LRK  GLFANVRP K+VEG  T  + +DLV++RENTE  Y  IE   +       
Sbjct: 106 SPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSR 163

Query: 168 VVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL- 222
           + ++ K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF +V KE+ 
Sbjct: 164 IAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVY 223

Query: 223 ---SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXX 279
               S Y  +    Q++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 224 ESNKSLYSGVAYNEQIVDSMVYRLFREPECF--DVIVAPNLYGDILSDGAAALVGSLGLV 281

Query: 280 XXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLS 339
              AN+G  + I E  HGSAPDIAG+  ANP A + S+  ML ++G    A  I KAV +
Sbjct: 282 PS-ANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDA 340

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIKRL 369
            I    + +TADL G ++T    + ++ +L
Sbjct: 341 NIRDN-KIKTADLGGDSTTQQVIDDILGKL 369

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  157 bits (397), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 119/396 (30%), Positives = 189/396 (47%), Gaps = 53/396 (13%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI-- 58
           MLR+ V R   RR +               N +    T+  I GDG+G E+  + K +  
Sbjct: 1   MLRNGVYRACARRTVV--------------NGARSNLTIGLIPGDGIGKEVIPAGKKVLE 46

Query: 59  ---------FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLI-ALKGPLATPIG 108
                    F   ++   W++      F++    +P   V  + +    AL G + +P  
Sbjct: 47  TIGDKYSIDFKFIDLHAGWQT------FLDTGKALPDETVSILKQQCQGALFGAVQSPTT 100

Query: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161
           K  G+ S  + LRK  GL+AN+RP KSV G  T    VD+V++RENTE  Y     + I+
Sbjct: 101 KVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYID 158

Query: 162 HVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVD 217
                 V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF +
Sbjct: 159 EATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFRE 218

Query: 218 VAKELSSE----YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXX 273
           V +++  +    Y ++    Q++D+ V  +   P  +   V V PNLYGDI         
Sbjct: 219 VCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECF--DVVVAPNLYGDILSDGAAALV 276

Query: 274 XXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSI 333
                    AN+G  + I E  HGSAPDI+GQ  +NP A + S+ +ML  +G  E A  I
Sbjct: 277 GSLGVVPS-ANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDI 335

Query: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           + AV   I SG + +T DL G +ST+  T+ ++ +L
Sbjct: 336 QNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  157 bits (396), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 178/359 (49%), Gaps = 39/359 (10%)

Query: 38  TVSFIEGDGVGPEISKSVKDI-----------FAAAEVPVEWESCDVTPLFINGLTTIPQ 86
           T+  I GDG+G E+  + K I           F   ++   WE+      F N    +P 
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79

Query: 87  PAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143
             V+ + ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K+VEG  T    
Sbjct: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137

Query: 144 VDLVLIRENTEGEYSGIEHVVS-PG----VVQSIKLITRDASERVIRYAFEYA----RAV 194
           VD+V++RENTE  Y  IE   + P     V ++ K I+  A+ R+   A + A    ++ 
Sbjct: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197

Query: 195 GRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAY 250
           G   + V HKS +   +DGLF ++ K++      +Y  IQ   Q++D+ V  +   P  +
Sbjct: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257

Query: 251 ADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANP 310
              V V PNLYGDI                  AN+G ++ I E  HGSAPDIAG+  ANP
Sbjct: 258 --DVVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGRGIANP 314

Query: 311 TALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
            A + S+ +ML  +G  E A  I KAV S I    + +T DL G ++T    + ++ ++
Sbjct: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 123/387 (31%), Positives = 188/387 (48%), Gaps = 44/387 (11%)

Query: 10  LPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI----------- 58
           L R   + + Q +IG  + K N      T+  I GDG+G E+  S + +           
Sbjct: 2   LRRSVYNRQFQRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLT 56

Query: 59  FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLI-ALKGPLATPIGK--GHRSLN 115
           F   ++   W++      F++    +P   V ++ +N   AL G + +P  K  G+ S  
Sbjct: 57  FNFIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPI 110

Query: 116 LTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHVVSPGVVQ 170
           + LRK  GL+AN+RP KSV+      + VD+V++RENTE  Y     + I+      V  
Sbjct: 111 VALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVAD 168

Query: 171 SIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL---- 222
           + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF +V KE+    
Sbjct: 169 ATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN 228

Query: 223 SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXX 282
            + Y DIQ   Q++D+ V  +   P  +   V V PNLYGDI                  
Sbjct: 229 KTLYSDIQYNEQIIDSMVYRLFREPECF--DVIVAPNLYGDILSDGAAALVGSLGVVPS- 285

Query: 283 ANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIA 342
           AN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I+ AV S + 
Sbjct: 286 ANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLR 345

Query: 343 SGPENRTADLAGSASTSSFTEAVIKRL 369
              + +T DL G  STS     VI+RL
Sbjct: 346 E-DKIKTPDLGGKNSTSDVVNDVIRRL 371

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  154 bits (390), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 121/396 (30%), Positives = 187/396 (47%), Gaps = 55/396 (13%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI-- 58
           MLRS V  Q  RR  +S  +P                T+  I GDG+G E+  + K +  
Sbjct: 1   MLRSTV-SQFARRSYASAAKP---------------LTIGLIPGDGIGKEVIPAGKLVLE 44

Query: 59  ---------FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLI-ALKGPLATPIG 108
                    F   ++   W++      F++    +P   ++ +  +   AL G + +P  
Sbjct: 45  NLSSKHNLKFNFIDLQAGWQT------FLDTGKALPDETIEILKSDCQGALFGAVQSPTN 98

Query: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161
           K  G+ S  + LRK  GL+ANVRP KSV+G  T    VD++++RENTE  Y     + I+
Sbjct: 99  KVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYID 156

Query: 162 HVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVD 217
                 V ++IK I+  A+  + + A E +    +A G+  + V HKS +   +DGLF +
Sbjct: 157 EKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFRE 216

Query: 218 VAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXX 273
           V K +       Y  I    Q++D+ V  +   P  +   V V PNLYGDI         
Sbjct: 217 VCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECF--DVIVAPNLYGDILSDGAAALV 274

Query: 274 XXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSI 333
                    AN+GH   + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I
Sbjct: 275 GSLGVVPS-ANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDI 333

Query: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
            KAV + I    + +T DL G ++T    + ++ ++
Sbjct: 334 HKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  153 bits (387), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 178/361 (49%), Gaps = 29/361 (8%)

Query: 31  NPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPL------FINGLTTI 84
           N +    T+  I GDG+G E+  + K +  +   P    + D   L      F +    +
Sbjct: 19  NAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLN-PKHGLNFDFIDLQAGFQTFQDTGKAL 77

Query: 85  PQPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTY 141
           P   V  + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KSVEG  +  
Sbjct: 78  PDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEG--SNE 135

Query: 142 ENVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----R 192
             VD++++RENTE  Y  IE           V ++ K I+  A++R+   A + A    +
Sbjct: 136 RPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQ 195

Query: 193 AVGRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPG 248
             G+  + V HKS +   +DGLF +V +E+      +Y  I    Q++D+ V  +   P 
Sbjct: 196 NNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPE 255

Query: 249 AYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKA 308
            +   V V PNLYGDI                  AN+G ++ I E  HGSAPDIAG+  A
Sbjct: 256 CF--DVIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIA 312

Query: 309 NPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKR 368
           NP A + S+ +ML  +G  E A  I KAV + +  G   +TADL G+A+T +  + ++ R
Sbjct: 313 NPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLV-KTADLGGNATTQNVVDDILAR 371

Query: 369 L 369
           L
Sbjct: 372 L 372

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  152 bits (384), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 175/353 (49%), Gaps = 28/353 (7%)

Query: 38  TVSFIEGDGVGPEISKSVKDIFAA----AEVPVEWESCDV-TPLFINGLTTIPQPAVDSI 92
           T+  I GDG+G E+  + + +  A     ++   +E  D     F+     +P   V+++
Sbjct: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81

Query: 93  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KSV G   T + VDLV++
Sbjct: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138

Query: 150 RENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERV----IRYAFEYARAVGRPKVM 200
           RENTE  Y     + ++      V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198

Query: 201 VVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSV 256
           V HKS +    DGLF +V +E+       Y  I+   Q++D+ V  +   P  +   V V
Sbjct: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCF--DVVV 256

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 316
            PNLYGD+                   N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 APNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315

Query: 317 SVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
             +ML  +GL E A  I++AV   +    +  + DL G  +T    + ++ R+
Sbjct: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  152 bits (384), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 179/354 (50%), Gaps = 28/354 (7%)

Query: 38  TVSFIEGDGVGPEISKSVKDIFAA--AEVPVEWESCDVTPLFINGLTT---IPQPAVDSI 92
           T+  I GDG+G E+  + K +     ++  + ++  D+   F   L T   +P   +  +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84

Query: 93  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVEG  TT + VD+V++
Sbjct: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142

Query: 150 RENTEG------EYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKV 199
           RENT        E + I+      V ++ K I+  A+ R+   A + A    +  G+  +
Sbjct: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202

Query: 200 MVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVS 255
            V HKS +   +DGLF ++ K++      +Y  I    Q++D+ V  +   P  +   V 
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCF--DVV 260

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 315
           V PNLYGDI                  AN+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 261 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319

Query: 316 SSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           S+ +ML  +G  E A  I +AV + +    + +T DL G ++T   TE V+ RL
Sbjct: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  152 bits (383), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 119/396 (30%), Positives = 186/396 (46%), Gaps = 55/396 (13%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           M RS V +   RR  S+ K   IG                 I GDG+G E+  + K +  
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIG----------------LIPGDGIGKEVIPAGKQVLE 44

Query: 61  A-----------AEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLI-ALKGPLATPIG 108
           A            ++   WE+      F      +P   V  + +    AL G + +P  
Sbjct: 45  ALGSKHGLQFDFIDLKAGWEA------FQQQGKALPDDTVKVLKEQCQGALFGAVQSPTT 98

Query: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161
           K  G+ S  + LRK  GL+ANVRP KSVE  K    NVD++++RENTE  Y     + ++
Sbjct: 99  KVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVRENTEDLYIKTEKTYVD 156

Query: 162 HVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVD 217
                 V ++IK I+  A+ ++   A + +    ++ G   + V HKS +   +DGLF +
Sbjct: 157 EATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFRE 216

Query: 218 VAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXX 273
           + K++      +Y +++   Q++D+ V  +   P  +   V V PNLYGDI         
Sbjct: 217 ICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECF--DVVVAPNLYGDILSDGAAALV 274

Query: 274 XXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSI 333
                    AN+G ++ I E  HGSAPDIAG+  +NP A + S+ +ML  +G  E A  I
Sbjct: 275 GSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDI 333

Query: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
            KAV + +  G  N T DL G A+T    + ++ ++
Sbjct: 334 YKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  151 bits (382), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 187/387 (48%), Gaps = 37/387 (9%)

Query: 6   VLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAA--AE 63
           +LR    RF +S  +      T   N      T+  I GDG+G E+  + K +     ++
Sbjct: 1   MLRTAASRFATSTCR------TYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSK 54

Query: 64  VPVEWESCDVTPLFINGLTT---IPQPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLT 117
             ++++  D+   F   L T   +P   V  +      AL G + +P  K  G+ S  + 
Sbjct: 55  HGLKFDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVA 114

Query: 118 LRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHV-----VSPGVVQSI 172
           LRK  GLFANVRP KSV G K     VD+V++RENTE  Y  IE           V ++ 
Sbjct: 115 LRKEMGLFANVRPVKSVSGTKD--RPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEAT 172

Query: 173 KLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL----SS 224
           K I+  A+ R+   A + A    +  G+  + V HKS +   +DGLF ++ K++      
Sbjct: 173 KRISEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKD 232

Query: 225 EYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXAN 284
           +Y  I    Q++D+ V  +   P  +   V V PNLYGDI                  AN
Sbjct: 233 KYGSITYNEQIVDSMVYRMFREPQCF--DVIVAPNLYGDILSDGAAALVGSLGVVPS-AN 289

Query: 285 IGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASG 344
           +G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I +AV + +   
Sbjct: 290 VGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMR-- 347

Query: 345 PEN--RTADLAGSASTSSFTEAVIKRL 369
            EN  +T DL G+++T   TE V+ RL
Sbjct: 348 -ENKIKTPDLGGNSTTQQVTEDVLARL 373

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  151 bits (382), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 176/360 (48%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGVGPEISKSVKDIFAA--AEVPVEWESCDVTPLFINGLTT---IP 85
           N +    T+  I GDG+G E+  + K +     ++  + +   D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 86  QPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYE 142
              V  + +    AL G + +P  K  G+ S  + LR+  GLFANVRP KSVEG K   +
Sbjct: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKG--K 135

Query: 143 NVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----RA 193
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQT 195

Query: 194 VGRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGA 249
            G+  + V HKS +   +DGLF ++ KE+      +Y  I+   Q++D+ V  +   P  
Sbjct: 196 RGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 250 YADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKAN 309
           +   V V PNLYGDI                  AN+G ++ I E  HGSAPDIAG+  AN
Sbjct: 256 F--DVIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 310 PTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           P A + S+ +ML  +G  E A  I KAV + +  G   +T DL G AST    + V+ RL
Sbjct: 313 PIATIRSTALMLEFLGHNEAAQDIYKAVDANLREG-SIKTPDLGGKASTQQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 174/360 (48%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGVGPEISKSVKDIFAA--AEVPVEWESCDVTPLFINGLTT---IP 85
           N +    T+  I GDG+G E+  + K +     ++  + +   D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 86  QPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYE 142
              V  + +    AL G + +P  K  G+ S  + LR+  GLFANVRP KSVEG K   +
Sbjct: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--K 135

Query: 143 NVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----RA 193
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQT 195

Query: 194 VGRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGA 249
            G   + V HKS +   +DGLF ++ KE+      +Y  I+   Q++D+ V  +   P  
Sbjct: 196 RGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 250 YADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKAN 309
           +   V V PNLYGDI                  AN+G ++ I E  HGSAPDIAG+  AN
Sbjct: 256 F--DVIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 310 PTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           P A + S+ +ML  +G    A  I KAV + +  G   +T DL G AST    E V+ RL
Sbjct: 313 PIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  149 bits (375), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 174/360 (48%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGVGPEISKSVKDIFA--AAEVPVEWESCDVTPLFINGLTT---IP 85
           N +    T+  I GDG+G E+  + K I     ++  + +   D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 86  QPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYE 142
              +  +      AL G + +P  K  G+ S  + LR+  GL+ANVRP KSVEG K   +
Sbjct: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135

Query: 143 NVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----RA 193
            +D+V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195

Query: 194 VGRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGA 249
            G   + V HKS +   +DGLF ++ K++      +Y  I+   Q++D+ V  +   P  
Sbjct: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 250 YADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKAN 309
           +   V V PNLYGDI                  AN+G  + I E  HGSAPDIAG+  AN
Sbjct: 256 F--DVIVAPNLYGDI-LSDGAAALVGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIAN 312

Query: 310 PTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           P A + S+ +ML  +G  + A  I KAV + +  G    T DL G AST    + V+ RL
Sbjct: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 118/360 (32%), Positives = 173/360 (48%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGVGPEISKSVKDIFAA--AEVPVEWESCDVTPLFINGLTT---IP 85
           N +    T+  I GDG+G E+  + K +     ++  + +   D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 86  QPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYE 142
              V+ + K    AL G + +P  K  G+ S  + LR+  GLFANVRP KSVEG +   +
Sbjct: 78  DETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRN--K 135

Query: 143 NVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----RA 193
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQT 195

Query: 194 VGRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGA 249
            G   + V HKS +    DGLF ++ KE+      +Y  I+   Q++D+ V  +   P  
Sbjct: 196 RGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 250 YADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKAN 309
           +   V V PNLYGDI                  AN+G ++ I E  HGSAPDIAG+  AN
Sbjct: 256 F--DVIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 310 PTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           P A + S+ +ML  +G    A  I KAV + +  G    T DL G AST    + V+ RL
Sbjct: 313 PIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 115/374 (30%), Positives = 181/374 (48%), Gaps = 42/374 (11%)

Query: 24  GRFTGKPNPSTGKYTVSFIEGDGVGPEI----SKSVKDI-------FAAAEVPVEWESCD 72
           G+ + +   ++  +T+  I GDG+G E+     K ++ I       F   ++   W++  
Sbjct: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT-- 64

Query: 73  VTPLFINGLTTIPQPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVR 129
               F++    +P   V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+R
Sbjct: 65  ----FLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR 120

Query: 130 PAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVI 184
           P KSV+G  T    VDLV+ RENTE  Y     + I+      V ++IK I+  A+  + 
Sbjct: 121 PVKSVDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178

Query: 185 RYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL---SSEYPDIQLQLQLLD 237
             A E A    +  G   + V HKS +   +DGLF ++ K +   + ++ ++Q   Q++D
Sbjct: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVD 238

Query: 238 NTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHG 297
           + V  +   P  +   V V PNLYGDI                   N+G  + I E  HG
Sbjct: 239 SMVYRLFKEPQCF--DVIVAPNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHG 295

Query: 298 SAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPEN--RTADLAGS 355
           SAPDI GQ  ANP A + S+ ++L  +GL E A  IEK V   I    EN  +T DL G+
Sbjct: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGN 352

Query: 356 ASTSSFTEAVIKRL 369
           ++       ++ R+
Sbjct: 353 STGEQVANDILSRI 366

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  141 bits (356), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 122/391 (31%), Positives = 189/391 (48%), Gaps = 42/391 (10%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLRS V +    R LS+K    I +            T+  I GDG+G E+  + K +  
Sbjct: 1   MLRSVVTKSATIRHLSTK---GINK----------SLTIGLIPGDGIGKEVIPAGKQVLQ 47

Query: 61  --AAEVPVEWESCDVTPLFINGLTT---IPQPAVDSINKNLIA-LKGPLATPIGK--GHR 112
             ++   + +   D+   F   L T   +P   V  + +     L G + +P  +   + 
Sbjct: 48  NLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPG----V 168
           S  + LRK   L+AN+RP KSV G  +  + VD+V++RENTE  Y  IE          V
Sbjct: 108 SPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQNGMRV 166

Query: 169 VQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL-- 222
            ++ K IT  A+ ++ + A + A    +  G+  + V HKS +   +DGLF ++ K++  
Sbjct: 167 AEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQ 226

Query: 223 --SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXXX 280
               +Y  I    Q++D+ V  +   P  Y D + V PNLYGDI                
Sbjct: 227 ANKDKYAGINYNEQIIDSMVYRMFREP-EYFDVI-VAPNLYGDILSDGAAALVGSLGVVP 284

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLST 340
             AN+G  + + E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I KAV S 
Sbjct: 285 S-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESN 343

Query: 341 IASGPEN--RTADLAGSASTSSFTEAVIKRL 369
           +    EN  +T DL G++ST +  + V+++L
Sbjct: 344 MR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  140 bits (354), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 117/396 (29%), Positives = 184/396 (46%), Gaps = 56/396 (14%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI-- 58
           MLR+    QL RR  +S               +T   T+  I GDG+G E+  + K +  
Sbjct: 1   MLRTS-FNQLARRSYTS---------------ATKSLTIGLIPGDGIGREVIPAGKLVLE 44

Query: 59  ---------FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSI-NKNLIALKGPLATPIG 108
                    F   ++   W++      F++    +P   +D + N+   AL G + +P  
Sbjct: 45  NLSSKHGLKFNFIDLEAGWQT------FLDTGKALPDETIDILKNECQGALFGAVQSPTN 98

Query: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161
           K  G+ S  + LRK  GL+ANVRP KSV    +  + +D+V++RENTE  Y     + I+
Sbjct: 99  KVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPIDMVIVRENTEDLYIKTEKTYID 155

Query: 162 HVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVD 217
                 V ++IK I+  A+  +   A E A    +  G   + V HKS +   +DGLF +
Sbjct: 156 EKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFRE 215

Query: 218 VAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXX 273
           + +++      ++  I    Q++D+ V  +   P  +   V V PNLYGDI         
Sbjct: 216 ICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECF--DVIVAPNLYGDILSDGAAALV 273

Query: 274 XXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSI 333
                    AN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I
Sbjct: 274 GSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDI 332

Query: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
            KAV + +      +T DL G ++T    + V+ R+
Sbjct: 333 HKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  140 bits (354), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 116/390 (29%), Positives = 186/390 (47%), Gaps = 42/390 (10%)

Query: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60
           MLRS + R   RR  +S  +  +               +  I GDG+G E+  + K +  
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMV---------------IGLIPGDGIGKEVIPAGKQVLE 45

Query: 61  --AAEVPVEWESCDVTP---LFINGLTTIPQPAVDSI-NKNLIALKGPLATPIGK--GHR 112
             + +  + ++  D+      F      +P+  V  + N+   AL G + +P  K  G+ 
Sbjct: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYS 105

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHV-----VSPG 167
           S  + LRK  GL+ANVRP KSVEG K     VD+V++RENTE  Y  +E           
Sbjct: 106 SPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTR 163

Query: 168 VVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL- 222
           V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF ++ K++ 
Sbjct: 164 VAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY 223

Query: 223 ---SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y  +    Q++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 224 ESNKDKYGQVAYNEQIVDSMVYRMFREPECF--DVVVAPNLYGDILSDGAAALVGSLGVV 281

Query: 280 XXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLS 339
              AN+G ++ I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I +AV +
Sbjct: 282 PS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDA 340

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIKRL 369
            +    + +T DL G+++T    E ++ +L
Sbjct: 341 NLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  140 bits (354), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 109/359 (30%), Positives = 170/359 (47%), Gaps = 40/359 (11%)

Query: 38  TVSFIEGDGVGPEISKSVKDI-----------FAAAEVPVEWESCDVTPLFINGLTTIPQ 86
           T+  I GDG+G E+  + + +           F   ++   W++      F      +P 
Sbjct: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQT------FQETGKALPD 75

Query: 87  PAVDSI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143
             +D + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV         
Sbjct: 76  ETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LPQERP 132

Query: 144 VDLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA----RAV 194
           VD++++RENTE  Y     + I+      V ++IK I+  A++ +   A E A    +  
Sbjct: 133 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVN 192

Query: 195 GRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAY 250
           G   + V HKS +   +DGLF +V +++      ++  I+   Q++D+ V  +   P  +
Sbjct: 193 GEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECF 252

Query: 251 ADTVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANP 310
              V V PNLYGDI                  AN+G    + E  HGSAPDIAG+  +NP
Sbjct: 253 --DVIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNP 309

Query: 311 TALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
            A + S+ +ML  MG  E A  I KAV + +      +T DL G ++T    E V+ R+
Sbjct: 310 VATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 91.7 bits (226), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 93/349 (26%), Positives = 151/349 (43%), Gaps = 32/349 (9%)

Query: 44  GDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLFINGL------TTIPQPAVDSINKNLI 97
           GD +G E+ +    +  A E  +     D     + G       + +P  A+ +  +   
Sbjct: 12  GDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEADA 71

Query: 98  ALKGPLATPIGKG-----HRSLNLTLRKTFGLFANVRP----AKSVEGFK----TTYENV 144
            L G +  P  +G      + L L LR+  G++AN+RP    A S+            + 
Sbjct: 72  VLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIARDT 130

Query: 145 DLVLIRENTEGEYSGIEHV-VSPGVVQSIKLITRDASERVIRYAFEYARAVGRP-KVMVV 202
           D++++RE   G Y G  H     GV       T    +R+ R A   A     P  V  +
Sbjct: 131 DIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVWSL 190

Query: 203 HKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYG 262
            K+ +   +      V +   SE+P++QLQ QL+D+  + +V NP A+ + V V  N++G
Sbjct: 191 DKANVLASSRLWRKTVEETFQSEFPNVQLQHQLIDSAAMILVKNPRAF-NGVVVTSNMFG 249

Query: 263 DIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSS 317
           DI                        +      ++E  HGSAPD+    KANP   +LS+
Sbjct: 250 DIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPA-GKANPIGCILSA 308

Query: 318 VMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAV 365
            MML   + +    +++E+AV   + SG   RT DL GS+STS   +A+
Sbjct: 309 AMMLKLSLNMVAAGEAVEQAVQEVLDSG--VRTGDLLGSSSTSEVGDAI 355

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 129/270 (47%), Gaps = 21/270 (7%)

Query: 116 LTLRKTFGLFANVRPAKSVE----GFKTTYENV----DLVLIRENTEGEYSG-IEHVVSP 166
           L +RK  GL+ N+RP K +     G     E V    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELGLYGNLRPCKFISDKLIGLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGS 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADG-LFVDVAKELSSE 225
           GV    +  + +  +R+ + A  +      P + +        LA   L+     E  +E
Sbjct: 154 GVAWDSEKYSIEEVKRITKMA-AFLSLQNDPPLPIWSLDKANVLASSRLWRAAVDETIAE 212

Query: 226 YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXX--XXXXXXXXXXA 283
           +P++++Q QL+D+  + +V NP    + + +  N++GDI                    A
Sbjct: 213 FPNLKVQHQLIDSAAMMLVKNP-TQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLA 271

Query: 284 NIGHK---VSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLS 339
           ++  K     ++E  HGSAPD+A + K NP A +LS+ MML   + + ++ ++IE+AV  
Sbjct: 272 SLPDKNKAFGLYEPCHGSAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSV 330

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIKRL 369
            +  G   RTADL G+++TS   +AV + L
Sbjct: 331 VLDRGI--RTADLGGNSTTSELGDAVAQEL 358

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 101/365 (27%), Positives = 165/365 (45%), Gaps = 35/365 (9%)

Query: 33  STGKYTVSFIEGDGVGPEISK-SVKDIFAAAEVPVEWESCDVTPLFINGLTT------IP 85
           ST K  V  + GD VG EI++ +VK + A +EV  E +  +     I G         +P
Sbjct: 2   STTKKIV-VLPGDHVGQEITEEAVKVLKAISEVRPE-KQFEFQYHLIGGAAIDATGEPLP 59

Query: 86  QPAVDSINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------S 133
             ++++  K+   L G +  P  G G     + L L +RK   L+AN+RP          
Sbjct: 60  DASLEAAKKSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLD 118

Query: 134 VEGFK-TTYENVDLVLIRENTEGEYSG-IEHVVSPGVVQSIKLITRDASERVIRYAFEYA 191
           +   K       D V++RE   G Y G  +     GV    +  +    +R+ R A   A
Sbjct: 119 LSPLKPECARGTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLA 178

Query: 192 RAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAY 250
                P  V  + K+ +   +      V + + +E+P + +Q QL+D+  + +V NP   
Sbjct: 179 LQHSPPLPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNP-TQ 237

Query: 251 ADTVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGQ 305
            + V +  N++GDI                        +      ++E  HGSAPD+  +
Sbjct: 238 LNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-K 296

Query: 306 NKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEA 364
            K NP A +LS+ MML   + ++E+  ++E+AV   + SG   RTADL G+++TS   EA
Sbjct: 297 GKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVLDSG--VRTADLKGTSTTSEVGEA 354

Query: 365 VIKRL 369
           V+K L
Sbjct: 355 VVKAL 359

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 102/363 (28%), Positives = 166/363 (45%), Gaps = 42/363 (11%)

Query: 39  VSFIEGDGVGPEIS-KSVKDIFAAAEVPVEWESCDVTPLFINGL--------TTIPQP-- 87
           +  + GD VG EI+ +++K + A +EV       DV   F N L        T +P P  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEV-----RSDVNFDFENHLIGGAAIDATGVPLPDE 61

Query: 88  AVDSINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVE 135
           A+++  K    L G +  P  G G     + L L +RK   L+AN+RP          + 
Sbjct: 62  ALEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLS 120

Query: 136 GFKTTY-ENVDLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITRDASERVIRYAFEYARA 193
             K  + +  D V++RE   G Y G  +     GV    +  T    +R+ R A   A  
Sbjct: 121 PIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 194 VGRP-KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYAD 252
              P  +  + K+ +   +      V + + +E+P +++Q QL+D+  + +V NP  + +
Sbjct: 181 HEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-THLN 239

Query: 253 TVSVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGQNK 307
            + +  N++GDI                    A++  K     ++E  HGSAPD+  +NK
Sbjct: 240 GIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNK 298

Query: 308 ANPTALLLSSVMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVI 366
            NP A +LS+ MML   + L E+  +IE AV   + +G   RT DL GS ST+   +AV 
Sbjct: 299 VNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVA 356

Query: 367 KRL 369
           K +
Sbjct: 357 KEV 359

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 123/276 (44%), Gaps = 32/276 (11%)

Query: 116 LTLRKTFGLFANVRP----AKSVEGFK----TTYENVDLVLIRENTEGEYSG-IEHVVSP 166
           L +RK  GL+AN+RP    +KS+ G         +  D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRP-------KVMVVHKSTIQRLADGLFVDVA 219
           GV    +  T    ER+ R     A     P       K  V+  S + R        V 
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRRT------VN 207

Query: 220 KELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXX---- 275
           + +  E+P + +Q QL+D+  + ++ NP  + + + +  N++GDI               
Sbjct: 208 ETIKREFPQLSVQHQLIDSAAMIMIKNPRKF-NGIVITSNIFGDIISDAASVIPGSLGLL 266

Query: 276 -XXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSI 333
                    +  +   ++E  HGSAPD+  + +ANP A +LS+ MML   + + ++  +I
Sbjct: 267 PSASLASEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAI 325

Query: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           E AV   I SG   RT DL G+ +T+   +AV   L
Sbjct: 326 ENAVKQVIESGI--RTGDLGGNNTTTEVGDAVTHAL 359

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 161/357 (45%), Gaps = 34/357 (9%)

Query: 39  VSFIEGDGVGPEIS-KSVKDIFAAAEVPVEWESCDVTPLFINGL------TTIPQPAVDS 91
           +  + GD VG E++ +++K + A AEV  E +  +     I G       T +P  A+++
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIK-FNFQHHLIGGAAIDATGTPLPDEALEA 63

Query: 92  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKT 139
             K    L G +  P  G G     + L L +RK  GL+AN+RP          +   K 
Sbjct: 64  SKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASDSLLDLSPLKP 122

Query: 140 TY-ENVDLVLIRENTEGEYSG-IEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRP 197
            Y +  D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 123 EYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQQNPP 182

Query: 198 -KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSV 256
             +  + K+ +   +      V + + +E+P + +Q QL+D+  + +V +P    + V +
Sbjct: 183 LPIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKSP-TKLNGVVI 241

Query: 257 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGQNKANPT 311
             N++GDI                        +      ++E  HGSAPD+   NK NP 
Sbjct: 242 TNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPDLPA-NKVNPI 300

Query: 312 ALLLSSVMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIK 367
           A +LS+ MML   + L E+  ++E+AV + + +G   RT DL GS ST+   +A+ K
Sbjct: 301 ATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAG--VRTGDLGGSNSTTEVGDAIAK 355

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 163/359 (45%), Gaps = 34/359 (9%)

Query: 39  VSFIEGDGVGPEISKSVKDIFAA-----AEVPVEWESCDVTPLFINGLTTIPQP--AVDS 91
           +  + GD VG EI+     +  A     + V  ++E+  +    I+  T +P P  A+++
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDA-TGVPLPDEALEA 65

Query: 92  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKT 139
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 140 TY-ENVDLVLIRENTEGEYSG-IEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRP 197
            + +  D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQHEPP 184

Query: 198 -KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSV 256
             +  + K+ +   +      V + + +E+P +++Q QL+D+  + +V NP  + + + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-THLNGIII 243

Query: 257 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGQNKANPT 311
             N++GDI                    A++  K     ++E  HGSAPD+  +NK NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPV 302

Query: 312 ALLLSSVMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           A +LS+ MML   + L E+  +IE AV   + +G   RT DL GS ST+   +AV K +
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAG--IRTGDLGGSNSTTEVGDAVAKEV 359

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 123/268 (45%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SVEGFKTTY-ENVDLVLIRENTEGEYSG-IEHVVSP 166
           L +RK   L+AN+RP          +   K  + +  D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSE 225
           GV    +  T+   +R+ R A   A     P  +  + K+ +   +      V + + +E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 226 YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P ++L  QL+D+  + +V +P    + + +  NL+GDI                     
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSP-TQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLA 270

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLS 339
              +      ++E  HGSAPD+  + K NP A++LS+ MML   + L ++ +++EKAV  
Sbjct: 271 SLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ 329

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIK 367
            + SG   RT DL GS STS   +A+ K
Sbjct: 330 VLDSG--VRTGDLGGSNSTSEVGDAIAK 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 101/363 (27%), Positives = 166/363 (45%), Gaps = 36/363 (9%)

Query: 33  STGKYTVSFIEGDGVGPEIS-KSVKDIFAAAEVPVEWESCDVTPLFINGL----TTIPQP 87
           ST K  V  + GD VG EI+ ++VK + A AEV     + D     I G     T +P P
Sbjct: 2   STKKIVV--LPGDHVGEEITAEAVKVLKAIAEVDNSI-NFDFQYHLIGGAAIDATGVPLP 58

Query: 88  --AVDSINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSVEG 136
             A+++   +   L G +  P  G G     + L L +RK  GL+AN+RP    ++S+ G
Sbjct: 59  DEALEASKNSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASESLLG 117

Query: 137 FK----TTYENVDLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITRDASERVIRYAFEYA 191
                    +  D +++RE   G Y G  +     GV    +  +    +R+ R A   A
Sbjct: 118 LSPLRPEIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLA 177

Query: 192 RAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAY 250
                P  +  + K+ +   +      V + + +E+P + +Q QL+D+  + +V NP   
Sbjct: 178 LQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQNQLIDSAAMILVKNP-TQ 236

Query: 251 ADTVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGQ 305
            + + +  N++GDI                        +      ++E  HGSAPD+  +
Sbjct: 237 LNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-K 295

Query: 306 NKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEA 364
            K NP A +LS+ MML   + L ++ D+IE+AV   + +G   RT DL GS ST+   +A
Sbjct: 296 GKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAG--IRTGDLGGSNSTTEVGDA 353

Query: 365 VIK 367
           + K
Sbjct: 354 IAK 356

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 118/268 (44%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SVEGFKTTY-ENVDLVLIRENTEGEYSG-IEHVVSP 166
           L +RK   L+AN+RP          +   K  Y +  D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASDSLLELSPLKAQYAQGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSE 225
           GV    +  +    +R+ R A   A     P  +  + K+ +   +      V K +  E
Sbjct: 152 GVAWDSEQYSVPEVQRITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEKTIKEE 211

Query: 226 YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P + +  QL+D+  + +V NP    + + +  N++GDI                     
Sbjct: 212 FPTLSVNHQLIDSAAMILVKNP-TQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLA 270

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLS 339
              +      ++E  HGSAPD+A + K NP A +LS+ MML   + + E+  +IEKAV  
Sbjct: 271 SLPDTNTAFGLYEPCHGSAPDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKK 329

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIK 367
            +  G   RT DL GS STS   +AV K
Sbjct: 330 VLDDGI--RTGDLGGSNSTSEVGDAVAK 355

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 123/268 (45%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SVEGFKTTY-ENVDLVLIRENTEGEYSG-IEHVVSP 166
           L +RK   L+AN+RP          +   K  Y +  D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSE 225
           GV    +  +    +R+ R A   A     P  +  + K+ +   +      V + + +E
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 226 YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P + +Q QL+D+  + +V +P    + + +  N++GDI                     
Sbjct: 214 FPTLTVQHQLIDSAAMILVKSPTKL-NGIVITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLS 339
              +      ++E  HGSAPD+  +NK NP A +LS+ MML   + L E+ +++E+AV  
Sbjct: 273 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRR 331

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIK 367
            + +G   RTADL G  STS   +AV+K
Sbjct: 332 VLDAG--IRTADLRGENSTSEVGDAVVK 357

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 163/359 (45%), Gaps = 34/359 (9%)

Query: 39  VSFIEGDGVGPEISKSVKDIFAA-----AEVPVEWESCDVTPLFINGLTTIPQP--AVDS 91
           +  + GD VG EI+     +  A     + V  ++E+  +    I+  T +P P  A+++
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDA-TGVPLPDEALEA 65

Query: 92  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKT 139
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 140 TY-ENVDLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGRP 197
            + +  D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPP 184

Query: 198 -KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSV 256
             +  + K+ +   +      V + + +E+P +++Q QL+D+  + +V NP  + + + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-THLNGIII 243

Query: 257 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGQNKANPT 311
             N++GDI                    A++  K     ++E  HGSAPD+  +NK NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 312 ALLLSSVMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           A +LS+ MML   + L E+  +IE AV   + +G   RT DL GS ST+   +AV + +
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVAEEV 359

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 162/358 (45%), Gaps = 33/358 (9%)

Query: 38  TVSFIEGDGVGPEISK-SVKDIFAAAEVPVEWESCDVTPLFINGL----TTIPQP--AVD 90
           T+  + GD VG EI++ ++K + A  E   +  +       I G     T +P P  A++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 91  SINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFK 138
           +  K    L G +  P  G G     + L L +RK   L+AN+RP          +   K
Sbjct: 66  ASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 139 -TTYENVDLVLIRENTEGEYSG-IEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVGR 196
                  D V++RE   G Y G  +     GV    +  +    +R+ R A   A     
Sbjct: 125 PEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQHNP 184

Query: 197 P-KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVS 255
           P  +  + K+ +   +      V + + +E+P + +Q QL+D+  + +V NP  + + + 
Sbjct: 185 PLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNP-THLNGII 243

Query: 256 VCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGQNKANP 310
           +  N++GDI                    A++  K     ++E  HGSAPD+  + K NP
Sbjct: 244 ITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGKVNP 302

Query: 311 TALLLSSVMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIK 367
            A +LS+ MML   + L+E+ + IE+AV   + SG   RTADL G+ ST+   +AV K
Sbjct: 303 VATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG--IRTADLKGTNSTTEVGDAVAK 358

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 101/369 (27%), Positives = 161/369 (43%), Gaps = 47/369 (12%)

Query: 33  STGKYTVSFIEGDGVGPEI-SKSVKDIFAAAEVPVEWESCDVTPLFINGL------TTIP 85
           ST K  V  + GD VG EI  +++K + A A    +    +     I G       T +P
Sbjct: 2   STKKIVV--LPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLP 59

Query: 86  QPAVDSINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSVEG 136
             A+D+   +   L G +  P  G G     + L L +RK   L+AN+RP    + S+ G
Sbjct: 60  DEALDAAKNSDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSDSLLG 118

Query: 137 FKTTYENV----DLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITRDASERVIRYAFEYA 191
                E +    D  ++RE   G Y G  +     G     +  T    +R+ R A   A
Sbjct: 119 LSPLKEEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMAAFLA 178

Query: 192 RAVGRP-------KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVV 244
                P       K  V+  S + R        V + + +E+P++++Q QL+D+  + +V
Sbjct: 179 LQHDPPLPIWSLDKANVLASSRLWRKT------VEETIKNEFPNLKVQHQLIDSAAMILV 232

Query: 245 SNPGAYADTVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSA 299
            +P    + + +  N++GDI                        +      ++E  HGSA
Sbjct: 233 KSPRQL-NGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSA 291

Query: 300 PDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSAST 358
           PD+  + K NP A +LS+ MML   + L ++  +IE+AV   + +G   RTADL GS ST
Sbjct: 292 PDLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG--IRTADLKGSNST 348

Query: 359 SSFTEAVIK 367
           S   +AV K
Sbjct: 349 SEVGDAVAK 357

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 156/361 (43%), Gaps = 33/361 (9%)

Query: 34  TGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVTPLFINGL----TTIPQP-- 87
           T K+ V  + GD VG EI++    +  A        + D     I G     T +P P  
Sbjct: 86  TTKHIV-VLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDE 144

Query: 88  AVDSINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVE 135
           A+++  K    L G +  P  G G     + L L +RK   L+AN+RP          + 
Sbjct: 145 ALEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLS 203

Query: 136 GFK-TTYENVDLVLIRENTEGEYSG-IEHVVSPGVVQSIKLITRDASERVIRYAFEYARA 193
             K    +  D+ ++RE   G Y G  +     GV    +  +    +R+ R A   A  
Sbjct: 204 PLKPEIVKGTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQ 263

Query: 194 VGRP-KVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYAD 252
              P  V  + K+ +   +      V + + +E+P + +Q QL+D+  + +V NP  + +
Sbjct: 264 HNPPLPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNP-THLN 322

Query: 253 TVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGQNK 307
            V +  N++GDI                        +      ++E  HGSAPD+  + K
Sbjct: 323 GVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGK 381

Query: 308 ANPTALLLSSVMMLN-HMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVI 366
            NP A +LS  MML   + + E+  ++EKAV   + SG   RTADL GS STS   +A+ 
Sbjct: 382 VNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVLDSGV--RTADLRGSNSTSEVGDAIA 439

Query: 367 K 367
           K
Sbjct: 440 K 440

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 119/268 (44%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SVEGFKTTY-ENVDLVLIRENTEGEYSG-IEHVVSP 166
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASESLLDLSPLKAEHARGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSE 225
           GV    +  +    +R+ R A   A     P  V  + K+ +   +      V + + +E
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQHNPPLPVWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 226 YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P + +Q QL+D+  + +V NP    + V +  N++GDI                     
Sbjct: 214 FPTLTVQHQLIDSAAMIMVKNP-TQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLS 339
              +      ++E  HGSAPD+  + K NP A +LS+ MML   + ++E+  ++E+AV  
Sbjct: 273 SLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRR 331

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIK 367
            + SG   RT DL GS ST    +AV K
Sbjct: 332 VLDSG--IRTGDLRGSNSTQEVGDAVAK 357

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 122/268 (45%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRP----AKSVEGFK----TTYENVDLVLIRENTEGEYSG-IEHVVSP 166
           L +RK  GL+AN+RP    ++ + G         +  D +++RE   G Y G  +     
Sbjct: 95  LKIRKELGLYANLRPCNFASEPLLGLSPLRPEIAKGTDFMVVRELVGGIYFGERKEDDGD 154

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSE 225
           GV    +  +    ER+ R A   A     P  +  + K+ +   +      V   + +E
Sbjct: 155 GVAWDSEKYSVPEVERITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEATIKNE 214

Query: 226 YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P + +Q QL+D+  + +V NP    + + +  N++GDI                     
Sbjct: 215 FPTLTVQNQLIDSAAMILVKNP-TQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLA 273

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLS 339
              +      ++E  HGSAPD+  +NK NP A +LS+ MML   + + ++ +++E+AV  
Sbjct: 274 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRR 332

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIK 367
            + +G   RT DL GS ST    +A+ K
Sbjct: 333 VLDAG--VRTGDLGGSNSTQEVGDAIAK 358

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 122/270 (45%), Gaps = 20/270 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SVEGFKTTY-ENVDLVLIRENTEGEYSGI-EHVVSP 166
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASESLLELSPIKPQFARGTDFVVVRELVGGIYFGKRKEDDGD 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSE 225
           GV    +  T    +R+ R A   A     P  +  + K+ +   +      V + + +E
Sbjct: 154 GVAWDSEQYTVPEVQRITRMAAFMALQHQPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 226 YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXX--XXXXXXXXXXA 283
           +P +++Q QL+D+  + +V NP    + + +  N++GDI                    A
Sbjct: 214 FPTLKVQHQLIDSAAMILVKNP-TQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLA 272

Query: 284 NIGHK---VSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLS 339
           ++  K     ++E  HGSAPD+  +NK NP A +LS+ MML   + +  +  +IE AV  
Sbjct: 273 SLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKK 331

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIKRL 369
            + +G   RT DL GS ST    +AV K +
Sbjct: 332 VLDAG--IRTGDLGGSNSTIEVGDAVAKEV 359

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 122/268 (45%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAKSVEGF--------KTTYENVDLVLIRENTEGEYSG-IEHVVSP 166
           L +RK  G++AN+RP + V           +   +  D V++RE   G Y G  +     
Sbjct: 94  LKIRKELGVYANLRPCQFVSETLLDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDD 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSE 225
           GV    +  +    +R+ R A   A     P  V  + K+ +   +      V + + +E
Sbjct: 154 GVAWDKESYSVPEIQRITRMAAFLALQHNPPLPVWSLDKANVLATSRLWRKTVEETIKNE 213

Query: 226 YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXXXX--XXXXXXXXXXA 283
           +P + +   L+D+  + +V NP    + V +  N++GDI                    A
Sbjct: 214 FPTLTINHHLIDSAAMTLVQNP-TKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 284 NIGHK---VSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLS 339
           ++  K   + ++E  HGSAPD+   + ANP A +LS+ MM    + L ++ ++IE+AV  
Sbjct: 273 SLPDKNDALGLYEPCHGSAPDLPA-DHANPIATILSAAMMCKLSLNLTKEGNAIEEAVKR 331

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIK 367
           TI +G   +T DL G  +T+    AV K
Sbjct: 332 TIDAGI--KTGDLGGKNTTTEVGNAVAK 357

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 117/268 (43%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SVEGFKTTY-ENVDLVLIRENTEGEYSGI-EHVVSP 166
           L +RK   L+AN+RP          +   K  Y +  D  ++RE   G Y G  +     
Sbjct: 95  LKIRKELQLYANLRPCNFASDSLLDLSPLKEKYAKGTDFTVVRELVGGIYFGKRKEDDGD 154

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAVGRP-KVMVVHKSTIQRLADGLFVDVAKELSSE 225
           GV    +  +    +R+ R A   A     P  +  + K+ +   +      V + + +E
Sbjct: 155 GVAWDSEQYSVPEVQRITRMAAFLAMQHNPPLPIWSLDKANVLASSRLWRKTVEETIQNE 214

Query: 226 YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDIXXXXXX-----XXXXXXXXXX 280
           +P +++  QL+D+  + +V NP    + + +  N++GDI                     
Sbjct: 215 FPSLKVSHQLIDSAAMILVKNP-TQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLS 273

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLYEKADSIEKAVLS 339
              +      ++E  HGSAPD+  + K NP   +LS  MML   + L E+  ++E+AV  
Sbjct: 274 SLPDTNSAFGLYEPCHGSAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRR 332

Query: 340 TIASGPENRTADLAGSASTSSFTEAVIK 367
            + +    RTADL GS STS   +AV K
Sbjct: 333 VLDNNI--RTADLGGSNSTSDIGDAVAK 358

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 319 MMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369
           +MLNH+GL E A  I KAV  TIA G ++ T D+ GS+ST+ FT  +I +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEIINKL 50

>KLTH0G12474g Chr7 (1059087..1059776) [690 bp, 229 aa] {ON} similar
           to uniprot|Q12354 Saccharomyces cerevisiae YLR118C
          Length = 229

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 39/92 (42%), Gaps = 19/92 (20%)

Query: 92  INKNLIALKGPLA--TPIGKGHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149
           IN  L+ LK P    TPI  GH   +  +   +G         SVE F T Y       I
Sbjct: 149 INDKLLELKSPANSDTPIFHGHGDQDTVIPLKYG--------HSVEQFFTKYCG-----I 195

Query: 150 RENTEGEYSGIEHVVSP----GVVQSIKLITR 177
              T   YSG+EH  SP     +V+ +K I R
Sbjct: 196 SNYTMNVYSGMEHSASPEEIEDLVKFLKSILR 227

>Kwal_26.7784 s26 (509503..510006) [504 bp, 167 aa] {OFF} [contig
           55] FULL
          Length = 167

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 19  KQPSIGRFTGKPNPSTGKYTVSFIEGD-GVGPEISKSVKDIFAA 61
           ++P +  +  K   S+  Y+V+ ++   G GP ++KS+KD+ AA
Sbjct: 77  RRPPLAPWRDKEPTSSLSYSVTMLKASLGTGPSLAKSIKDLMAA 120

>KNAG0H01030 Chr8 complement(172427..173758) [1332 bp, 443 aa] {ON} 
          Length = 443

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 59/140 (42%), Gaps = 10/140 (7%)

Query: 49  PEISKSVKDIFAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIG 108
            ++S    D   A    + + +  ++ L +N LT++ Q    + N +L  L+    T +G
Sbjct: 218 SDVSSVSFDNLQAVNASLGFLNNTISELKLNNLTSVGQTFTITFNNDLTHLEFSNLTKVG 277

Query: 109 KGHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIR--------ENTEGEYSG- 159
            G    N T  K+   FAN++           ++++DL  ++        E     +S  
Sbjct: 278 GGFVVANNTNLKSIDAFANLQTVNGALDVIGNFDSLDLTALKSVRGGADVETKSANFSCS 337

Query: 160 -IEHVVSPGVVQSIKLITRD 178
            ++ + S G +Q  K I ++
Sbjct: 338 PLKKLQSKGAIQGDKFICKN 357

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,672,321
Number of extensions: 1308043
Number of successful extensions: 3818
Number of sequences better than 10.0: 88
Number of HSP's gapped: 3614
Number of HSP's successfully gapped: 88
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)