Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02618g5.438ON1041045416e-73
Kwal_55.214145.438ON1191034143e-53
NCAS0F034105.438ON1061034021e-51
CAGL0A02882g5.438ON1041034011e-51
TDEL0D026305.438ON1021043993e-51
KNAG0C048805.438ON1041043923e-50
KLLA0E02267g5.438ON1031043821e-48
KLTH0F15972g5.438ON1031033821e-48
ACL169W5.438ON1031043761e-47
Ecym_45095.438ON1031043594e-45
ZYRO0F10120g5.438ON1051013525e-44
Kpol_1016.35.438ON971033481e-43
NDAI0B057005.438ON1041043239e-40
Kpol_1016.3asingletonON971032924e-35
TPHA0C00950singletonON991032511e-28
KAFR0D02490singletonON107952084e-22
TBLA0C05870singletonON1001041858e-19
KAFR0D02400singletonON114901651e-15
KAFR0D02500singletonON112901502e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02618g
         (104 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   213   6e-73
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   164   3e-53
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     159   1e-51
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   159   1e-51
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   158   3e-51
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   155   3e-50
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   151   1e-48
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   151   1e-48
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   149   1e-47
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   142   4e-45
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   140   5e-44
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   138   1e-43
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   129   9e-40
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   117   4e-35
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                101   1e-28
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      85   4e-22
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    76   8e-19
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                68   1e-15
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      62   2e-13

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  213 bits (541), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104
           TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  164 bits (414), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 88/103 (85%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWCV+VYDK  +DRS FRPAHL GIP LVE+GKLVCAGAI+ ++  EGK  NFAGS L
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103
            IVAD+KEEAL +VK DVFAKEGIWDLENI+I+PFGCAVR+ K
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  159 bits (402), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 85/103 (82%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWCV+VYDKP +DRS FRP HLA IP LVEQGKLVCAGAI+NE   EG+   FAGS L
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103
            I+AD+KEEAL +V ND+FAKEGIWD +NI+I+ FGCAVR+ K
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  159 bits (401), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 76/103 (73%), Positives = 84/103 (81%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWCV+VYDKP +DRS  RP HLAGIPPLVE GKLVCAGAI+NE  Q G    FAGS L
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103
            IVAD+KEEAL +V NDVFAK GIWDLENI+I+ FGCAVR+ K
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  158 bits (399), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 86/104 (82%), Gaps = 2/104 (1%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEW V+VYDK   DRS FRPAHLAGIPPLVEQGKLVCAGAI+NE    G    FAGS L
Sbjct: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104
            IVAD+KEEAL VVK D+FAKEG+WDL+NI+I+ FGCAVRKEKK
Sbjct: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  155 bits (392), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 83/104 (79%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWC VVYDKP +DRSQFRP HLA IP LV+QGKLVCAGAI+NE    G    FAGS L
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104
            IVAD+KEEAL V+  DVFAKEGIWDL NI+++ FGCAVR+ KK
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  151 bits (382), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 87/104 (83%), Gaps = 1/104 (0%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEW V+VYDKP +DRS  RP HLAGIPPLVE GK+V AGAI+ ++  +GKP NFAGS L
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDV-VDGKPANFAGSHL 59

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104
           TIVADSK+E + ++KNDVFAK  IWD++N LI+PFGCAVRKEK+
Sbjct: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  151 bits (382), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 85/103 (82%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWCV+V+DK  +DRS  RPAHL G+    E+G LVCAGAI++E+  +GKP NFAGS L
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103
            I A++KE+AL VVKND+FAKEGIWDLENI+I+PFGCAVR+ K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  149 bits (376), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 86/104 (82%), Gaps = 1/104 (0%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWC ++YDKP  DRS  R  HLA IP LVEQGKLV AGAI+ E+  +G+P  FAGSQL
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVV-DGRPSQFAGSQL 59

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104
           T+VADS+EEAL ++++D FAK G+WD+EN++++PFGCAVRKEK+
Sbjct: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  142 bits (359), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 64/104 (61%), Positives = 85/104 (81%), Gaps = 1/104 (0%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWCV VYDKP +DRS +R  HL  IP LV++GK+V AGAI+ ++  +GKP  FAGS L
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDL-VDGKPGGFAGSHL 59

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104
            +VAD++EE + ++K D++AKEG+WD++NILIFPFGCAVRKEK+
Sbjct: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  140 bits (352), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 82/101 (81%), Gaps = 2/101 (1%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEW V+ +DK  ADRS +R  HLAGIPP VE GKLVCAGAI+NE    G+P  FAGS L
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRK 101
            +VAD+KEEA+ +VK+D+FAKEG+WDL+N++++ FGCA+R+
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  138 bits (348), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 83/103 (80%), Gaps = 6/103 (5%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWCV++ DK  +DRS+ RP HLAGIPPLVEQGKL CAGAI+N+   +G   +FAGS L
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYND---DG---SFAGSHL 54

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103
            IVAD+KE+AL VVK DVFA  GIWDL++I+I+ FGCAVR+ K
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  129 bits (323), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 76/104 (73%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           MVEWCV++ DK  +DRS F   H AGIP LVEQGK+VC GAI+NE  +EG     AGS L
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104
            +VAD+KEE + +VK D+FAKEGIWD++N +I+ F  A+R  KK
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  117 bits (292), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (71%), Gaps = 6/103 (5%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           M EWC+++ DK  ++RS+    H AGI PLVEQG L C GAI+N+   +G   + AGS L
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYND---DG---SVAGSHL 54

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103
            IVAD+KE+AL VVK DVFA  GIWDL++I+I+ F CAVR+ K
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score =  101 bits (251), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 69/103 (66%), Gaps = 8/103 (7%)

Query: 1   MVEWCVVVYDKPNAD--RSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGS 58
           M E+ VV+ D   A+  R Q  P H   IPPLV+ G +VC GA+FNE   EG P+   GS
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNE---EGSPV---GS 54

Query: 59  QLTIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRK 101
            + IVADS+E+ L ++K DVFA+E +WDLE+ +I+ F CAVRK
Sbjct: 55  HIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRK 97

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 84.7 bits (208), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 6/95 (6%)

Query: 1  MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
          M EW V V DKP ADR+ +   HLA +P L E+  LV AGA+   I   GK +   GS  
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGAL---IGDNGKEV---GSSF 54

Query: 61 TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPF 95
           +VA+SKE+A+ V+KND+FAKEG+++L++ + + F
Sbjct: 55 QVVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 75.9 bits (185), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 6/104 (5%)

Query: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
           M EW V + D PN+DR+     H+  +P L+  G L C GA+ ++        N  GS  
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDDNG------NMIGSHF 54

Query: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104
            +  ++KEEA+ ++  D F K G+WD+ +I I  F C  R+E K
Sbjct: 55  ELKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHREEYK 98

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 68.2 bits (165), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 56/90 (62%), Gaps = 6/90 (6%)

Query: 1  MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
          M EW V V D  + DR+ + P H+  +P LV+ G +V AGA+      EGK +   G   
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGALTT---PEGKEI---GGMF 54

Query: 61 TIVADSKEEALGVVKNDVFAKEGIWDLENI 90
           + A +KEEA+ +VK DVFA++GI++++++
Sbjct: 55 IVTAKTKEEAIEIVKRDVFARKGIFNMDSV 84

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 62.4 bits (150), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (57%), Gaps = 6/90 (6%)

Query: 1  MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60
          M EW V + D   ADR+ + P H+  +  L ++  LV AGA+      EGK     G  L
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGAL---TTPEGKE---TGGIL 54

Query: 61 TIVADSKEEALGVVKNDVFAKEGIWDLENI 90
           I A +KEEA+ VVK DVFA++GI+ ++ I
Sbjct: 55 IIAAKTKEEAIEVVKRDVFARKGIFKMDTI 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,312,038
Number of extensions: 422349
Number of successful extensions: 707
Number of sequences better than 10.0: 20
Number of HSP's gapped: 695
Number of HSP's successfully gapped: 20
Length of query: 104
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 30
Effective length of database: 44,996,115
Effective search space: 1349883450
Effective search space used: 1349883450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)