Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02706g5.442ON33233217400.0
KLTH0F15884g5.442ON32933214390.0
Kwal_55.213995.442ON32933214260.0
KAFR0D050605.442ON32633213780.0
YDR372C (VPS74)5.442ON34534513780.0
Smik_4.6385.442ON34634613740.0
Suva_2.5445.442ON34634613700.0
KLLA0E02355g5.442ON32432913650.0
TDEL0D025905.442ON33033213640.0
Skud_4.6415.442ON34634613620.0
ZYRO0F10208g5.442ON33233213580.0
Kpol_1016.25.442ON32833213450.0
CAGL0A02926g5.442ON32833213270.0
KNAG0B042005.442ON34434413250.0
NCAS0F034305.442ON33233313150.0
Ecym_45135.442ON33333112881e-179
NDAI0B057205.442ON36536612881e-179
ACL165C5.442ON33132912531e-174
TBLA0A064805.442ON33433512451e-172
TPHA0J026105.442ON32933311861e-164
TBLA0A027805.442ON3873069271e-123
Kpol_1062.245.442ON2762769071e-122
NCAS0H020905.442ON3452835668e-70
Skud_5.481.485ON517106712.2
SAKL0E09394g2.217ON898124703.4
KAFR0H021508.349ON702165694.9
KAFR0C051107.39ON89168677.1
Skud_15.4828.790ON33643669.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02706g
         (332 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   674   0.0  
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   558   0.0  
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   553   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   535   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   535   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   533   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   532   0.0  
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   530   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   530   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   529   0.0  
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   527   0.0  
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   522   0.0  
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   515   0.0  
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   514   0.0  
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   511   0.0  
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   500   e-179
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   500   e-179
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   487   e-174
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   484   e-172
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   461   e-164
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   361   e-123
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   353   e-122
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   222   8e-70
Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)    32   2.2  
SAKL0E09394g Chr5 complement(782108..784804) [2697 bp, 898 aa] {...    32   3.4  
KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {O...    31   4.9  
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    30   7.1  
Skud_15.482 Chr15 complement(842032..843042) [1011 bp, 336 aa] {...    30   9.4  

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/332 (100%), Positives = 332/332 (100%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60
           MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV
Sbjct: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60

Query: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120
           LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG
Sbjct: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120

Query: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180

Query: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240
           LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL
Sbjct: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240

Query: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300
           SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE
Sbjct: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300

Query: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL
Sbjct: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/332 (81%), Positives = 302/332 (90%), Gaps = 3/332 (0%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60
           MSGLQRRRVN++ S  ++ P+ + +++ E    ++VAYDPEEAKL+++TT PKL LMEEV
Sbjct: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEG---KRVAYDPEEAKLRDDTTTPKLNLMEEV 57

Query: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120
           LLMGLKDKEGYLSFWNDNISYALRGCILIELALR KI+VL+DPARKRFDVS+RL+EVI+ 
Sbjct: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINA 117

Query: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180
           +KTGEVLLDEALNL+KNDEPL IANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177

Query: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240
           LRTEMKNFFLFDM THPITDTSCKEAIKRR+LSVLVSRNM+LNYNEYF  ++ FK+IRTL
Sbjct: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTL 237

Query: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300
           SLICGAYGANVLENVL+SLDY+KRDRAFSRADEILAQFS+FPFALDK TE+GISVNLNKE
Sbjct: 238 SLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKE 297

Query: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           VQ E+  N    LQLE VAGVFEVFSRMDTLL
Sbjct: 298 VQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/332 (80%), Positives = 302/332 (90%), Gaps = 3/332 (0%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60
           MSGLQRRRVN++ S+Y  +P+ S ++  E+   ++VAYDPEEA LK+N T+PKL LMEEV
Sbjct: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGES---KRVAYDPEEAMLKDNATIPKLNLMEEV 57

Query: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120
           LLMGLKDKEGYLSFWNDNISYALRGCILIELALR KI+V++D ARKRFDVS+RL+EVI+ 
Sbjct: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINA 117

Query: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180
           +KTGEVLLDEALNL+KNDEPL IANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177

Query: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240
           LRTEMKNFFLFDM THPITDTSCKEAIKRR+LSVLVSRNM+LNYNEYF  +++FK++RTL
Sbjct: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTL 237

Query: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300
           SLICGAYGANVLENVL SLDY+KRDRAFSRADEILAQFS+FPFALDK TE+GISVN+NKE
Sbjct: 238 SLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKE 297

Query: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           +Q EI  N    L+LEVVAGVFEVFSRMDTLL
Sbjct: 298 MQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/332 (78%), Positives = 293/332 (88%), Gaps = 6/332 (1%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60
           MS LQRRR NR++S+           N   ++DRKVAYDPEEAKL++N ++PKLTLMEEV
Sbjct: 1   MSTLQRRRKNRSDSN------ADDSENVSESQDRKVAYDPEEAKLRDNVSIPKLTLMEEV 54

Query: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120
           LLMGL+D+EGYLSFWNDNISYALRGCILIELALR+KIR+LDD ARKRFDVS+RL+EVIDG
Sbjct: 55  LLMGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVIDG 114

Query: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDEAL L+KNDEPL IANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV
Sbjct: 115 SKTGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 174

Query: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240
           LRTEMKNFFLFDMATHP+TDTSCKEAIKRR+LS LVSRNMELNYN YF+E  +FK IR +
Sbjct: 175 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIV 234

Query: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300
           +L+C +YGANVLENVL+SLDY+KRDRA SRA+EILAQF+++PF L K TE GISVNLNKE
Sbjct: 235 ALVCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKE 294

Query: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           V+ E+ +NP   LQLEV+AGV EVFSRMD LL
Sbjct: 295 VENEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/345 (75%), Positives = 296/345 (85%), Gaps = 13/345 (3%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSS-------------DSNDENAKDRKVAYDPEEAKLKE 47
           MS LQRRRVNR +S       +S+             D +D+N  ++K+AYDPEE+KL++
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60

Query: 48  NTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKR 107
           N  +P LTLMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALR KIR+LDD ARKR
Sbjct: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120

Query: 108 FDVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQV 167
           FD+S+RLIEVID SKTGEVLLDE L L+KNDEPL I+NWIDLLSGETWNLLKINYQLKQV
Sbjct: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180

Query: 168 RERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEY 227
           RERLAKGLVDKGVLRTEMKNFFLFDMATHPI D SCKEAIKRRVLSVLVSRNMEL+YNEY
Sbjct: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240

Query: 228 FSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDK 287
           F E  +FKIIRTL+LICG+YGANVLENVL +L+Y+KRD+A SRA+EI+AQFS++PF L+K
Sbjct: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300

Query: 288 ATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
            TE G+SVNLNKEV+ EI  NPG DLQLEV+AGVFEVFSRMD LL
Sbjct: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/346 (75%), Positives = 299/346 (86%), Gaps = 14/346 (4%)

Query: 1   MSGLQRRRVNRTNS-DYAEQPITSSDSN-------------DENAKDRKVAYDPEEAKLK 46
           MS LQRRRVNR +S D +    ++++ N             D+N  ++K+AYDPEE+KL+
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60

Query: 47  ENTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARK 106
           +N  +P LTLMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALR KIR+LDD ARK
Sbjct: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120

Query: 107 RFDVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQ 166
           RFD+S+RLIEVIDGSKTGEVLLDE L L+KNDEPL I+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNE 226
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPI D SCKEAIKRRVLSVLVSRNMEL+YNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 227 YFSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALD 286
           YF E  +FKIIRTL+LICG+YGANVLENVL +L+Y+KRD+A SRA+EI+AQFS+FPF L+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300

Query: 287 KATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           K TE GISVNLNKEV+ E+  NPG +LQLEV+AGVFEVFSRMD LL
Sbjct: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/346 (74%), Positives = 298/346 (86%), Gaps = 14/346 (4%)

Query: 1   MSGLQRRRVNRTNS-DYAEQPITSSDSN-------------DENAKDRKVAYDPEEAKLK 46
           MS LQRRRVNR +S D +    TS++ N             D+N  ++K+AYDPEE+KL+
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60

Query: 47  ENTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARK 106
           +N  +P LTLMEEVLLMGL+D+EGYLSFWND+ISYALRGCILIELALR KIR+LDD ARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 107 RFDVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQ 166
           RFD+S+RL+EVIDGSKTGEVLLDE L L+KNDEPL I+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNE 226
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPI D SCKEAIKRRVLSVLVSRNMEL+YNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 227 YFSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALD 286
           YF E  +FKIIRTL+LICG+YGANVLENVL +L+Y+KRD+A SRA+EI++ FS++PF L+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300

Query: 287 KATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           K T+ G+SVNLNKEV+ EI  NPG DLQLEV+AGVFEVFSRMD LL
Sbjct: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/329 (77%), Positives = 288/329 (87%), Gaps = 7/329 (2%)

Query: 4   LQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEVLLM 63
           LQRRRVN+ ++       T S    +N  D K+ YD +EAKL++NT+VPKLTLMEEVLLM
Sbjct: 3   LQRRRVNKGDT-------TESIPQIDNEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLM 55

Query: 64  GLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDGSKT 123
           GLKDK+GYLSFWNDNISYALRGCILIELALR KIR +DDPARKR+DVS+RLIEVIDGSKT
Sbjct: 56  GLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKT 115

Query: 124 GEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 183
           GEVLLDE+L+L+KND P  I  WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT
Sbjct: 116 GEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 175

Query: 184 EMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTLSLI 243
           EMKNFFLFDMATHPITDT+CKE+IKRR+LS+LVSRN EL YN YF ++++FK IRTLSLI
Sbjct: 176 EMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLI 235

Query: 244 CGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKEVQA 303
           CGAYGANVLENVLA+LDY+ RD  F+RADEILAQFSEFPF LDK T +G+SVNLNKE+  
Sbjct: 236 CGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQ 295

Query: 304 EIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           E+  +PG DLQLEVVAGVFEVFSRMDTLL
Sbjct: 296 ELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/332 (78%), Positives = 293/332 (88%), Gaps = 2/332 (0%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60
           MS LQRRRVNR +S   E  + +S+ N E    ++VAYDPEEAK+ EN   PKLTLMEEV
Sbjct: 1   MSNLQRRRVNRVDSG-DESSLQASEFN-ETTTSKRVAYDPEEAKITENVKNPKLTLMEEV 58

Query: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120
           LL+GL+DKEGYLSFWNDNISYALRGCI+IELALR KIR++DD ARKRFDVS+RLIEV+D 
Sbjct: 59  LLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDA 118

Query: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDE L L+K DEPL IANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV
Sbjct: 119 SKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 178

Query: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240
           LRTEMKNFFLFDMATHP+TDTSCKEA+KRRVLSVLVSRNMEL+YNEYF +  +FK+IRT+
Sbjct: 179 LRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTI 238

Query: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300
           +LICG+Y ANVLENVL SLDY+KRDRA SRADEIL Q++++PF LDKATESG+S+NLNKE
Sbjct: 239 ALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKE 298

Query: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           V+ E++QN    LQLEVVAGVFEVFSRMD LL
Sbjct: 299 VKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/346 (73%), Positives = 300/346 (86%), Gaps = 14/346 (4%)

Query: 1   MSGLQRRRVNRTNSD--YAEQPITSSDS------------NDENAKDRKVAYDPEEAKLK 46
           MS LQRRRVNR +S    + Q ++++D+            +D++  ++K+AYDPEE+KL+
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLR 60

Query: 47  ENTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARK 106
           +N  +P LTLMEEVLLMGL+D+EGYLSFWND+ISYALRGCILIELALR KIR+LDD ARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 107 RFDVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQ 166
           RFD+S+RL+EV+DGSKTGEVLLDE L L+KNDEPL I+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNE 226
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPI D SCKEAIKRRVLSVLVSRNMEL+YNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 227 YFSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALD 286
           YF E  +FKIIRTL+LICG+YGANVLENVL +L+Y+KRD+A +RA+EI+AQFS++PF L+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLE 300

Query: 287 KATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           K TE G+SVNLNKEV+ EI  N G DLQLEV+AGVFEVFSRMD LL
Sbjct: 301 KETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/332 (77%), Positives = 285/332 (85%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60
           MSGLQRRRVNR +S  +    T      E++  +KVAYDPEE KL +N  VPKLTLMEEV
Sbjct: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKLTLMEEV 60

Query: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120
           LL+GL+DKEGYLSFWNDNISYALRGCI+IELALR KIRV+DD ARKRFDVS+RLIEV D 
Sbjct: 61  LLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120

Query: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDEAL L+K DEPL I NWIDLLSGETWN LKINYQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180

Query: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240
           LRTEMKNFFLFDMATHP+TDTSCKEAIKRR+LSVLV RN+ELNYN+YFSE ++FK+IRT+
Sbjct: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240

Query: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300
           +LICGAY ANVLENVL SL Y+KRD A  RADEIL QFSE+PF LD  TESGIS+NLNKE
Sbjct: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300

Query: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           V  E+ Q+P   LQLEV+AGVFEVFSRMD LL
Sbjct: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/332 (73%), Positives = 293/332 (88%), Gaps = 4/332 (1%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60
           MS LQRRR+NR NSD AE    SS+ ++E +K  K+AYDPEEAKLK++ TVP LTLMEEV
Sbjct: 1   MSSLQRRRLNRINSDTAE----SSNDDEERSKSTKIAYDPEEAKLKDDVTVPTLTLMEEV 56

Query: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120
           +L+GL DK+GYLSFWNDNISY LRGCI+IELALR+KIR+LDDPARKRFD+S+RL+EV+DG
Sbjct: 57  VLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVVDG 116

Query: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDEAL L+KNDEPL IANWIDLLSGETWN  KINYQLKQVRER++KGLVDKGV
Sbjct: 117 SKTGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDKGV 176

Query: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240
           LRTEMKNFFLFDMATHP+TDTSCKEAIKRR+LS LVSR MELNYNEYF E   +K+IRT+
Sbjct: 177 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIRTI 236

Query: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300
           +LIC +Y ANVLENVL+SL+Y+KRD A +R++ IL++F+++PF LDKA++  +S+NL+K 
Sbjct: 237 ALICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLSKL 296

Query: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           V+ EIAQNPG  LQLE VAGVF+VFS+MD +L
Sbjct: 297 VEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/332 (75%), Positives = 289/332 (87%), Gaps = 4/332 (1%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60
           MS LQRRRVN+  S+ A   I   D  D+     K+AYDPEE+KL+ ++  P LTLMEEV
Sbjct: 1   MSTLQRRRVNK--SENASNGI--EDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEV 56

Query: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120
           LLMGL+D+EGYLSFWND+ISYALRGCILIELALR+KIR+LD PAR RFD+S+RLIEVID 
Sbjct: 57  LLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDS 116

Query: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDE L L+ NDEPL IANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV
Sbjct: 117 SKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 176

Query: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240
           LRTEMKNFFLFDMATHP++D+SCKEAIKRR+LSVLVSRNME++YN YF E+  FK+IRT+
Sbjct: 177 LRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTV 236

Query: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300
           SLI GAYGANVLENV++SL+YDKRD+A +RA+EILAQFS++PF L K ++ GISVNLNKE
Sbjct: 237 SLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKE 296

Query: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           +Q E+  NPG DL+LEV+AGVFEVFSRMD LL
Sbjct: 297 LQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/344 (72%), Positives = 292/344 (84%), Gaps = 12/344 (3%)

Query: 1   MSGLQRRRVNRTNSDYAEQ---------PITSSDSND---ENAKDRKVAYDPEEAKLKEN 48
           MS LQRRRVNR++S+  E          P  S+D+ +    +   RKVAYDPEEAKL++N
Sbjct: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60

Query: 49  TTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRF 108
            TVPKLTLMEEVLLMGL+D+EGYLSFWNDNISYALRGCI+IELALR KIR+LDD ARKRF
Sbjct: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120

Query: 109 DVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVR 168
           D+S+RL+EV+DGSKTGEVLLDE L L+KNDEPL IANWIDLLSGETWNL+KINYQLKQVR
Sbjct: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180

Query: 169 ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYF 228
           ERLAKGLVDKGVLRTEMKNFFLFDMATHP+TD+SCKEAIKRR+LS +VSRNMEL++N YF
Sbjct: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240

Query: 229 SENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKA 288
            E+ +FK IRT++L+C  YGA+VLENVL+SLDY++RDRA SRA+E+L +F ++PF L+K 
Sbjct: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300

Query: 289 TESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
            +SGIS NLNKE Q E+ ++P   L LEVVAGV EVFSRMD LL
Sbjct: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  511 bits (1315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/333 (74%), Positives = 287/333 (86%), Gaps = 2/333 (0%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKE-NTTVPKLTLMEE 59
           MS LQRRRVN+ +SD     +T +   D +  D KVAYDPEEA+++     VP LTLMEE
Sbjct: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSD-NDNKVAYDPEEARMRNVGGQVPVLTLMEE 59

Query: 60  VLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVID 119
           VLLMGL+DKEGYLSFWNDNISYALRGCILIELALR KI++LDD ARKRF++S+RL++VID
Sbjct: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119

Query: 120 GSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKG 179
           G+KTGEVLLDE L L+KNDEPL IA+WIDLLSGETWN++KINYQLKQVRERLAKGLVDKG
Sbjct: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179

Query: 180 VLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRT 239
           VLRTEMKNFFLFDMATHP+TD+SCKEAIKRRVLS+LVSRNMEL+YN YF E   FKIIRT
Sbjct: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239

Query: 240 LSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNK 299
           ++LICGAYGANVLEN+L SLD++  D A +RADE++AQFS+FPF L+  T  GISVNLN+
Sbjct: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299

Query: 300 EVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           EVQ E+A  PG DLQLEV+AGV EVFSRMDTLL
Sbjct: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  500 bits (1288), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 243/331 (73%), Positives = 282/331 (85%), Gaps = 2/331 (0%)

Query: 4   LQRRRVNRTNSDYAEQPITS-SDSNDENAK-DRKVAYDPEEAKLKENTTVPKLTLMEEVL 61
           LQRRRVN+         +T      DE+ K   KVAYDPE+ KL+ENT  P LTLMEEVL
Sbjct: 3   LQRRRVNKAEVGGTSVELTQRKHGEDEDDKGSHKVAYDPEDQKLRENTKEPTLTLMEEVL 62

Query: 62  LMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDGS 121
           LMGLKDKEGYLSFWND+ISY+LRGCILIELALR KIRV++D ARKRFD+S+RL+EVI+ S
Sbjct: 63  LMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVEVIETS 122

Query: 122 KTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVL 181
           KTGE LLDE L+L+K++EPL I NWIDLLSGETWNLLKI+YQLKQVRERLAKGLVDKGVL
Sbjct: 123 KTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLVDKGVL 182

Query: 182 RTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTLS 241
           RTEMKNFFLFDMATHP+ D+SCKE+IKRR+LSVLV RN+ L+Y EYF E++ FK +RT++
Sbjct: 183 RTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKYLRTIA 242

Query: 242 LICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKEV 301
           LICGAYGANVLENVL+SLDY+KR+R FSRA+EIL QFS++PFALDK  E+GISVNL  +V
Sbjct: 243 LICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVNLYNQV 302

Query: 302 QAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           + EI +NPG  LQLEVVAGVFEVFSRMD  L
Sbjct: 303 KEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  500 bits (1288), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 256/366 (69%), Positives = 287/366 (78%), Gaps = 35/366 (9%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENA-----------------KDRKVAYDPEEA 43
           MS LQRRR  +  S+     +  SD+ND +                     K+AYDPEEA
Sbjct: 1   MSTLQRRRRPQDGSNKGMVDV-DSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEEA 59

Query: 44  KL-----------------KENTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGC 86
           KL                   N   P LTLMEEVLLMGL+DKEGYLSFWNDNISYALRGC
Sbjct: 60  KLLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGC 119

Query: 87  ILIELALRDKIRVLDDPARKRFDVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANW 146
           ILIELALR KIR+LDD ARKRFD+S+RLIEV DGSKTGEVLLDE L L+KNDEPL IANW
Sbjct: 120 ILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANW 179

Query: 147 IDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEA 206
           IDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+TD+SCKEA
Sbjct: 180 IDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEA 239

Query: 207 IKRRVLSVLVSRNMELNYNEYFSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDR 266
           IKRRVLSVLVSRNME NYNEYF +N  FKIIRT++LICGAYGANVLENVL+SLDY+K D 
Sbjct: 240 IKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDN 299

Query: 267 AFSRADEILAQFSEFPFALDKATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFS 326
           A +RADE++AQFS+FPF L+K T + +SVNLN+ VQ E+ +NPG DLQLEV+AGV EVFS
Sbjct: 300 AIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFS 359

Query: 327 RMDTLL 332
           RMDTLL
Sbjct: 360 RMDTLL 365

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  487 bits (1253), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/329 (71%), Positives = 274/329 (83%)

Query: 4   LQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEVLLM 63
           LQRRRVN+T  +      + + S++E     KVAYDPEE KL+ENT  P LTLMEEVLLM
Sbjct: 3   LQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLLM 62

Query: 64  GLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDGSKT 123
           GLKDKEGYLSF N+NISYALRGCILIELALR +I+V+DD  R+RFD S+RLIEV+DGSKT
Sbjct: 63  GLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKT 122

Query: 124 GEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 183
           GE LLDEAL L+K  EPL I NW+DLLSGETWN LKINYQL+QVRERLAKGLVDKGVLRT
Sbjct: 123 GEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRT 182

Query: 184 EMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTLSLI 243
           EMKNFFLFDM THP+ DTSCKE+IKRR+LSVLV RN+EL Y E F E + FK +RT++LI
Sbjct: 183 EMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALI 242

Query: 244 CGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKEVQA 303
           C A+GANVLE VL++LDY+KRDR FSRA+E+L QFS++PFALDK  E+GISVNLN+ VQ 
Sbjct: 243 CSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQE 302

Query: 304 EIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           E+ +NPG  L LEVVAGV +V+SRMD LL
Sbjct: 303 ELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  484 bits (1245), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 233/335 (69%), Positives = 279/335 (83%), Gaps = 4/335 (1%)

Query: 1   MSGLQRRRVNRTNSDYAEQPITSSDSND---ENAKDRKVAYDPEEAKLKENTTVPKLTLM 57
           MS LQRRR  +  SD      T S+ N+     A+ R+VAYDPEE K++ N +VP+LTLM
Sbjct: 1   MSTLQRRR-KQARSDSVGSSGTDSNDNEPTNRQAESRRVAYDPEEDKIRNNMSVPQLTLM 59

Query: 58  EEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEV 117
           EEV+L+GL+DKEGYLSFWNDNISYALRGCI+IELALR KIR+LDDPARKRF++S+RL+EV
Sbjct: 60  EEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSERLVEV 119

Query: 118 IDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVD 177
           +D SKTGEVLLDEAL +++NDEPL I+NW+DLLSGETWN+ KINYQLKQVRER++KGLVD
Sbjct: 120 VDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLVD 179

Query: 178 KGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKII 237
           KGVLRTEMKNFFLFDMATHP+TD+SCKEAIKRR+LS+LV+R  E  YN+YF E  +FK I
Sbjct: 180 KGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKYI 239

Query: 238 RTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNL 297
           RT+SLIC AYGANVLENVL SL+Y KRD   +RA+E+L QFS++PF L+K TE G S+NL
Sbjct: 240 RTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSINL 299

Query: 298 NKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           N  V+ EI  +P   L LEVVAGVFEVFS+MD LL
Sbjct: 300 NALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  461 bits (1186), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/333 (66%), Positives = 272/333 (81%), Gaps = 5/333 (1%)

Query: 1   MSGLQRRRVNR-TNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEE 59
           MSG+QRRR+NR +N D ++     SD++   +   KVA+DPEEAK+K++ +VPKLTLMEE
Sbjct: 1   MSGVQRRRINRISNEDESDH----SDNDQSRSNVSKVAFDPEEAKIKDDVSVPKLTLMEE 56

Query: 60  VLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVID 119
           V+L+GL D EGYLSFWNDNISY LRGCILIELALR KIR++DD ARK FD+S+RLIEVID
Sbjct: 57  VVLLGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIEVID 116

Query: 120 GSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKG 179
            SKTGEVLLDE L L+KNDEP  I +WIDLLSGETWN  K+NYQLKQVRERL+KGLVDKG
Sbjct: 117 ASKTGEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKG 176

Query: 180 VLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRT 239
           VLRTEMKNFFLFDMATHP+ D+SCKE++KRR++S LV R + L YNEYF E+ TFK+IRT
Sbjct: 177 VLRTEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRT 236

Query: 240 LSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNK 299
           +SLI  AY ANVLENVL +L+Y+KRD+A SRA+ +L  F  +PF L    ++ IS+NLN+
Sbjct: 237 VSLIITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQ 296

Query: 300 EVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
            V+ EI  NP   LQLEV+AGVF+VF++MD ++
Sbjct: 297 LVEDEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  361 bits (927), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 170/306 (55%), Positives = 226/306 (73%), Gaps = 1/306 (0%)

Query: 28  DENAKDRKVAYDPEEAKLKENTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCI 87
           + N K     +DPEE+       +P L LMEE++L+GLKDK+GYLSFWNDNISY LRGCI
Sbjct: 82  NPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCI 141

Query: 88  LIELALRDKIRVLDDPARKRFDVSDRLIEVI-DGSKTGEVLLDEALNLIKNDEPLPIANW 146
           LIELALR KI+V+DDP R  +DVS R+IEV+   +KTG  LLDEALN++  + P  I NW
Sbjct: 142 LIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNW 201

Query: 147 IDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEA 206
           IDLLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE+
Sbjct: 202 IDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKES 261

Query: 207 IKRRVLSVLVSRNMELNYNEYFSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDR 266
           +K+R+ S+LV ++  L YN YF EN+TFKIIR+L LIC AYGA+VL++ L +++YD  D 
Sbjct: 262 VKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDN 321

Query: 267 AFSRADEILAQFSEFPFALDKATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFS 326
           AF +A+++    S+FP  LD+   SG+ V++ K++Q+E+ Q+ G+ L LEVVAGV +V  
Sbjct: 322 AFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVIL 381

Query: 327 RMDTLL 332
           RMD+LL
Sbjct: 382 RMDSLL 387

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  353 bits (907), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 217/276 (78%)

Query: 57  MEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIE 116
           MEEV+L+G++DKEGYLSFWN+N+S+ LRGCILIELA R  I+V+DDP+RKRFD+SDRLIE
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 117 VIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLV 176
           V++  KTGE LLDE L ++K++E   I+ WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 177 DKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKI 236
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+R+LSVL+ +   +  +EYF E +  + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 237 IRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVN 296
           +RT++LI  AY  +VLENV + LDY K+D  F R  EIL Q S +PF  D  + + I+ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 297 LNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           LN+ V+ E++++   +L+LE +AGVFEVF +MD+++
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  222 bits (566), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 185/283 (65%), Gaps = 7/283 (2%)

Query: 52  PKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKR-FDV 110
           P+LTLM+E+ L+ LKDKEGY+S W+  +SY LR C++IELALR KI+ + +  +K+    
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122

Query: 111 SDRLIEVIDGSKTGEVLLDEALNLIKNDEP-LPIANWIDLLSGETWNLLKINYQLKQVRE 169
            +  IEVIDGS TG+ LLD+ L L+K ++    +++WI LLSGE+ N LK +YQL  VR+
Sbjct: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182

Query: 170 RLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFS 229
           R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  ++L   +YF 
Sbjct: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242

Query: 230 ENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKAT 289
           + ++++++RT+ L C AYGA++L+      + ++      RA  +L+ FS+FPF L++A 
Sbjct: 243 DTVSYRVLRTIVLACAAYGADILDKGFFQTE-NETVIGKGRARVLLSLFSKFPFELNQAV 301

Query: 290 ESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332
           +     +LN++V  E+ ++P +  QLEVVAG  +V + +DT+L
Sbjct: 302 QP----DLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)
          Length = 517

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 41/106 (38%), Gaps = 23/106 (21%)

Query: 72  LSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDGSKTGEVLLDEA 131
           L F  DN+    RGC  + +     +R++ D   K+                   +L   
Sbjct: 150 LDFAVDNVPLKARGCTPVAVRATAGLRIIGDAKSKK-------------------ILTAV 190

Query: 132 LNLIKNDEPLPIA-NWIDLLSGE---TWNLLKINYQLKQVRERLAK 173
            N ++ D P PIA   + ++ G+    +  +  NY LK +    AK
Sbjct: 191 TNHLEKDYPFPIAEGSVSIMDGDEEGVFAWITTNYLLKNIGTEGAK 236

>SAKL0E09394g Chr5 complement(782108..784804) [2697 bp, 898 aa] {ON}
           similar to uniprot|P40462 Saccharomyces cerevisiae
           YIL137C RBF108 Hypothetical ORF
          Length = 898

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 19/124 (15%)

Query: 219 NMELNYNEYFSENITFKIIRTL--SLIC--GAYGANVLENVLASL--------DYDKRDR 266
           N++ N   Y   +I  +I++T+  S+I   G    N  E+++  L        D+ K   
Sbjct: 605 NLKKNPQYYHGLSIGLEILQTIERSIITYKGFSSTNSCESIIKPLFKKLSWPEDFSKS-- 662

Query: 267 AFSRADEILAQFSEFPFALDKATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFS 326
             S +   L   S+  FA     E     +L++    +I Q P + + LE+V  VF V S
Sbjct: 663 --SHSHYELEVMSQLLFASKDEQEV---FDLSRRYFKKILQGPNQSIPLEIVGSVFSVVS 717

Query: 327 RMDT 330
           R+ T
Sbjct: 718 RLTT 721

>KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {ON}
           Anc_8.349 YLR143W
          Length = 702

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 67/165 (40%), Gaps = 20/165 (12%)

Query: 146 WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFL----FDMATHPITDT 201
           ++ L+SG   +   I + LKQ  E +A G +       E+ +F      FD+ ++  +  
Sbjct: 3   FVALVSGGKDSFFNILHCLKQGHELIALGNLYPSENEQEIDSFMFQTVGFDIVSYYSSCI 62

Query: 202 SCKEAIKRRVLSVLVSRNMELNYNEY----------FSENITFKIIR----TLSLICGAY 247
           S   AI R  +    S+N++LNY +           F +N+ FK       ++  I  +Y
Sbjct: 63  SKTIAIHRWPIVKNTSKNVKLNYTQTQDDEIEQLFEFLKNLQFKYPELEAVSVGAILSSY 122

Query: 248 GANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESG 292
             N +ENV   L        + R    L   +E  F      E+G
Sbjct: 123 QRNRVENVCNRLGLSVLSYLWQRNQ--LELMTEMAFMSKSGDETG 165

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 7/68 (10%)

Query: 101 DDPARKRFDVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSG-ETWNLLK 159
           D  A K  D++D   + +D SK    +LDE L L+ N++PL +  ++  +   +TW   K
Sbjct: 729 DSLASKIRDLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKLKTWE--K 782

Query: 160 INYQLKQV 167
           IN  LK +
Sbjct: 783 INAFLKSI 790

>Skud_15.482 Chr15 complement(842032..843042) [1011 bp, 336 aa] {ON}
           YOR313C (REAL)
          Length = 336

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 258 SLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300
           +LDY+   RA S A   +A  ++ PFA    T +  + NL+K+
Sbjct: 244 ALDYNFMTRALSAASHQVADVAKLPFAYGYHTNTVYNKNLDKQ 286

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,381,841
Number of extensions: 1512043
Number of successful extensions: 5525
Number of sequences better than 10.0: 40
Number of HSP's gapped: 5672
Number of HSP's successfully gapped: 40
Length of query: 332
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 222
Effective length of database: 40,868,139
Effective search space: 9072726858
Effective search space used: 9072726858
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)