Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02640g5.439ON1261266672e-91
CAGL0I01078g5.439ON1261266185e-84
Skud_15.2845.439ON1261266133e-83
Smik_15.2995.439ON1261266134e-83
YOR122C (PFY1)5.439ON1261266134e-83
TDEL0D026205.439ON1261266108e-83
NDAI0C015805.439ON1261266082e-82
Suva_8.1745.439ON1261266064e-82
KLLA0E02289g5.439ON1261266031e-81
KNAG0B042205.439ON1261265995e-81
KAFR0D050405.439ON1261265943e-80
NCAS0H020705.439ON1261265892e-79
Ecym_45105.439ON1261265873e-79
ACL168C5.439ON1261265841e-78
Kpol_1062.275.439ON1261265795e-78
KLTH0F15950g5.439ON1261265786e-78
TPHA0E017405.439ON1261265701e-76
ZYRO0F10142g5.439ON1261265483e-73
TBLA0A065005.439ON1191265449e-73
Kwal_55.214135.439ON58582863e-34
YMR041C (ARA2)2.604ON33570642.3
ZYRO0F02574g8.17ON63058652.4
CAGL0F00649g1.390ON51436633.3
NCAS0C027408.427ON491134607.9
Skud_13.1972.604ON35170609.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02640g
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   261   2e-91
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   242   5e-84
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   240   3e-83
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   240   4e-83
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   240   4e-83
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   239   8e-83
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   238   2e-82
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   238   4e-82
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   236   1e-81
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   235   5e-81
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   233   3e-80
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   231   2e-79
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   230   3e-79
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   229   1e-78
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   227   5e-78
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   227   6e-78
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   224   1e-76
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   215   3e-73
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   214   9e-73
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   114   3e-34
YMR041C Chr13 complement(350966..351973) [1008 bp, 335 aa] {ON} ...    29   2.3  
ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} simila...    30   2.4  
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    29   3.3  
NCAS0C02740 Chr3 (515889..517364) [1476 bp, 491 aa] {ON} Anc_8.4...    28   7.9  
Skud_13.197 Chr13 complement(337502..338557) [1056 bp, 351 aa] {...    28   9.2  

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  261 bits (667), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  242 bits (618), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGKVDKA+IYS+AGDA+WATSGGL+LQ  EISEI QGFDNPTGLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQT+LIAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  240 bits (613), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNL+GTGKVDKA+IYSRAGDAIWATSGGL+LQP EISE+ QGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGV+CVRTKQT++I+HYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  240 bits (613), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNL+GTGKVDKA+IYSRAGDA+WATSGGL+LQP EI EI QGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQT++IAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  240 bits (613), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNL+GTGKVDKA+IYSRAGDA+WATSGGL+LQP EI EI QGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQT++IAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  239 bits (610), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLLGTGKVDKA+IYSRAGD+IWA+SGGL LQ  EI EIAQGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQTILIAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  238 bits (608), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGKVDKA+IYSRAGD++WATSGG  LQ  EISEI QGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQT+L+AHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  238 bits (606), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNL+GTGKVDKA+I+SRAGDAIWATSGGL+LQP EI EI QGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGV+CVRTKQT++IAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  236 bits (603), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 109/126 (86%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGK+DK++IYSRAGDA+WA+SGGL LQPAEISEIA+GFDNP+GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LH+Q QKFMLI+ADDRSIYGRH+AEG+V VRTKQTILI HYPPGVQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  235 bits (599), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 109/126 (86%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLLGTGKVDKA+IYSRAGD++WATSGGL LQP EIS I  GFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LH+Q QKFM +RADDRSIYGRHDAEGV+CVRTKQTIL+AHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  233 bits (594), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLL T KVD+A+IYSRAGDA WATSGG+ LQP EI+EIAQGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQTI+IAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  231 bits (589), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQA TDNLL TGKVD+A++YSRAGD++WATSGGL LQP EI+EIA+GFDNP GLQSNG
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LH+Q QKFML+RADD+SIYGRHDAEG+VCVRT QTILIAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV+Y
Sbjct: 121 LISVKY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  230 bits (587), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNL+ TGKVDKAIIYSRAGD IWA+SGG++L+  EISEI+QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQSQKFML+RADDRSIYGRH+AEG++ VRTKQTILIAHYP GVQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  229 bits (584), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGKVDKA IYSRAGD IWA+SGGL L+P+EI EI+QGFDN  GLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RAD+RSIYGRH+AEGVV VRTKQTILIAHYP GVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  227 bits (579), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGK+DKA++YSRAGDA+WA+SGGL L   EIS IAQGFD+P+ LQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFM++RADDRSIYGRHDAEGVVCVRTKQTIL+AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  227 bits (578), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLLGTGK+DKA IYSRAGD++WA SGGL+L   EI EIAQGF+NP+GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LH+Q QKFMLIRADDRSIYGRHDAEGV+CVRTKQTIL+ HYP GVQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV Y
Sbjct: 121 LISVSY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  224 bits (570), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGKVDKA +YSRAGDA WA SGGL+L   E +EIA+GFD+P+GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQTI+IAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  215 bits (548), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 98/126 (77%), Positives = 110/126 (87%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQAYT+NLLGTGK+DKA IYSRAGD++WA+SGGL   P EI +IA GFD P+GLQS G
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           L +Q QKFML+RADDRSIY RHDAEG+ CVRTKQTI++AHYPP VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI  QY
Sbjct: 121 LIGAQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  214 bits (544), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 113/126 (89%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60
           MSWQA       TGKVDKA+IYSRAGD++WA+SGGL L   EI+EIA+GFDNP+GLQSNG
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120
           LH+QSQKFML+RADDRSIYGRHDAEG+VCVRTKQTI+IAHYPP VQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LISVQY 126
           LI VQY
Sbjct: 114 LIGVQY 119

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  114 bits (286), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 55/58 (94%)

Query: 69  MLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADYLISVQY 126
           MLIRADDRSIYGRHDAEGVVCVRTKQTIL+ HYP GVQAGEATKIVEQLADYLISV Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>YMR041C Chr13 complement(350966..351973) [1008 bp, 335 aa] {ON}
           ARA2NAD-dependent arabinose dehydrogenase, involved in
           biosynthesis of dehydro-D-arabinono-1,4-lactone; similar
           to plant L-galactose dehydrogenase
          Length = 335

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 33/70 (47%)

Query: 16  VDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNGLHIQSQKFMLIRADD 75
           VD A + +R   + W   G + L  + + E+    DN   ++SNG  + S+   L+    
Sbjct: 254 VDLADLATRYAISEWVGKGPVVLGVSSMEELKLALDNYEIVKSNGNRLSSKDGQLVEYIQ 313

Query: 76  RSIYGRHDAE 85
           ++I+  H  E
Sbjct: 314 KNIFKEHFNE 323

>ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} similar
           to uniprot|P43561 Saccharomyces cerevisiae YFL041W
          Length = 630

 Score = 29.6 bits (65), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 27/58 (46%)

Query: 36  LNLQPAEISEIAQGFDNPTGLQSNGLHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTK 93
           L LQ        +G+D P  +   GL   +++F L   D+R +Y  +D +    VR K
Sbjct: 294 LQLQWTHQVAYDKGYDWPKTIDVGGLENAAEEFYLQPLDNRELYDDYDVQITFDVRMK 351

>CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar to
           uniprot|P38623 Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or uniprot|P38622 Saccharomyces
           cerevisiae YGL158w RCK1
          Length = 514

 Score = 28.9 bits (63), Expect = 3.3,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 20/36 (55%)

Query: 32  TSGGLNLQPAEISEIAQGFDNPTGLQSNGLHIQSQK 67
           +S GLNL   +  +I   F+  TG+Q     ++++K
Sbjct: 445 SSNGLNLHSTQKEQIRNFFNTATGIQQENFKVETEK 480

>NCAS0C02740 Chr3 (515889..517364) [1476 bp, 491 aa] {ON} Anc_8.427
           YLR227C
          Length = 491

 Score = 27.7 bits (60), Expect = 7.9,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 51/134 (38%), Gaps = 24/134 (17%)

Query: 3   WQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNGLH 62
           W+ + D    T K+D+  I +     +  T  G  +   EIS+I    DN T  Q    H
Sbjct: 363 WERFND----TTKLDRQSITTHLPRILLKTLRGSIIMVEEISDIESDSDNETSSQMISNH 418

Query: 63  ------IQSQKFMLIRADDR---SIYGRHDAE----------GVVCVRTKQTILIAHYPP 103
                 I   KFM +R   +    I+ RH  +          GV  +R  Q     H   
Sbjct: 419 KYKYEIISKLKFMKLRVKQKWNDGIHSRHSHKSDKYKKRWDLGVEWIRLWQKGYSEHNDT 478

Query: 104 GVQAGEATKIVEQL 117
            V  G AT ++EQ 
Sbjct: 479 KVD-GMATFLLEQF 491

>Skud_13.197 Chr13 complement(337502..338557) [1056 bp, 351 aa] {ON}
           YMR041C (REAL)
          Length = 351

 Score = 27.7 bits (60), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 31/70 (44%)

Query: 16  VDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNGLHIQSQKFMLIRADD 75
           +D A + +R   A W   G + L  + + E+    DN   ++ NG  + S+   L+    
Sbjct: 267 IDLADLATRYAIAEWIGKGPVVLGVSSMEELKSALDNYENVKYNGNKLSSKDEKLVNFIQ 326

Query: 76  RSIYGRHDAE 85
           ++ +  H  E
Sbjct: 327 KNFFREHFNE 336

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,611,100
Number of extensions: 430779
Number of successful extensions: 812
Number of sequences better than 10.0: 26
Number of HSP's gapped: 812
Number of HSP's successfully gapped: 26
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)