Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02684g5.441ON53953927240.0
Kpol_1062.255.441ON53347113191e-177
ZYRO0F10186g5.441ON51945212931e-174
TDEL0D026005.441ON52346812361e-165
TPHA0E017205.441ON53749212181e-162
NDAI0B057105.441ON56348112081e-160
NCAS0F034205.441ON52549911831e-157
TBLA0A027905.441ON54749411781e-156
CAGL0A02904g5.441ON50145311501e-152
KLTH0F15906g5.441ON51546511381e-150
Kwal_55.214025.441ON51648811271e-149
KAFR0E038105.441ON49046410951e-144
KLLA0E02333g5.441ON48045210831e-142
KNAG0C048705.441ON45845810751e-142
Smik_4.6375.441ON51150710481e-137
Suva_2.5435.441ON51148610391e-135
YDR371W (CTS2)5.441ON51146310301e-134
Ecym_45125.441ON52749010291e-134
Skud_4.6405.441ON51146310041e-130
ACL166W5.441ON4904769651e-125
Skud_4.232.38ON112564800.45
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02684g
         (539 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...  1053   0.0  
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   512   e-177
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   502   e-174
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   480   e-165
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   473   e-162
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   469   e-160
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   460   e-157
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   458   e-156
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   447   e-152
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   442   e-150
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   438   e-149
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   426   e-144
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   421   e-142
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   418   e-142
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   408   e-137
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   404   e-135
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   401   e-134
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   400   e-134
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   391   e-130
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   376   e-125
Skud_4.23 Chr4 complement(36009..39386) [3378 bp, 1125 aa] {ON} ...    35   0.45 

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score = 1053 bits (2724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/539 (94%), Positives = 507/539 (94%)

Query: 1   MSVHFASIITVSFTLKEVTMQWKRSLTFQXXXXXXXXXXXXXEMSVFFGTLKGRATQKFK 60
           MSVHFASIITVSFTLKEVTMQWKRSLTFQ             EMSVFFGTLKGRATQKFK
Sbjct: 1   MSVHFASIITVSFTLKEVTMQWKRSLTFQTFLICLLTSLLFLEMSVFFGTLKGRATQKFK 60

Query: 61  QIYSDMNSNDNNQNLQEEVGPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVF 120
           QIYSDMNSNDNNQNLQEEVGPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVF
Sbjct: 61  QIYSDMNSNDNNQNLQEEVGPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVF 120

Query: 121 YSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCI 180
           YSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALL      TFQSHKKEMLPMGCI
Sbjct: 121 YSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLSSSSSSTFQSHKKEMLPMGCI 180

Query: 181 GELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETM 240
           GELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETM
Sbjct: 181 GELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETM 240

Query: 241 FQYGFDGLDIDWEFPQNDGLEPKMYLTMIXXXXXXXXXXXXXIFQDEHHSEHFFLTVAVP 300
           FQYGFDGLDIDWEFPQNDGLEPKMYLTMI             IFQDEHHSEHFFLTVAVP
Sbjct: 241 FQYGFDGLDIDWEFPQNDGLEPKMYLTMIRRLREALDDLERDIFQDEHHSEHFFLTVAVP 300

Query: 301 AFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEEN 360
           AFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEEN
Sbjct: 301 AFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEEN 360

Query: 361 QLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGE 420
           QLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGE
Sbjct: 361 QLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGE 420

Query: 421 PGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGF 480
           PGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGF
Sbjct: 421 PGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGF 480

Query: 481 WWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQGFLSRVFKG 539
           WWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQGFLSRVFKG
Sbjct: 481 WWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQGFLSRVFKG 539

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  512 bits (1319), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 249/471 (52%), Positives = 319/471 (67%), Gaps = 27/471 (5%)

Query: 83  SNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDF 142
           +N    Y  GVYY+NWSPY PR H PHDM+F R+T+V+Y+FFVVD K+G + +SD WSDF
Sbjct: 58  NNPDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDF 117

Query: 143 QMDLYKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHR 202
           +MD YK    + K   L       F    K  LPMGCIGELFYL++S +  S +     R
Sbjct: 118 EMDCYKPLAMKLKKLQLDHFFNPKF----KNGLPMGCIGELFYLRHSQLFDSNNS----R 169

Query: 203 NFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEP 262
            FK+ MSVGGWSNR+AFP ++RD  K D F+ +C+E MF YGFDG+++DWEFP++D LEP
Sbjct: 170 KFKLIMSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEP 229

Query: 263 KMYLTMIXXXXXXXXXXXXXIFQDEHHSEH-----FFLTVAVPAFKEKLQVLPLRDMDAY 317
           KMYL ++             IF +  +  H     F L++A PAFKEKL +L +R+MD Y
Sbjct: 230 KMYLELVKKLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHY 289

Query: 318 VDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEE-------------NQLNA 364
           VD WN+M YDYHGEWSE TGYHSNLYS            D +             + LN 
Sbjct: 290 VDVWNMMTYDYHGEWSEKTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNG 349

Query: 365 DSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGEPGMW 424
           D A+ Y++K + IN +K+ LGMAAYGRGFT+V  ++    +I KPY GVGGASEGEPGMW
Sbjct: 350 DYAINYVIKKYHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMW 409

Query: 425 LYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWES 484
           LYNQLP+  +LE FDP  VSA+ +D KSKTFVGYDN DSM+ KAQYVK HNL GGFWWES
Sbjct: 410 LYNQLPIKNSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWES 469

Query: 485 CGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNY-PQGFLS 534
           CGD+HK+ +KSLLNAFT+++GS+ ++  +++T+  V++YYLK     GFLS
Sbjct: 470 CGDDHKNPEKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLS 520

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  502 bits (1293), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/452 (52%), Positives = 318/452 (70%), Gaps = 13/452 (2%)

Query: 87  QSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDL 146
           + Y SG+YY++WSPY PR HFPHD++F ++++++Y+FF++D  +G +KSSDEWSDFQMDL
Sbjct: 66  EGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDL 125

Query: 147 YKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKV 206
           YK    +     L              +LP GC+GELFYL+++ IL    G    R+FKV
Sbjct: 126 YKPLAVKLNQLQLKNDDVHASMG----VLPKGCVGELFYLRHTGILDRDKG----RHFKV 177

Query: 207 SMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYL 266
            M+VGGWSNRD +P +VRD  + + FI +CVETMF+YGFDG+D+DWEFPQNDG EP+MYL
Sbjct: 178 MMAVGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYL 237

Query: 267 TMIXXXXXXXXXXXXXIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAY 326
            +              IF  E +   F L++A PAFK+KL VLP++++D Y+D WN+M Y
Sbjct: 238 ELARKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTY 297

Query: 327 DYHGEWSELTGYHSNLYSEDSNHVHRRHFRD---EENQLNADSAVKYLLKNFGINSRKVV 383
           DYHGEWS +TGYH NLY +    VH ++  D   ++  L+A+SA+  ++  FG++SRK+ 
Sbjct: 298 DYHGEWSPVTGYHCNLY-DGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKIT 356

Query: 384 LGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSV 443
           LGMAAYGRGFT VK ++N   +I K ++GVGGASEGEPGMWLYNQLP+ G+ E +DP  V
Sbjct: 357 LGMAAYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYV 416

Query: 444 SAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTND 503
           S + FD K+KTFVGYDNV+S++ KA YVK   L GGFWWESCGDNH D Q+SLLNAFT  
Sbjct: 417 SGFCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGR 476

Query: 504 LGSLAKQQPSIYTSAHVIRYYLKNYPQG-FLS 534
           + ++AK + S+Y     +RYYL+ + Q  FLS
Sbjct: 477 IKTIAKNENSVYHKPEALRYYLEKFGQDEFLS 508

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  480 bits (1236), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 227/468 (48%), Positives = 315/468 (67%), Gaps = 26/468 (5%)

Query: 73  QNLQEEVGPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGT 132
           Q  Q    P + +   Y+SG+YY+NWSPY+PR HFPHD++  R+++++Y+FF+VD  +G 
Sbjct: 48  QQAQLVTNPGTVEPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGA 107

Query: 133 VKSSDEWSDFQMDLYK-------KFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFY 185
           +K  DEWSD  MDLYK       K  P+ K  L            ++ +LP GC+GELFY
Sbjct: 108 LKLGDEWSDVGMDLYKPMAIKLNKLNPEVKNDL----------ERQRRILPNGCLGELFY 157

Query: 186 LKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGF 245
           ++ +++ P+ +     R+FKV M VGGWSNR+ FP +VR+  + D FI +C+ETMF+YGF
Sbjct: 158 MRNANLFPNRN----IRDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGF 213

Query: 246 DGLDIDWEFPQNDGLEPKMYLTMIXXXXXXXXXXXXXIFQDEHHSEHFFLTVAVPAFKEK 305
           DG+D+DWEFP++DG EP+MYL +              IF    +   F L++A PAF EK
Sbjct: 214 DGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEK 273

Query: 306 LQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDS---NHVHRRHFRDEEN-- 360
           L +LP+ +MD Y+D WN+M YDYHGEWSE TGYH NLY+  +   +  H++H    E+  
Sbjct: 274 LDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVE 333

Query: 361 QLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGE 420
            L+A SA++++L   G+NS K+ LGMAAYGRGFT V   +    +I KP++GVGGAS+GE
Sbjct: 334 GLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGE 393

Query: 421 PGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGF 480
           PGMWLYNQLP+ GT E FDP  VS + +   SKTFVGYD+V+S+R KAQYV+  NLAGGF
Sbjct: 394 PGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGF 453

Query: 481 WWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNY 528
           WWESCGD+H ++ +SLLNAFTN++  ++K    +Y    V+RYY+  +
Sbjct: 454 WWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNKF 501

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  473 bits (1218), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 240/492 (48%), Positives = 331/492 (67%), Gaps = 17/492 (3%)

Query: 54  RATQKFKQIYSDMNSNDNNQN--LQEEVGPASNDSQS--YISGVYYTNWSPYAPRNHFPH 109
           R   K   I S++N +D   +  ++ E    +N +++  Y  GVYY+NWSPY+PR  FPH
Sbjct: 39  RFDAKPGNISSELNQHDREYDPIMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPH 98

Query: 110 DMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLXXXXXXTFQS 169
           D++  R+++V+YSF +VD   GT+KSSD WSDFQ+D+YK  Y       +         S
Sbjct: 99  DIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYKPLY--LSLGQVDNDFDSVPIS 156

Query: 170 HKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKF 229
            KKE+LPMGCIGE FYL+ + I   +HG     +FKV MSVGGWSNR+AFP +VRD  K 
Sbjct: 157 MKKELLPMGCIGEFFYLRNTRI--PIHGPK-STDFKVFMSVGGWSNREAFPKMVRDPQKV 213

Query: 230 DTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIXXXXXXXXXXXXXIFQD--E 287
           D FI +C++TMF YGFDG+D+DWEFP++DG EP MYL +I             I++D   
Sbjct: 214 DKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLKMKMLELEATIYKDAIS 273

Query: 288 HHSE--HFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYS- 344
           H++   HF L++A PAF EKL++LP++ MD +VD WN+M YDY GEWS++TGYHSNL+S 
Sbjct: 274 HNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSP 333

Query: 345 -EDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSG 403
            + S  V +R   +    L  D+AVKY+  N  I+SRK++LGMAAYGRGF+ V  +  +G
Sbjct: 334 PDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMAAYGRGFSGVSKSKTNG 393

Query: 404 SYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDS 463
              GK +NGV G+S  EPG+WLYN+LP+ G+ E FD  SVSAY +DPKSK FV YDN  S
Sbjct: 394 KLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQS 453

Query: 464 MRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRY 523
           M  K++YV+++NL GGF WE+CG+   + + SL+N+FT D+ ++ KQ+ S++++  V+ Y
Sbjct: 454 MVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFDMNNIDKQK-SMFSNRKVLEY 512

Query: 524 YLKNY-PQGFLS 534
           YL  Y  QGFLS
Sbjct: 513 YLMKYGKQGFLS 524

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  469 bits (1208), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 237/481 (49%), Positives = 314/481 (65%), Gaps = 43/481 (8%)

Query: 86  SQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMD 145
           + +++SGVYY++WSPY PR HFPHD++  +IT+V+YSFF+V+  +G V  SDEWSD +MD
Sbjct: 90  NNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMD 149

Query: 146 LYKKFYPQFKAALLXXXXXXTFQSHK----------KEMLPMGCIGELFYLKYSSILPSL 195
           LYK      K   L          +K          K+ LP+GC+GELFYLK        
Sbjct: 150 LYKPL--SLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK-------- 199

Query: 196 HGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFP 255
                 +NFK+ MS+GGWSNR+ FP +VRD NK + FI + VE MF+YGFDG+D+DWEFP
Sbjct: 200 ----KFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFP 255

Query: 256 QNDGLEPKMYLTMIXXXXXXXXXXXXXIFQD----------EHHSEHFFLTVAVPAFKEK 305
           ++DG EP  YL ++             IFQ           ++H   F L+VA PAF EK
Sbjct: 256 EDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEK 315

Query: 306 LQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQ---- 361
           L +LP+++M+ Y+D+WN+M YDY+G+WSE TGYH NLY   +N      ++ E       
Sbjct: 316 LNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKG 375

Query: 362 LNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGEP 421
           LNA+ A+ Y+L N  ++SRK+VLG+AAYGRGFT+VK   N   +I K ++GVGGAS GEP
Sbjct: 376 LNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEP 435

Query: 422 GMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFW 481
           GMWLYNQLP+  + E FDP  VSA+ +DPK+KTFVGYDNVD+M+ KA+YV++ +LAGGFW
Sbjct: 436 GMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFW 495

Query: 482 WESCGDNHKDEQKSLLNAFTNDL--GSLAKQQPS--IYTSAHVIRYYLKNYPQ-GFLSRV 536
           WESCGD+HK  ++SLLNAFTN L    L K + S  IY     I+YYL  +   GFLS  
Sbjct: 496 WESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPF 555

Query: 537 F 537
           F
Sbjct: 556 F 556

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  460 bits (1183), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 235/499 (47%), Positives = 315/499 (63%), Gaps = 23/499 (4%)

Query: 52  KGRATQKFKQIYSDMNSNDNNQNLQEEVGPA-SNDSQSYISGVYYTNWSPYAPRNHFPHD 110
           K +ATQ   Q +    +  N Q +   +    SN  + Y+SG+YY++WSPY PR HFPHD
Sbjct: 36  KQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKGYLSGLYYSSWSPYKPRFHFPHD 95

Query: 111 MNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLXXXXXXTFQSH 170
           ++  R+++++Y+FF+VDPK+G +  SDEWSD QMDLYK    +     L        Q  
Sbjct: 96  IDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNLNLADNEKPV-QLR 154

Query: 171 KKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFD 230
            K  LP+GCIGELFYLK+S I+P         + K+ +S+GGWSNRD FP +VRD  KF+
Sbjct: 155 DKRKLPLGCIGELFYLKHSGIIPG------GSSTKMILSIGGWSNRDRFPGLVRDTRKFE 208

Query: 231 TFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIXXXXXXXXXXXXXIFQDEHHS 290
            FI + VETMF+YGFDG+D+DWEFP++DGLEP  YL MI             IF +    
Sbjct: 209 NFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIFGETKDH 268

Query: 291 EHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSN-- 348
             F L+VA PAF  KL +LP+  MD YVD+WN+M YDY+G WSE TGYH NL++ D +  
Sbjct: 269 PKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFNGDGSEF 328

Query: 349 -----HVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSG 403
                H H  H     N LNA+ A+ +++K+  + S KVVLGMAAYGR F  VK+     
Sbjct: 329 RAGYKHEHTAH----NNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQGVD 384

Query: 404 SYIGKPYNGVGGASEG-EPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVD 462
           + I + + GVG    G EPGMWLYNQLPL GT+E +DP   +A+ +D KS+TF+GYDNVD
Sbjct: 385 TLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSETFIGYDNVD 444

Query: 463 SMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAK--QQPSIYTSAHV 520
           S++ KAQYV+   L GGFWWESCGD+H ++++SLL  F+N++  + K   Q  I+     
Sbjct: 445 SVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQDLIFRRKEC 504

Query: 521 IRYYLKNY-PQGFLSRVFK 538
           I YYL  Y   GFLS + +
Sbjct: 505 IAYYLNRYGTDGFLSGILQ 523

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  458 bits (1178), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 226/494 (45%), Positives = 317/494 (64%), Gaps = 31/494 (6%)

Query: 66  MNSNDNNQNLQEEVGPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFV 125
           +N+ DN     +       + Q Y SGVYY+NWSPY+PR HFPHD++F RI++V+YSFF+
Sbjct: 54  LNNVDNEIKDNKNTNLTVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFL 113

Query: 126 VDPKSGTVKSSDEWSDFQMDLYKKF---YPQFKAALLXXXXXXTFQSHKKEMLPMGCIGE 182
           V+  +G V+  D+WSD +MDLYK       + K  +       T QS  K  LP GCIGE
Sbjct: 114 VNGDNGKVELGDKWSDIEMDLYKPLSIKLGKLKNKVDVYEEPQT-QSTIKTNLPKGCIGE 172

Query: 183 LFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQ 242
            FYL+ S +LP+++ +   +NFK+ M++GGWSNRD+FP + +   K   F+ + +E MF+
Sbjct: 173 FFYLRNSKLLPTINTEN-SKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFE 231

Query: 243 YGFDGLDIDWEFPQNDGLEPKMYLTMIXXXXXXXXXXXXXIFQDE----HHSEHFFLTVA 298
           YGFDG+D+DWEFP+N+  EP +YL ++             I+++        +HF L+VA
Sbjct: 232 YGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVA 291

Query: 299 VPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDE 358
            PAF+EKL VLP+++M+  +D+WN+M YDY+GEWSE TGYHSNLY  D + V     + +
Sbjct: 292 SPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLY--DGSKV-----KHD 344

Query: 359 ENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSG--------------S 404
           E  LNADSA+KY+++  G+   K+VLG+A YGRG+T V      G               
Sbjct: 345 EEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEV 404

Query: 405 YIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSM 464
           +I   Y GVGG SEGEPGMW+YNQLP+ G++E FDP+ VSAY +D K+ T V YDNV+SM
Sbjct: 405 FIDLEYKGVGGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESM 464

Query: 465 RCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYY 524
             K QYVK+  LAGGF WESCGD H + ++SL+ AFTN+LG + KQ+ SI+       +Y
Sbjct: 465 NVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFY 524

Query: 525 LKNYP-QGFLSRVF 537
           L+ +  +G+LS   
Sbjct: 525 LEEFGNEGYLSEAI 538

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  447 bits (1150), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 302/453 (66%), Gaps = 14/453 (3%)

Query: 88  SYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLY 147
           SYI+G+YY+NWSPY PR HFPHD++F ++++++Y+F ++DP++G + SSDEWSD Q++L 
Sbjct: 55  SYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLA 114

Query: 148 KKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVS 207
           K    Q +  +         ++      P GCIGEL YL+Y      ++     RN K+ 
Sbjct: 115 K----QCREYMFKRFTGDELKAVTNIRAPPGCIGELNYLRY------IYSKIKKRNVKLI 164

Query: 208 MSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLT 267
           MSVGGWSNR++FPI+VRD+ KF  FI +C+ETM  YGFDG+D+DWEFP++D  EP  YL 
Sbjct: 165 MSVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLR 224

Query: 268 MIXXXXXXXXXXXXXIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYD 327
           M              I  D H ++ F L++A PAFK+KL +LP+  +D Y+D WNLM YD
Sbjct: 225 MARELKLQLQKLEANILGD-HSNKTFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYD 283

Query: 328 YHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGMA 387
           Y+GEWSE TG H+NLY+E    +H  H  DE+  L+ D+A+ Y++    I+ RKV+LGMA
Sbjct: 284 YYGEWSERTGLHANLYNEKGKLLHL-HRHDEDAGLSGDAAINYMVNRCKIDPRKVILGMA 342

Query: 388 AYGRGFTRVKT-TANSGSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVSAY 446
           AYGRGFT V   + N  +  G  ++GVGGASEGEPGMWLYNQLP+PG+ E +D R V AY
Sbjct: 343 AYGRGFTNVDMKSTNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGAY 402

Query: 447 SFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGS 506
            +D ++ T VGYDN  S+  KA Y+ +++L G FWWESCGD HK+ ++SLLN +   + +
Sbjct: 403 CYDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRN 462

Query: 507 LAKQQPSIYTSAHVIRYYLKNY-PQGFLSRVFK 538
           +   + +IY++  +  YYL+NY   GFL+   K
Sbjct: 463 VKNNKETIYSTTKLHDYYLENYDTNGFLTGFIK 495

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  442 bits (1138), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 220/465 (47%), Positives = 302/465 (64%), Gaps = 16/465 (3%)

Query: 79  VGPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDE 138
            G ++++   +++G+YY+NWSPYA R HFPHD++F ++T+V+Y+F VV+ ++G  + SDE
Sbjct: 61  TGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDE 120

Query: 139 WSDFQMDLYKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGD 198
           WSD QMDLYK+    FK   L       F +  K+ LP+GCIGELF+LKYS+ L    G 
Sbjct: 121 WSDVQMDLYKQMISSFKKLDLRAQ----FPTGSKDKLPLGCIGELFFLKYSNFLTRNGGS 176

Query: 199 GVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQND 258
               NFK  MSVGGWSNR+AF  +V    K + F+ +CV  MF+YGFDG+DIDWEFP+ND
Sbjct: 177 AGVNNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKND 236

Query: 259 GLEPKMYLTMIXXXXXXXXXXXXXIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYV 318
             EPK+YL M+             IF  + H  HF LT A+ A +E L+ LPL++ D YV
Sbjct: 237 AKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYV 296

Query: 319 DFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGIN 378
           D+WNLMAYD+ G WS  T Y SNLY+       + + R    + +AD AV++L     + 
Sbjct: 297 DYWNLMAYDFSGAWSAQTAYQSNLYTP-----AKTNKRSTNGRGSADKAVRFLTDKSKLA 351

Query: 379 SRKVVLGMAAYGRGFTRVKTTANS-GSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLEN 437
           S+K+VLGM AYGRGF  V+ +  S  + IGKP+  V G+SEGE G+ LY QLPL G +E 
Sbjct: 352 SKKIVLGMPAYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEF 411

Query: 438 FDPRSVSAY----SFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQ 493
           FD  +VSAY    S + K    + YDNVDSM  KA YV+ ++L GGFWWESCG+++K   
Sbjct: 412 FDHNAVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG-- 469

Query: 494 KSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQGFLSRVFK 538
           KSL+ AFT ++  L K +P+IY+   V+++YLK +P GFL+  F+
Sbjct: 470 KSLVGAFTKEIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTFQ 514

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  438 bits (1127), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 231/488 (47%), Positives = 296/488 (60%), Gaps = 21/488 (4%)

Query: 55  ATQKFKQIYSDMNSNDNNQNLQEEVGPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFH 114
           A  + +++ S +   DN+  +  E G          SG+YY+NWSPY  R HFPHD++F 
Sbjct: 45  AIARSEKMQSTVKDKDNSLLISSERG--------LTSGIYYSNWSPYKARKHFPHDIDFR 96

Query: 115 RITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLXXXXXXTFQSHKKEM 174
           R+T VFYSF VV+ ++G  + SDEWSD QMDLYK+ +  F+   L       F    +  
Sbjct: 97  RLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQMFSAFEKVDLKR----QFPQSSRND 152

Query: 175 LPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIR 234
           LP+GCIGELFYLKY+  L  + G    +NFK  MSVGGWSNR+AF  +V+   K   FI 
Sbjct: 153 LPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGWSNREAFESLVQSPAKMKVFIN 212

Query: 235 TCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIXXXXXXXXXXXXXIFQDEHHSEHFF 294
           +CV+ MF+YGFDG+DIDWEFP+ND  EPK YL M+             IF  E H++HF 
Sbjct: 213 SCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLRKKLDDLESDIFGTEKHTQHFL 272

Query: 295 LTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRH 354
           LT A+ A    L+ LPL ++D YVD WNLMAYD+ G WS  T Y SNLYS  S  + +R 
Sbjct: 273 LTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWSRHTAYQSNLYSRSS--LGKRS 330

Query: 355 FRDEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSG-SYIGKPYNGV 413
              E    +AD+AV+ LL    + ++K+VLGM AYGRGF  V    +S  + IG+ +  V
Sbjct: 331 ENSEGG--SADTAVRLLLNKHKLPAKKIVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQV 388

Query: 414 GGASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKT----FVGYDNVDSMRCKAQ 469
            G SEGE G+ LYNQLPL G  E FD  +VSAYS    S       V YDNV SM+ KAQ
Sbjct: 389 SGLSEGESGISLYNQLPLKGGQEWFDQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQ 448

Query: 470 YVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYP 529
           YV  +NL GGFWWESCG+N+ D  +SL  AFT ++  L K  P+IY    V  YY K YP
Sbjct: 449 YVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKYP 508

Query: 530 QGFLSRVF 537
            GFL+ + 
Sbjct: 509 DGFLASII 516

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  426 bits (1095), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 213/464 (45%), Positives = 298/464 (64%), Gaps = 47/464 (10%)

Query: 86  SQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMD 145
           ++S+  G+YY+NWS Y PR HFPH++NF  I++V+Y+FF+VD K+G + S D+W+DFQ  
Sbjct: 55  NRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRP 114

Query: 146 LYKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFK 205
           + K                          L  G +GELF LK            +    K
Sbjct: 115 ILKN-----------------------NKLVKGNVGELFDLK------------MKNRVK 139

Query: 206 VSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMY 265
             M +GGWSNR+A+ I   D +K ++F    V+ MF+YGFDG+D+DWE+P++DG+EP++Y
Sbjct: 140 CIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLY 199

Query: 266 LTMIXXXXXXXXXXXXXIFQDEHHSEHFF-LTVAVPAFKEKLQVLPLRDMDAYVDFWNLM 324
           L ++             IF+D   +  +F L+VA PAFK+KL++ PL++MD  +D+WN+M
Sbjct: 200 LEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMM 259

Query: 325 AYDYHGEWSELTGYHSNLY--SEDSNHVHR--RHFRDEENQLNADSAVKYLLKNFGINSR 380
            YDY+GEWSE TGYHSNLY  S+ S  +    RH   E   LN D AVKY++ N GI   
Sbjct: 260 TYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMI-NQGIKKD 318

Query: 381 KVVLGMAAYGRGFTRVKTTA----NSGSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLE 436
           K++LGMAAYGRGFT V         S  YIG+ ++GVGGASEGEPGMW Y+QLP+PGT+E
Sbjct: 319 KIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVE 378

Query: 437 NFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSL 496
            FDPR VS Y F+P + TFVGYD +DS+R K QY+K  ++ GGFWWESCGD HK+ ++SL
Sbjct: 379 QFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSL 438

Query: 497 LNAFTNDLGSLAKQQP-SIYTSAHVIRYYLKNY-PQGFLSRVFK 538
           +NA+  +LG    ++P SIY + H + +Y +++  +GFLS+  K
Sbjct: 439 VNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYLK 482

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  421 bits (1083), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 216/452 (47%), Positives = 288/452 (63%), Gaps = 47/452 (10%)

Query: 92  GVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFY 151
             YY+NWSPY  RNH P D+   ++T+V+Y+FFVVD KSG VKSSD WSDF++ L     
Sbjct: 69  ATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPL----- 123

Query: 152 PQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVG 211
                                 +   GCI EL  +K  S             FK  + +G
Sbjct: 124 ---------------------SVGVKGCIKELQKIKLES----------KHEFKTILCLG 152

Query: 212 GWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIXX 271
           GWSNR+A+  I + + K   FI T V+ MF+YGFDG+D+DWEFP+ D  EP +YL M+  
Sbjct: 153 GWSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRG 212

Query: 272 XXXXXXXXXXXIF---QDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDY 328
                      IF    +E    HF L+VA PAF EKL +LP+ +M  YVD WN+M YD+
Sbjct: 213 IREGMDQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDF 272

Query: 329 HGEWSELTGYHSNLYSEDSNHVHRRHF--RDEENQLNADSAVKYLLKNFGINSRKVVLGM 386
           HGEWS++TGYHSNLY +   H HRR    R   + L++D+AVK +     I+SR++ LGM
Sbjct: 273 HGEWSDVTGYHSNLYLQ--GHSHRRSLSNRISNSSLSSDTAVKLMTDRHNISSRRIALGM 330

Query: 387 AAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVSAY 446
           AAYGRGFT V+T  N  +Y+GK Y+GVGG SEGEPG+WLYNQLP+ G+ E FD  +VSAY
Sbjct: 331 AAYGRGFTNVET--NDDNYLGKKYHGVGGGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAY 388

Query: 447 SFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGS 506
            FDPKS+TFVGYDNV SM  K +Y+K  NL GGFWWESCGD+ KD +KSL+NAF+ ++G 
Sbjct: 389 CFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIG- 446

Query: 507 LAKQQPSIYTSAHVIRYYLKNYPQGFLSRVFK 538
           L++   S++ S  V +++L+ YP+ ++S +F+
Sbjct: 447 LSEGFVSLFKSDKVKQFHLQKYPKDYISSLFQ 478

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  418 bits (1075), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 212/458 (46%), Positives = 286/458 (62%), Gaps = 48/458 (10%)

Query: 84  NDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQ 143
           N +Q Y+SGVYY++WSPY PR HFP +++  +IT+++YSFF+VD  S  +K  D WSD +
Sbjct: 46  NVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIE 105

Query: 144 MDLYKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRN 203
           M       P  K  +L                  GCIG L  L+                
Sbjct: 106 M-------PMGKNTVLK-----------------GCIGALNSLRDEK-----------PG 130

Query: 204 FKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPK 263
           FK  M+VGGWSN+DAFP+ +R K+  +   ++CVETMFQYGFDG+D+DWE+P++DG EP+
Sbjct: 131 FKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPR 190

Query: 264 MYLTMIXXXXXXXXXXXXXIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNL 323
           +YL ++             I+ D+     F L+VA PAF +KL+  P+++MD Y+D+WN+
Sbjct: 191 IYLELMRKIRQHMNELEIAIWGDK--KRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNM 248

Query: 324 MAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVV 383
           M YDY+GEWS  TG+HSNLY   +           E+ L AD A++Y+    GINSRKVV
Sbjct: 249 MTYDYYGEWSSGTGFHSNLYDGTNKF--------SEHSLCADGAIRYMTNKIGINSRKVV 300

Query: 384 LGMAAYGRGFTRVKT--TANSGSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPR 441
           LGMA YGRGFT VK      +   I + + GVGG SEGEPGMWLYNQLP+ GT E FD +
Sbjct: 301 LGMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQ 360

Query: 442 SVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFT 501
             SAY FDPK+KT VGYDNVDS R KAQYV+ HNLAGGFWWESCG+   + Q+SL++ F 
Sbjct: 361 YGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFN 420

Query: 502 NDLGSLAKQQPSIYTSAHVIRYYLKNYPQ-GFLSRVFK 538
            D+  L + + ++Y    +  +YL+ + + GFL+  FK
Sbjct: 421 EDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK 458

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  408 bits (1048), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 205/507 (40%), Positives = 312/507 (61%), Gaps = 43/507 (8%)

Query: 43  EMSVFFGTLKGRATQKFKQIYSDMNSNDNNQNLQEEVGPASNDSQSYISGVYYTNWSPYA 102
           EM ++    K + + K +  ++  N      N+ +  GP + D + ++SGVYY+NWSPY 
Sbjct: 30  EMCLYKKIFKNQRSNKIRDSFN--NGGHKVPNMDQTQGP-NVDGEGFVSGVYYSNWSPYK 86

Query: 103 PRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLXXX 162
           PR HFPHD+N  ++++V+Y+FF ++P++G ++S+D WSD +M+LYK    +  + L+   
Sbjct: 87  PRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIK-SSELIDGN 145

Query: 163 XXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPII 222
                Q    ++LP+GCIGELFYLK+S            + FKV MS+GGWS+ + F +I
Sbjct: 146 SSNDIQ----KILPLGCIGELFYLKHSC---------SGKKFKVIMSIGGWSDSENFKVI 192

Query: 223 VRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIXXXXXXXXXXXXX 282
           ++++N    F+ + VETMF+ GFDG+D+DWEFP+N+  EP+ YL ++             
Sbjct: 193 IKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQ 252

Query: 283 IFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNL 342
           IF  E   +HF L++A PAFK+KL  LP+ ++D Y+D+WN+M YDY+G WSE TGYHSNL
Sbjct: 253 IF-GEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNL 311

Query: 343 YSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGF----TRVKT 398
           +SE               +L+ + A+ Y++  FGINSRK+VLGMAAYGR F    +  + 
Sbjct: 312 FSE--------------TELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQP 357

Query: 399 TANSGSYIGKPYNGVG------GASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKS 452
              +   I + + GVG        ++G+ G+W Y  LP  GT+E +DP+ VSAY FD K+
Sbjct: 358 FTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKN 417

Query: 453 KTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQP 512
             F+ YDN  S++ KA+YV ++ L GGFWWESCG+ + +E +SL++AF   L S    +P
Sbjct: 418 SIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKP 477

Query: 513 SIYTSAHVIRYYLKNYP-QGFLSRVFK 538
           S++ +  V+ +YL  Y   GFL+   K
Sbjct: 478 SMFENERVVNFYLNKYGNNGFLTPYLK 504

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  404 bits (1039), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 207/486 (42%), Positives = 294/486 (60%), Gaps = 45/486 (9%)

Query: 70  DNNQNLQEEV------GPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSF 123
           DN QN + +V         S D   Y+SGVYY+NWSPY PR HFPHD+N  ++++V+Y+F
Sbjct: 48  DNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAF 107

Query: 124 FVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGEL 183
           F +DPK+G + S+D WSD +MDLYK      KA+ L         ++ + +LP+GCIGEL
Sbjct: 108 FRIDPKTGCIGSTDSWSDLEMDLYKPL--AIKASQLVDDNLD--DNNMQSILPLGCIGEL 163

Query: 184 FYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQY 243
           FYLK +            R FK  MS+GGWS+ + F  IV+++     F+ + VETMF+ 
Sbjct: 164 FYLKNAC---------SGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKL 214

Query: 244 GFDGLDIDWEFPQNDGLEPKMYLTMIXXXXXXXXXXXXXIFQDEHHSEHFFLTVAVPAFK 303
           GFDG+DIDWEFP+N+ +EP+ YL ++             IF      +HF L++A PAFK
Sbjct: 215 GFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGST-KDHFELSIAAPAFK 273

Query: 304 EKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLN 363
           +KL  LP+ ++D Y+D WN+M YDY+G WSE TGYHSNL+SE               +L+
Sbjct: 274 DKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSE--------------TELS 319

Query: 364 ADSAVKYLLKNFGINSRKVVLGMAAYGRGF----TRVKTTANSGSYIGKPYNGVG----- 414
            + A+ Y++  FG+N RK+VLGMAAYGR F     + +    +   I + + GVG     
Sbjct: 320 GNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKNTVLINQQFKGVGKPGKE 379

Query: 415 -GASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKN 473
              ++G+ G+W Y  LP  GT E +DP+ VSAY FD K+  F+GYDN +S++ KA YV +
Sbjct: 380 IDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDNTESIKTKADYVMH 439

Query: 474 HNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQ-GF 532
             L GGFWWESCG+++ D+ +SL+NAF   L      +PS++    V++YYL  Y   GF
Sbjct: 440 TELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDKRVMKYYLSKYGDGGF 499

Query: 533 LSRVFK 538
           L+   K
Sbjct: 500 LAPYLK 505

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  401 bits (1030), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 199/463 (42%), Positives = 289/463 (62%), Gaps = 40/463 (8%)

Query: 87  QSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDL 146
           +++ISGVYY+NWSPY PR HFPHD+N  ++++++Y+FF ++ ++G ++++D WSD +M+L
Sbjct: 71  EAFISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNL 130

Query: 147 YKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKV 206
           YK    +  + L+      + Q+    +LP+GCIGELFYLK +            + FKV
Sbjct: 131 YKSLAIK-NSELIKESSNNSVQN----ILPLGCIGELFYLKNTC---------SDKKFKV 176

Query: 207 SMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYL 266
            MS+GGWS+ + F II++D      F+ + VETMF+ GFDG+D+DWEFP N+  EP+ YL
Sbjct: 177 IMSIGGWSDSENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYL 236

Query: 267 TMIXXXXXXXXXXXXXIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAY 326
            ++             IF  +   +HF L++A PAFK+KL  LP+ ++D YVD+WN+M Y
Sbjct: 237 KLVRMLRLKLNSLESQIF-GKRTEDHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTY 295

Query: 327 DYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGM 386
           DY+G WSE TGYHSNL+SE               +LN + A+ Y++  FG+NSRK+VLGM
Sbjct: 296 DYYGSWSETTGYHSNLFSE--------------TELNGNFAMHYMIDRFGVNSRKLVLGM 341

Query: 387 AAYGRGF----TRVKTTANSGSYIGKPYNGVG------GASEGEPGMWLYNQLPLPGTLE 436
           AAYGR F     + +    +   I K + GVG        ++G+ G+W Y  LP  GT+E
Sbjct: 342 AAYGRSFHIKDNKFEPFNQNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIE 401

Query: 437 NFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSL 496
            +DP+ VSAY FD K+  F+ YDN  S++ KA+YV ++NL GGFWWESCG+ + +E +SL
Sbjct: 402 QYDPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSL 461

Query: 497 LNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQ-GFLSRVFK 538
           +NAF   L      +PSI+    V +YYL  Y   GFLS   K
Sbjct: 462 INAFNEGLHFNVSSKPSIFQDVRVKKYYLNKYGDGGFLSPYLK 504

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  400 bits (1029), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 222/490 (45%), Positives = 300/490 (61%), Gaps = 47/490 (9%)

Query: 57  QKFKQIYSDMNSNDNNQNLQEEVGPASNDSQ--SYISGVYYTNWSPYAPRNHFPHDMNFH 114
           +KFK+  SD+        L     P   + Q   Y  GVYYT+WSPY PR HFPHD++F 
Sbjct: 33  EKFKKPRSDIERT----ALSTITRPVDRNLQHGKYAVGVYYTSWSPYEPRLHFPHDIDFK 88

Query: 115 RITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLXXXXXXTFQSHKKEM 174
           R+TNV Y+FFVVDPK+G V+ +D WSD +M  +    PQ                     
Sbjct: 89  RVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGVT------------------ 130

Query: 175 LPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIR 234
              G IGEL YLK             + NF++ M+VGGWSNR+AFP IVR + K   F+ 
Sbjct: 131 ---GMIGELNYLKLQR----------NTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVN 177

Query: 235 TCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIXXXXXXXXXXXXXIF-QDEHHSEHF 293
           + ++ MF+YGFDG+D+DWEFP++DG EP MYL M              I+  +      F
Sbjct: 178 STIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKF 237

Query: 294 FLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNH--VH 351
            L+VA PAF + L++LP+ +M+ +V  WN+M YD+HG WS+ TGYHSNLY  + N+  + 
Sbjct: 238 ELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELK 297

Query: 352 RRHFR----DEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIG 407
           +R F     D+   LNAD A+K +++NF ++++KV LGM AYGRGFT V+T  +    + 
Sbjct: 298 KRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQT-KDDDDLLN 356

Query: 408 KPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCK 467
           K Y+GVGG SEGEPG+WLYNQLPL  T E FD R VSAY FD   KTFVGYDN+ SM  K
Sbjct: 357 KKYSGVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVK 416

Query: 468 AQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKN 527
           + YVK  +L+GGF+WESCGD H D +++L+ AF+ +L  +  + P+I+     I YYLK+
Sbjct: 417 SDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEM--RIPTIFKDPRAIAYYLKH 474

Query: 528 YPQGFLSRVF 537
             +GFL  +F
Sbjct: 475 RQKGFLYSLF 484

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  391 bits (1004), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 193/463 (41%), Positives = 286/463 (61%), Gaps = 40/463 (8%)

Query: 87  QSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDL 146
           + Y+SGVYY+NWSPY PR HFPHD+N  ++++V+Y+FF ++ K+G ++S+D WSD +M+L
Sbjct: 71  KGYVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNL 130

Query: 147 YKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKV 206
           YK    +  + L+      + Q+    +LP+GC+GELFYLK +            + FKV
Sbjct: 131 YKPLAIK-SSQLVENNLNDSVQN----ILPLGCVGELFYLKNAC---------SEKKFKV 176

Query: 207 SMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYL 266
            MS+GGWS+ + F  IV D      F+ + VETMF+ GFDG+DIDWEFP+N+ +EP+ YL
Sbjct: 177 IMSIGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYL 236

Query: 267 TMIXXXXXXXXXXXXXIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAY 326
            ++             IF  E   +HF +++A PAFK+KL  LP+ ++D Y+D+WN+M Y
Sbjct: 237 KLVKMLRLKLNNLESQIF-GESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTY 295

Query: 327 DYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGM 386
           DY+G WSE TGYHSNL+SE               +L+ + A+ Y++  F ++S K+VLGM
Sbjct: 296 DYYGSWSETTGYHSNLFSE--------------TELSGNFAMHYMIDEFSVDSSKLVLGM 341

Query: 387 AAYGRGF----TRVKTTANSGSYIGKPYNGVG------GASEGEPGMWLYNQLPLPGTLE 436
           AAYGR F    ++ +    +   I + + GVG        ++G+ G+W Y  LP  GT+E
Sbjct: 342 AAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIE 401

Query: 437 NFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSL 496
            +DP+ VSAY FD K+  F+ YDN  S + KA+YV ++ L GGFWWESCG+ H ++ +SL
Sbjct: 402 QYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSL 461

Query: 497 LNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNY-PQGFLSRVFK 538
           +NAF   +      +PS++    VI++YL  Y   GFLS   K
Sbjct: 462 INAFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYLK 504

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  376 bits (965), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 211/476 (44%), Positives = 290/476 (60%), Gaps = 47/476 (9%)

Query: 75  LQEEVGP---ASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSG 131
           + EE  P   A      Y  GVYY++WSPY PR H+P +++F R+T+V+Y+FFVVD K+G
Sbjct: 46  VHEETRPVPDAPYPDGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTG 105

Query: 132 TVKSSDEWSDFQMDLYKKFYPQFKAALLXXXXXXTFQSHKKEMLPMGCIGELFYLKYSSI 191
            + S D+WSD +M +     P+                        G IGEL YLK    
Sbjct: 106 KIGSLDKWSDTKMPMNLTGMPRGLN---------------------GAIGELNYLKTRP- 143

Query: 192 LPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDID 251
                      +FK+ M+VGGWSNR+ F  IVRD+ KF+ FI + ++ MF+YGFDG+D+D
Sbjct: 144 ---------GTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLD 194

Query: 252 WEFPQNDGLEPKMYLTMIXXXXXXXXXXXXXIFQDEHHSE-HFFLTVAVPAFKEKLQVLP 310
           WEFP++DG EP+MYL M              I+     +E  F L++A PAF + L + P
Sbjct: 195 WEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFP 254

Query: 311 LRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLY----SEDSNHVHRRHFRDEE----NQL 362
           + +M+ Y+  WN+M YDYHG WSE TGYHSNLY    S   +H+ +R + D      ++L
Sbjct: 255 VEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDEL 314

Query: 363 NADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGEPG 422
           NA  A+  + + F ++ RK+ LGMAAYGRGFT V+   +    IG+ Y+GVGG SEGEPG
Sbjct: 315 NAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVR--GDGEQLIGQKYSGVGGGSEGEPG 372

Query: 423 MWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWW 482
           MWLYNQLPL    E FD   VSAYS+DP +KT V YDNVDSM+ K +YVK+  LAG F W
Sbjct: 373 MWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLW 432

Query: 483 ESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQGFLSRVFK 538
           ESCGDN KD+ ++L+ AFT ++    K   + Y  + +I+YYL+  P+GFL  +++
Sbjct: 433 ESCGDNFKDKDRNLVEAFTENMKGARKA--TAYKDSKLIQYYLRTRPEGFLVPMYR 486

>Skud_4.23 Chr4 complement(36009..39386) [3378 bp, 1125 aa] {ON}
           YDL231C (REAL)
          Length = 1125

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 65  DMNSNDNNQNLQEEVGPASNDSQSYISGVYYTNWSP-YAPRNHFPHDM--NFHRITNVFY 121
           D  S   N N+ ++ G A   SQS  S  Y   W+  Y P  HFP D+  N+  I   F 
Sbjct: 94  DSKSRSYNSNVDDDDGAARKKSQSSFSKFYLYVWAVIYKPIVHFPRDLRDNWASIFKFFV 153

Query: 122 SFFV 125
           ++F+
Sbjct: 154 AYFI 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,257,996
Number of extensions: 2742738
Number of successful extensions: 7834
Number of sequences better than 10.0: 28
Number of HSP's gapped: 7913
Number of HSP's successfully gapped: 29
Length of query: 539
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 425
Effective length of database: 40,409,475
Effective search space: 17174026875
Effective search space used: 17174026875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)