Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02662g5.440ON47947920030.0
Kwal_55.214085.440ON43635710551e-140
KLTH0F15928g5.440ON42340010311e-136
NDAI0C015905.440ON4703599651e-126
KLLA0E02311g5.440ON4172539541e-125
Smik_15.3005.440ON4633789581e-125
ACL167C5.440ON4394029511e-124
Suva_8.1755.440ON4533739511e-124
YOR123C (LEO1)5.440ON4643709401e-122
Ecym_45115.440ON4612499311e-121
TDEL0D026105.440ON4403649221e-120
NCAS0H020805.440ON4353609161e-119
Skud_15.2855.440ON4873719191e-118
CAGL0K10230g5.440ON4462438921e-115
ZYRO0F10164g5.440ON4233528811e-114
KAFR0D050505.440ON4192458731e-113
KNAG0B042105.440ON4632708501e-108
Kpol_1062.265.440ON4572818171e-104
TPHA0E017305.440ON4692597726e-97
TBLA0A064905.440ON4282477322e-91
AER442W3.529ON59075722.9
Kwal_47.178512.394ON652109698.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02662g
         (479 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   776   0.0  
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   410   e-140
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   401   e-136
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   376   e-126
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   372   e-125
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   373   e-125
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   370   e-124
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   370   e-124
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   366   e-122
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   363   e-121
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   359   e-120
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   357   e-119
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   358   e-118
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   348   e-115
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   343   e-114
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   340   e-113
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   332   e-108
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   319   e-104
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   301   6e-97
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   286   2e-91
AER442W Chr5 (1482977..1484749) [1773 bp, 590 aa] {ON} Syntenic ...    32   2.9  
Kwal_47.17851 s47 complement(580692..582650) [1959 bp, 652 aa] {...    31   8.0  

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/479 (83%), Positives = 400/479 (83%)

Query: 1   MCPFFYGKFYQNFEGKTVEIRTTLVKRNLDKRKKSALSMSEDNSETKDNTAIQESDASAG 60
           MCPFFYGKFYQNFEGKTVEIRTTLVKRNLDKRKKSALSMSEDNSETKDNTAIQESDASAG
Sbjct: 1   MCPFFYGKFYQNFEGKTVEIRTTLVKRNLDKRKKSALSMSEDNSETKDNTAIQESDASAG 60

Query: 61  LENPIREASGKXXXXXXXXXXXXXXXXXLFGDDSDNAXXXXXXXXXXXXXSPNHLSKSEA 120
           LENPIREASGK                 LFGDDSDNA             SPNHLSKSEA
Sbjct: 61  LENPIREASGKDNEDDNDNSGEDEEMDDLFGDDSDNAGEGELEGEEKEGKSPNHLSKSEA 120

Query: 121 NHGSYLEEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKTTSNSQDK 180
           NHGSYLEEDEEQAMYNRKFYG           SQREFKEADVEIAKHIVPYKTTSNSQDK
Sbjct: 121 NHGSYLEEDEEQAMYNRKFYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYKTTSNSQDK 180

Query: 181 EVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSK 240
           EVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSK
Sbjct: 181 EVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSK 240

Query: 241 QQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITK 300
           QQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITK
Sbjct: 241 QQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITK 300

Query: 301 TMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERR 360
           TMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERR
Sbjct: 301 TMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERR 360

Query: 361 KRQLKEQLEKENRDSVEPLGVRKSATSSFGVGRRNXXXXXXXXXXXXXXXXXXXXXXXXX 420
           KRQLKEQLEKENRDSVEPLGVRKSATSSFGVGRRN                         
Sbjct: 361 KRQLKEQLEKENRDSVEPLGVRKSATSSFGVGRRNEYEEDDFLVDDEEEEEEGGISGEEE 420

Query: 421 XXXXXXXXXXXXXLNAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEEDE 479
                        LNAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEEDE
Sbjct: 421 EEAEEEDDDDEDDLNAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEEDE 479

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  410 bits (1055), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 254/357 (71%), Gaps = 13/357 (3%)

Query: 132 QAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKTTSNSQDKEVYYAKVPQFL 191
           QAMYNRKFYG           SQREF+EADV++ KH+VPY T  +  DK ++YAKVPQFL
Sbjct: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSEGDKTIFYAKVPQFL 139

Query: 192 TIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESNAQI 251
           TIDP+PFDPP+F+  +E R AQ SS EDQ+DDRLI+ENT+RWRYSRDSKQQVFKESNAQI
Sbjct: 140 TIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQI 199

Query: 252 IQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTSTSS 311
           +QWSDGTFSLRLGDEF+DVLINDT++T+LTVSH+QQEL+Q V+GGE+TK M+FIPTST+S
Sbjct: 200 VQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNS 259

Query: 312 KIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLEKE 371
           K HQRLSKAV R+EQREH GPNTYI+R DPELEQ+ELEKKQ QI+RERRKRQL+EQ E+E
Sbjct: 260 KSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQERE 319

Query: 372 NRDSVEPLGVRKSATSSFGVGRRNXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXX 426
             DS  P    KS TSS G  +                                      
Sbjct: 320 GLDSPAPAAKPKS-TSSLGYSQSRYDEYEDDGFMVDDENNETGEDDEGEDDEDDLLDDNN 378

Query: 427 XXXXXXXLNAERLRQLKREGAAQYE---QKDEESGSEE---SSHKRRKIAVLDDEEE 477
                  LNAERLRQLKR GA+QY     +D+    EE   S+ KRRK+AVLDDE++
Sbjct: 379 EEEEDDDLNAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDD 435

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  401 bits (1031), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 214/400 (53%), Positives = 265/400 (66%), Gaps = 24/400 (6%)

Query: 89  LFGDDSDNAXXXXXXXXXXXXXSPNHLSKSEANHGSYLEEDEEQAMYNRKFYGXXXXXXX 148
           LFGDDSD               SPN  ++         EED+EQAMYNRKFYG       
Sbjct: 36  LFGDDSD--QETGSGPGEQEPHSPNSANE---------EEDDEQAMYNRKFYGDKGEDSN 84

Query: 149 XXXXSQREFKEADVEIAKHIVPYKTTSNSQDKEVYYAKVPQFLTIDPVPFDPPSFKRNVE 208
                 +EF+EAD++I KHIVPY T  +  DK +YY KVPQFLTIDP+PFDPP+F+  +E
Sbjct: 85  DE--GSQEFREADIDIMKHIVPYSTEPSQGDKTIYYTKVPQFLTIDPIPFDPPAFQSKIE 142

Query: 209 GRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLGDEFS 268
            R AQ +S EDQ+DDRLI+ENT+RWRYSRD  Q+VFKESNA I+QWSDGT+SLRLGDE++
Sbjct: 143 ERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAHIVQWSDGTYSLRLGDEYT 202

Query: 269 DVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRREQRE 328
           DVLINDT++T+L VSH+QQEL+Q V+GGE+TK M+FIPTST+SK HQRLSKAV R+EQ+E
Sbjct: 203 DVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQQE 262

Query: 329 HLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLEKENRDSVEPLG-VRKSATS 387
           H GPNTYI+R DPELEQ+ELEKKQ QI+RERRKRQL+EQ E+E  DS  P    R ++  
Sbjct: 263 HHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQEREGMDSPAPTSKPRSASRP 322

Query: 388 SFGVGRRNXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNAERLRQLK 443
            +   R +                                          LNAERLRQLK
Sbjct: 323 GYSQTRYDEYEDDGFMVDDEENESDGGVGGDGNEDEEDLLDDEEEEDDDDLNAERLRQLK 382

Query: 444 REGAAQYEQKD------EESGSEESSHKRRKIAVLDDEEE 477
           R+GAAQY  ++      E   +E+S+ KRRK+AVLDDE++
Sbjct: 383 RKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDEDD 422

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  376 bits (965), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 204/359 (56%), Positives = 253/359 (70%), Gaps = 12/359 (3%)

Query: 129 DEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKTTSNSQDKEVYYAKVP 188
           D+E+AMY RKFYG           +  +FKEA+VEI +H+VPYKT+S+  D  +YYAKVP
Sbjct: 116 DDEEAMYTRKFYGDTDKYSDNEEDAH-DFKEANVEIIRHMVPYKTSSDQADTTIYYAKVP 174

Query: 189 QFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESN 248
            FLTIDP+PFDP SF+  V+ RLA +SS+EDQL DRLIDENTIRWRYSRD  Q+VFKESN
Sbjct: 175 PFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVFKESN 234

Query: 249 AQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTS 308
           AQI+QWSDG+FSL+LGDE++D+L+NDTDNTFLTVSH+QQELMQC  GGEITKTMMFIPTS
Sbjct: 235 AQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFIPTS 294

Query: 309 TSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQL 368
           T+SKIHQ+LSKAV RR QR++LGP T I+ KDPELE++ELEKKQ QI+RERRKRQLKE+ 
Sbjct: 295 TNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKELEKKQGQILRERRKRQLKERE 354

Query: 369 EKENRDSVEPLGVRKSAT--------SSFGVGRRNXXXXXXXXXXXXXXXXXXXXXXXXX 420
            +E+ D+     VR SA+        SS+   R++                         
Sbjct: 355 IQESPDTT--FDVRGSASSKNRSPAPSSYRGSRQDEYEEDDFLVDDDEEEEFVGDEDEEE 412

Query: 421 XXXXXXXXXXXXXLNAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEEDE 479
                          A+RL+++K+ GA +Y  + EES  EE S KRRK+AVL D+EEDE
Sbjct: 413 EEEEEEEEEDEDDRKAKRLKEIKKGGAQEYADR-EESDMEEGSSKRRKVAVLSDDEEDE 470

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  372 bits (954), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 176/253 (69%), Positives = 215/253 (84%), Gaps = 2/253 (0%)

Query: 127 EEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKTTSNSQDKEVYYAK 186
           EEDEEQAMYNRKF G            ++  KE DVEI KH+VPYKT + + DK +YYAK
Sbjct: 65  EEDEEQAMYNRKFLGEDYEGQSEEEYEKKY-KEVDVEIVKHVVPYKTANGADDKTIYYAK 123

Query: 187 VPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKE 246
           VPQFLTIDPVPFDPPSF++ VE R++++SSKEDQL DRLI+ENTIRWRYSRD  ++VFKE
Sbjct: 124 VPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKE 183

Query: 247 SNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIP 306
           SNAQI++WSDGTFSL++GDE++D+L+N+T+NT+LTVSHE+QEL+QCVEGGEITK+MMF+P
Sbjct: 184 SNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVP 243

Query: 307 TSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKE 366
           TST+SK+H+ LSKAV RR++R   GPNTYI R DPELE+RELEKK DQI+RERRK+QLKE
Sbjct: 244 TSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQILRERRKKQLKE 303

Query: 367 QLEKENR-DSVEP 378
           +LE EN  DS EP
Sbjct: 304 KLELENAGDSPEP 316

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 31/43 (72%), Gaps = 8/43 (18%)

Query: 435 NAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEE 477
           NA+RLR++K+ GA +Y+        E++  K+RKIAVLDDE++
Sbjct: 382 NAKRLREVKQTGAQEYQ--------EDAQAKKRKIAVLDDEDD 416

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  373 bits (958), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 252/378 (66%), Gaps = 13/378 (3%)

Query: 111 SPNHLSKSEANHGSYLEEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVP 170
           S NH S+   + G   +E EEQAMY RKFYG           +   FKE +VE+ +HI+P
Sbjct: 89  SVNHRSRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIP 148

Query: 171 YKTTSN--SQDKEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDE 228
            K   N  +   E++YA++P FLTIDPVPFDPPSF+  V  R +  +SKEDQLDDRLIDE
Sbjct: 149 SKGIVNETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDE 208

Query: 229 NTIRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQE 288
           NT+RWRYSRD  Q VFKESN QI+QWSDGT+SL++G+E +D+L+NDT NTFLTVSH+QQE
Sbjct: 209 NTVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQE 268

Query: 289 LMQCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQREL 348
           L+QC EGGEI KT+MFIPTST+SKIHQ+LSKAV+RR QR++ GP TYIV  DPE+E+REL
Sbjct: 269 LIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKREL 328

Query: 349 EKKQDQIVRERRKRQLKEQLEKENRDSVEPLGVRK-SATSSFGVGRRNX------XXXXX 401
           EKKQ QI+R+RR+RQLKE+ ++E+ D+    G RK S+ +++G  RRN            
Sbjct: 329 EKKQSQILRDRRRRQLKEKEKQESPDAAFETGFRKQSSPTAYGTSRRNEYEEDDFLVDDD 388

Query: 402 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNAERLRQLKREGAAQYEQKDEESGSEE 461
                                            NA RLR LK+EGAA Y Q++ E  +E 
Sbjct: 389 EEEEAEFDDDDDNEEEEEEEEEEEEEEEDADEANAARLRSLKKEGAAMYRQEENEDNNET 448

Query: 462 SSHKRRKIAVL-DDEEED 478
              KRR++AV+ DDEEED
Sbjct: 449 ---KRRRVAVIEDDEEED 463

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  370 bits (951), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/402 (50%), Positives = 258/402 (64%), Gaps = 13/402 (3%)

Query: 89  LFGDDSDNAXXXXXXXXXXXXXSPNHLSKSEA-NHGSYLEEDEEQAMYNRKFYGXXXXXX 147
           LFG+DSD +               +   +S    HG   E++EEQ MYNRKFYG      
Sbjct: 38  LFGEDSDVSGSDDADEADDGASEDSGSRRSRGTGHGLGAEDNEEQEMYNRKFYGDDLQQA 97

Query: 148 X--XXXXSQREFKEADVEIAKHIVPYKTTSNSQDKEV-YYAKVPQFLTIDPVPFDPPSFK 204
                    RE KEAD+E+ KH+VP       + K + YY KVPQFLTIDPVPFDPPSF+
Sbjct: 98  SDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLYYTKVPQFLTIDPVPFDPPSFQ 157

Query: 205 RNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLG 264
             +E R+A+FSSKEDQL D LIDENTIRWRYSR S Q+VFKESNAQ+I+WSDGT SL+LG
Sbjct: 158 GQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFKESNAQVIEWSDGTLSLKLG 217

Query: 265 DEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRR 324
           DE++D+L N+ +NT+LTVSHEQQE+MQCVEGG I+ +M+FIPTST+SKIH+RL+KA+ RR
Sbjct: 218 DEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIPTSTNSKIHKRLTKAIARR 277

Query: 325 EQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLEKENRDSVEPLG---V 381
           E REH GP+TYIVRKDPELE+REL+KK DQ++RERRKRQLKEQL+++N +     G    
Sbjct: 278 EAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQLKEQLDRDNLEGGLAQGSFEF 337

Query: 382 RKSATSSFGVGRR-----NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNA 436
           +K+A  +    R      +                                      LNA
Sbjct: 338 KKAAGRAAPYSRSMEDEYDDEDGFIDDDDDLEALSDNDDAADSLPGSPTASQDEEDDLNA 397

Query: 437 ERLRQLKREGAAQYEQKDEESGS-EESSHKRRKIAVLDDEEE 477
            RL+QLKREGAA+Y        + EE + KRRK+AVLD ++E
Sbjct: 398 ARLQQLKREGAAKYAAAPPAPRADEEVALKRRKVAVLDSDDE 439

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  370 bits (951), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 196/373 (52%), Positives = 249/373 (66%), Gaps = 11/373 (2%)

Query: 111 SPNHLSKSEANHGSYLEEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVP 170
           S NH      + G   +E EEQAMY RKFYG           +   FKE +VE+ +HI+P
Sbjct: 87  SANHRDHHRESLGLDDDEAEEQAMYTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIP 146

Query: 171 YKTTSN--SQDKEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDE 228
            K   N  +   E++YA++P FLTIDP+PFDPPSF+  V  R     SKEDQLDDRLIDE
Sbjct: 147 SKANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDE 206

Query: 229 NTIRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQE 288
           NT+RWRYSRD+ Q VFKESN QI+QWSDG++SL++G+E++D+L+NDT NTFLTVSH+QQE
Sbjct: 207 NTVRWRYSRDNDQHVFKESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQE 266

Query: 289 LMQCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQREL 348
           LMQC EGGEI KT+MFIPTSTSSKIHQ+LSKAVVR+ QR++ GP TYI+  DPE+E+REL
Sbjct: 267 LMQCYEGGEIKKTLMFIPTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKREL 326

Query: 349 EKKQDQIVRERRKRQLKEQLEKENRDSVEPLGVRK-SATSSFGVGRRNXXXXXXXXXXXX 407
           EKKQ QI+R+RRKRQLKE+ ++E+ D       RK S+ +++G  RRN            
Sbjct: 327 EKKQSQILRDRRKRQLKEKEKQESPDVGFETAFRKQSSPTAYGATRRNEYEEDDFLVDDD 386

Query: 408 XXXXXXXXXXXXXXXXXXXXXXXXXXLNAERLRQLKREGAAQYEQKDEESGSEESSH-KR 466
                                       A RLR LKREGAA Y+   EE G ++S+  KR
Sbjct: 387 EEEEAEFDDDDDNEEEEEEEADEDN---AARLRNLKREGAAMYK---EEGGDDDSNESKR 440

Query: 467 RKIAVL-DDEEED 478
           R++AV+ DDE+ED
Sbjct: 441 RRVAVIEDDEDED 453

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  366 bits (940), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 250/370 (67%), Gaps = 6/370 (1%)

Query: 113 NHLSKSEANHGSYLEEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYK 172
           NH S+   + G   +E EEQAMY RKFYG           +   FKE +VE+ +HI+P K
Sbjct: 97  NHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSK 156

Query: 173 TTSN--SQDKEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENT 230
              N  +   E++YA++P FLTIDP+PFDPPSF+  V  R +  +S+EDQLDDRLIDENT
Sbjct: 157 ANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENT 216

Query: 231 IRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELM 290
           +RWRYSRD  Q VFKESN QI+QWSDGT+SL++G+E +D+L+NDT NTFLTVSH+QQEL+
Sbjct: 217 VRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELI 276

Query: 291 QCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEK 350
           QC EGGEI KT+MFIPTST+SKIHQ+LSKAV+RR QR+  GP TYIV  DPE+E++ELE+
Sbjct: 277 QCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELER 336

Query: 351 KQDQIVRERRKRQLKEQLEKENRDSVEPLGVRK-SATSSFGVGRRNXXXXXXXXXXXXXX 409
           KQ QI+R+RR+RQLKE+ ++E+ D+    G RK ++ +++G  RRN              
Sbjct: 337 KQSQILRDRRRRQLKEKEKQESPDAAFETGFRKQNSPTTYGASRRNEYEEDDFLVDDDEE 396

Query: 410 XXXXXXXXXXXXXXXXXXXXXXXXLNAERLRQLKREGAAQYEQKDEESGSEESSHKRRKI 469
                                     + RLR LKREGAA Y +++EE   + S  KRR++
Sbjct: 397 EEAAFDDEEDDNEEEEEEEDADEENAS-RLRNLKREGAAMY-REEEEEEKDRSETKRRRV 454

Query: 470 AVL-DDEEED 478
           AV+ DDE+ED
Sbjct: 455 AVIEDDEDED 464

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  363 bits (931), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 210/249 (84%), Gaps = 3/249 (1%)

Query: 127 EEDEEQAMYNRKFYGX--XXXXXXXXXXSQREFKEADVEIAKHIVPYKTTSNSQ-DKEVY 183
           +E++EQ MYNRKFYG              +RE KEA+V+I KH+VPY TT+ S+ D  +Y
Sbjct: 82  DEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEKDSSLY 141

Query: 184 YAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQV 243
           YAKVPQFLTIDP+PFDPP F+  +E RL +FSSKEDQL DRLIDENTIRWRYSR + QQV
Sbjct: 142 YAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQV 201

Query: 244 FKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMM 303
           FKESNAQIIQWSDGTFSL+LGDEFSD+LIND +NT++TVSHEQ+ELMQCVEGGEI K+M+
Sbjct: 202 FKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSML 261

Query: 304 FIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQ 363
           FIPTST+SK HQRLS A+ RRE REH GP+TYIVR DPELE++ELEKK DQ++RERRKRQ
Sbjct: 262 FIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPELEKKELEKKHDQVIRERRKRQ 321

Query: 364 LKEQLEKEN 372
           LKEQ+++EN
Sbjct: 322 LKEQMDREN 330

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 13/57 (22%)

Query: 434 LNAERLRQLKREGAAQYEQ-------------KDEESGSEESSHKRRKIAVLDDEEE 477
           LNAERL+QLK EGAA+Y+              K +   ++ S+ KRRK+AVLD ++E
Sbjct: 405 LNAERLKQLKIEGAARYQHGSTTTTSPSDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  359 bits (922), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 189/364 (51%), Positives = 240/364 (65%), Gaps = 16/364 (4%)

Query: 127 EEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKTTSNSQDKE--VYY 184
           EE +E AMY RKFYG           S   F E +VE+ +HIVPYKT     D++  +YY
Sbjct: 81  EEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYY 140

Query: 185 AKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVF 244
           AKVP+FLTIDPVPFDPPSF+  V+ RL   SS+EDQL DRLIDENTIRWRYSRD  QQV+
Sbjct: 141 AKVPEFLTIDPVPFDPPSFESKVKERLNS-SSREDQLGDRLIDENTIRWRYSRDENQQVY 199

Query: 245 KESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMF 304
           KESNAQI+QWSDG  SL+LG E++D+L+NDTDNTF  VSH++QELMQC +GGE+TK++MF
Sbjct: 200 KESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMF 259

Query: 305 IPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQL 364
           IPTST+SK+HQ+L+KAV+RR+QR+  GP  Y V KDPELE+ ELEKKQ Q+VRERRKRQL
Sbjct: 260 IPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRERRKRQL 319

Query: 365 KEQLEKENRDSVEPL-GVRKSATSS-------FGVGRRNXXXXXX--XXXXXXXXXXXXX 414
           KE   + + D    L G RK+  ++       +G  +RN                     
Sbjct: 320 KEIESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNEYEQDDFLVDDDEEEEAGYSE 379

Query: 415 XXXXXXXXXXXXXXXXXXXLNAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDD 474
                                AERLRQLKR+G  +Y + + ES   + S KRRK+A++DD
Sbjct: 380 EDDVLDDNNDDQEAEDEEDAKAERLRQLKRQGTERYTEPEPES---DPSTKRRKVAIIDD 436

Query: 475 EEED 478
           E+++
Sbjct: 437 EDDE 440

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  357 bits (916), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 193/360 (53%), Positives = 248/360 (68%), Gaps = 13/360 (3%)

Query: 129 DEEQAMYNRKFYGXXXXX--XXXXXXSQREFKEADVEIAKHIVPYKTTSNSQDKE-VYYA 185
           DEE+AMY RKFYG             +   FKE +VE+ +H+VPYKT+S   D+  VYYA
Sbjct: 80  DEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYA 139

Query: 186 KVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFK 245
           KVP FLTI+PVPFDP +F+ +V  RL+ +SSKEDQL DRLIDENT+RWRYSRD+ Q+VFK
Sbjct: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199

Query: 246 ESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFI 305
           ESNAQI+QWSDG+FSL+LGDE++D+L+N+T+NTFL VSH+QQELMQC  GGEITKT+MFI
Sbjct: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259

Query: 306 PTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLK 365
           PTST+SKIHQ+LSKAV RR QREHLGP T I+ +DPE+E+RELEKKQ QI+R+RR+RQLK
Sbjct: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRRRRQLK 319

Query: 366 EQLEKENRDSVEPLG----VRKSATSSFGVGRRNXXXXXXXXXXXXXXXXXXXXXXXXXX 421
           E+   E+ D+   +      RK  T +  +G R                           
Sbjct: 320 EKELLESPDTTMDVSGGYETRKRNTPNPSLGSR-RQDEYEEDDFLVDDEDEEDFIEDDEE 378

Query: 422 XXXXXXXXXXXXLNAERLRQLKREGAAQYEQKDEESGSEE--SSHKRRKIAVLDDEEEDE 479
                         AERLR  KR G   Y++ ++ESG+E   SS K+R++AV++D+E+DE
Sbjct: 379 EEEEEEEEDNDEEKAERLRNAKRSG---YDEDNQESGTENESSSSKKRRVAVINDDEDDE 435

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  358 bits (919), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/371 (51%), Positives = 254/371 (68%), Gaps = 6/371 (1%)

Query: 113 NHLSKSEANHGSYLEEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYK 172
           +H S+   + G   +E EEQAMY RKFYG           +   FKE ++EI +HI+P K
Sbjct: 119 DHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNK 178

Query: 173 TTSN--SQDKEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENT 230
              N  +   E++YA++P FLTID VPFDPPSF+  V  R    +SKEDQLDDRLIDENT
Sbjct: 179 ANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENT 238

Query: 231 IRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELM 290
           +RWRYSRD  Q VFKESN QI+QWSDG++SL++G+E +D+L+NDT NTFLTVSH+QQEL+
Sbjct: 239 VRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELI 298

Query: 291 QCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEK 350
           QC EGGEI KT+MFIPTST+SKIHQ+LSKAV+RR QR++ GP TYIV  DPE+E++ELEK
Sbjct: 299 QCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEK 358

Query: 351 KQDQIVRERRKRQLKEQLEKENRDSVEPLGVRK-SATSSFGVGRRNXXXXXX-XXXXXXX 408
           KQ Q++R+RR+RQLKE+ ++E+ D+    G RK S+ +S+G+ RRN              
Sbjct: 359 KQSQVLRDRRRRQLKEREKQESPDAAFETGFRKQSSPTSYGISRRNEYEEDDFLVDDDEE 418

Query: 409 XXXXXXXXXXXXXXXXXXXXXXXXXLNAERLRQLKREGAAQYEQKDEESGSEESSHKRRK 468
                                     NA RLR LKREGAA Y++++++  S E+  KRR+
Sbjct: 419 EEAGFDDGDDEEEEEEEEEEEEADQENAARLRNLKREGAAMYKEEEKDDDSNET--KRRR 476

Query: 469 IAVLDDEEEDE 479
           +AV++D+E++E
Sbjct: 477 VAVIEDDEDEE 487

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  348 bits (892), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 203/243 (83%), Gaps = 2/243 (0%)

Query: 131 EQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKT-TSNSQDKEVYYAKVPQ 189
           EQ MY RKFYG               FKE++V++ +HI+PYKT T+N++  E++YAKVP 
Sbjct: 108 EQEMYTRKFYGEDAVNYSDDDEPH-TFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPA 166

Query: 190 FLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESNA 249
           FLTIDPVPFDP +F+  V+ RL++ +SKEDQL DRLIDENTIRWRYSRD++Q VFKESNA
Sbjct: 167 FLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNA 226

Query: 250 QIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTST 309
           QI+QWSDG+FSL+LGDE++D+++NDTDNTFLTVSH+QQELMQC +GGEITKTMMFIPTST
Sbjct: 227 QIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTST 286

Query: 310 SSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLE 369
           +SKIHQ+LSKAV RR  R++LGP +YI+++DPE+E++ELEK Q QI+RERRKRQ KE   
Sbjct: 287 NSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEIET 346

Query: 370 KEN 372
           +EN
Sbjct: 347 REN 349

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  343 bits (881), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/352 (53%), Positives = 235/352 (66%), Gaps = 12/352 (3%)

Query: 127 EEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKTTSNSQDKEVYYAK 186
           EE EE AMY RKFYG           +Q   +E DVE+ +HIVPY+ T  +    +YYAK
Sbjct: 84  EEAEEHAMYTRKFYGEDVDRVSDEEEAQEF-REEDVELVRHIVPYRATQGTDKPVLYYAK 142

Query: 187 VPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKE 246
           +P+FLTIDPVPFDPPSF+ +V+ RL   +SKEDQL DRLIDENT+RWRYSRD+ QQVFKE
Sbjct: 143 IPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKE 202

Query: 247 SNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIP 306
           SNAQI+QWSDGTFSL+LGDE++D+L NDTDNTF  VSH+QQELMQC EGGE+TKT+MFIP
Sbjct: 203 SNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIP 262

Query: 307 TSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKE 366
           TSTSS++HQ+L+KAV+RR+ ++  GP TYIV+KDPELE+ ELEKKQ Q+VRERR+RQ+KE
Sbjct: 263 TSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELEKKQQQVVRERRRRQVKE 322

Query: 367 QLEKENRDSVEPLGVRKSATSSFGVGRRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 426
              +E     +      +     G  RRN                               
Sbjct: 323 MESREASGDPDRRAAISAEAEPMGNIRRNEYEQDDFLVDDDDEEEYASGSGEEGEEEEEE 382

Query: 427 XXXXXXXLNAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEED 478
                    AERLR+LKREGA  YE++           KRR++AV+DDEE++
Sbjct: 383 DEGNVSDEGAERLRRLKREGANNYEER-----------KRRRVAVIDDEEDE 423

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  340 bits (873), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/245 (67%), Positives = 202/245 (82%), Gaps = 4/245 (1%)

Query: 124 SYLEEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKT-TSNSQDKEV 182
           SY+  DEE+AMYNRKFYG            +  FKEADVE+ +H+VPYKT   N  DK +
Sbjct: 63  SYI--DEEEAMYNRKFYGEEGSDMSDHEE-EALFKEADVELVRHVVPYKTFPENEDDKTI 119

Query: 183 YYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQ 242
           YY KVP FL+IDP+PFDPPSF+  V+ R + FSS EDQL DRLIDENTIRWRYSRD++Q+
Sbjct: 120 YYTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQR 179

Query: 243 VFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTM 302
           VFKESNAQI+QWSDG++SL+LG E++D+L+N TDNTFLTVSH+QQELMQCV+GG+I KT+
Sbjct: 180 VFKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTL 239

Query: 303 MFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKR 362
           +FIPTST+SKIHQRLSKA+ RR+QR H GP T IV  DPE+E+RELEKKQ QI+RERR+R
Sbjct: 240 IFIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRR 299

Query: 363 QLKEQ 367
           Q+KEQ
Sbjct: 300 QMKEQ 304

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  332 bits (850), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 163/270 (60%), Positives = 199/270 (73%), Gaps = 3/270 (1%)

Query: 126 LEEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKTTSNSQ--DKEVY 183
           L+ DEE+ MYNRKFYG           ++ EFKEA+VE+ KHIVPYK   +      ++Y
Sbjct: 94  LDMDEEEEMYNRKFYGEDVDMSDTEQ-AEHEFKEANVELVKHIVPYKLVPDDAIGTNDIY 152

Query: 184 YAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQV 243
            AKVP FL IDP PFDP SF+  V  RL    SKED+L DRLIDENT+RWRYSRD+ Q V
Sbjct: 153 VAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQSV 212

Query: 244 FKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMM 303
           FKESN QI+QWSDG++SL+LG+E++D+LINDTDNTFLTVSH+QQELMQCVEGG + KT+M
Sbjct: 213 FKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLM 272

Query: 304 FIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQ 363
           FIPTSTSSKIHQ+LSKAV RR   +  GP TYIV  DPE+E++ELE+KQ QI +ERR+RQ
Sbjct: 273 FIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELERKQGQIFKERRRRQ 332

Query: 364 LKEQLEKENRDSVEPLGVRKSATSSFGVGR 393
           L+E+   E+ D+        SA S  G  R
Sbjct: 333 LREKELAESPDTTIGGPRSGSAGSWHGTPR 362

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  319 bits (817), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 166/281 (59%), Positives = 209/281 (74%), Gaps = 15/281 (5%)

Query: 127 EEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKTTS--NSQDKEVYY 184
           +EDEEQAMY RKFYG            + EF+E DV + +H+VP K TS  N  D  +YY
Sbjct: 88  DEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTIYY 147

Query: 185 AKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVF 244
           AKVP FLTIDP+PFDPP+F+  V  RL    SKE+QL+DRLID+NTIRWRYSRD  Q+VF
Sbjct: 148 AKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVF 207

Query: 245 KESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMF 304
           KESNA I+QWSDG++SL+LGDE++D+L+NDTDNTFLTVSH+QQELMQCV GGEI+K+++F
Sbjct: 208 KESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLF 267

Query: 305 IPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQL 364
           +P ST+SK+HQRLSKA+VRR   E +GP + IV  DPELE++ELEKKQ Q+ RERRK   
Sbjct: 268 VPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRERRK--- 324

Query: 365 KEQLEKENRDSVEPLGV--------RKSATS--SFGVGRRN 395
           K+Q E E  +S+E  G         RK +T+  S+G  RR+
Sbjct: 325 KKQKEIEALESLETTGFGNNSYSASRKRSTTPMSYGGSRRD 365

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/43 (62%), Positives = 35/43 (81%), Gaps = 3/43 (6%)

Query: 436 AERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEED 478
           AERLR+LKR+G A Y   DE+SGSE  S KRRK+AV++D+E+D
Sbjct: 418 AERLRELKRQGTAAY-NDDEKSGSE--SPKRRKVAVIEDDEDD 457

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  301 bits (772), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 152/259 (58%), Positives = 195/259 (75%), Gaps = 10/259 (3%)

Query: 127 EEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKT----TSNSQD--- 179
           +EDEE AMY RKFYG           +  EFKEADVE+ +HIVPYK       NS+D   
Sbjct: 107 DEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDAT 166

Query: 180 --KEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSR 237
                YYA++P FLTIDPVPFDPP F+  V+ RL   ++ +D++ DRLIDENTIRWRYSR
Sbjct: 167 SKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSR 226

Query: 238 DSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGE 297
           D+ Q VFKESNAQIIQWSDG++SL+LGD+++D+L+ND  NTFLTVSH+QQELMQCV+GGE
Sbjct: 227 DANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGE 286

Query: 298 ITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVR 357
           I+K+ MF+P ST+S++HQRLSKA+ RR+Q     P + I+  DPE+E++ELEKKQ QI R
Sbjct: 287 ISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFR 346

Query: 358 ERRKRQLKE-QLEKENRDS 375
           +RRKR+ +E + E+E  DS
Sbjct: 347 DRRKRKQREIETEQEALDS 365

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  286 bits (732), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 191/247 (77%), Gaps = 6/247 (2%)

Query: 127 EEDEEQAMYNRKFYGXXXXXXXXXXXSQREFKEADVEIAKHIVPYKTTSNSQD----KEV 182
           ++++++AMY +KFYG           ++ E+KE+D+E+ +HIVPYKT  ++++    +E+
Sbjct: 51  DDEQDKAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYKTRPSNKELDKHREL 110

Query: 183 YYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQ- 241
           YYAKVP FL +DPVPFD  +F+  V+ R+    +++ Q+ DRL DENTIRWRYSRDS   
Sbjct: 111 YYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSNDN 170

Query: 242 -QVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITK 300
            +VFK+SNAQIIQWSDG++SL+LG++++D+L N+TDN FLTVSH+QQELMQC  GGEITK
Sbjct: 171 DKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEITK 230

Query: 301 TMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERR 360
           T+MFIP+ST SKIHQRL+ AV  R+++   GP   ++  DPE+E++ LEKKQ Q++R+RR
Sbjct: 231 TLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQMMRDRR 290

Query: 361 KRQLKEQ 367
           ++QL+E+
Sbjct: 291 RKQLQER 297

>AER442W Chr5 (1482977..1484749) [1773 bp, 590 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL219C (MDM34)
          Length = 590

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 305 IPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQL 364
           IPT  S K+   L K V        L  N+Y VR    ++ +  E+  + +V  RRK ++
Sbjct: 347 IPTRASFKVENTLPKEV--------LDSNSYDVRVITAIQTKMYERASNDVVLRRRKIKM 398

Query: 365 KE-QLEKENRDSVEP 378
           +  +  K N+D+V P
Sbjct: 399 RSRKPSKANKDAVSP 413

>Kwal_47.17851 s47 complement(580692..582650) [1959 bp, 652 aa] {ON}
           YMR137C (PSO2) - interstrand crosslink repair protein
           [contig 204] FULL
          Length = 652

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 13/109 (11%)

Query: 167 HIVPYKTTSNSQDKEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDR-- 224
           H+V  +T S+ +  + Y+  +      D V F P  +     GR  +     DQ  D   
Sbjct: 509 HLVSLRTLSSKESLQFYFKPISHIYE-DMVAFSPTGWSFKNGGRFIKLHESLDQKIDHTM 567

Query: 225 ---------LIDENTIRWRYSRDSKQQVFKESNAQIIQWSD-GTFSLRL 263
                    ++D +TI  +Y R+++ QVF+   ++   + D   F +RL
Sbjct: 568 GLLSNKSLDVMDPSTIYKQYKREARFQVFRIPYSEHSSFKDLANFCVRL 616

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,527,038
Number of extensions: 1849551
Number of successful extensions: 12851
Number of sequences better than 10.0: 141
Number of HSP's gapped: 13070
Number of HSP's successfully gapped: 169
Length of query: 479
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 366
Effective length of database: 40,524,141
Effective search space: 14831835606
Effective search space used: 14831835606
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)