Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02596g5.437ON40040021420.0
Kwal_55.214155.437ON3893838681e-113
KLTH0F15994g5.437ON3903778351e-108
KAFR0E038205.437ON3963726752e-84
NDAI0B056905.437ON4233796606e-82
AER404C5.437ON3863626515e-81
TDEL0B021805.437ON4183726251e-76
Suva_2.5425.437ON4423726033e-73
YDR370C5.437ON4423696024e-73
Smik_4.6365.437ON4463676026e-73
Skud_4.6395.437ON4423735956e-72
NCAS0F034005.437ON4153875796e-70
KLLA0E02245g5.437ON4033605673e-68
ZYRO0F10098g5.437ON3733625556e-67
KNAG0C048905.437ON4054094853e-56
Kpol_1016.45.437ON4133774672e-53
CAGL0A02860g5.437ON4023574636e-53
TBLA0A028005.437ON4533924386e-49
TPHA0J026005.437ON4413863538e-37
AFR263C3.570ON3762351409e-09
TPHA0G036503.570ON3772351354e-08
KLLA0E12893g3.570ON3843001337e-08
CAGL0C01925g3.570ON4003101329e-08
AFR262CsingletonON7752341331e-07
Smik_7.153.570ON3872431283e-07
KAFR0J001603.570ON3803631256e-07
NDAI0I032603.570ON3773651257e-07
KNAG0D029703.570ON3863961231e-06
Kwal_47.192763.570ON3862991231e-06
NCAS0E002403.570ON3802241203e-06
YGL246C (RAI1)3.570ON3872551193e-06
Kpol_380.83.570ON3792691194e-06
Ecym_26003.570ON3842261176e-06
Suva_7.153.570ON3892521168e-06
Skud_7.213.570ON3892451168e-06
ZYRO0E09592g3.570ON3802871114e-05
SAKL0F00726g3.570ON3832211089e-05
TDEL0D063803.570ON3782041061e-04
KLTH0G00660g3.570ON3832761025e-04
KNAG0I002103.570ON374305930.005
TBLA0E001803.570ON378187830.086
Kpol_1060.146.302ON38980722.0
Suva_2.3838.425ON1319106732.0
NCAS0D012402.393ON183115702.1
TPHA0D036806.302ON38980713.2
Suva_4.5016.155ON48969694.9
KNAG0I024206.302ON38961686.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02596g
         (400 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   829   0.0  
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   338   e-113
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   326   e-108
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   264   2e-84
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   258   6e-82
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   255   5e-81
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   245   1e-76
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   236   3e-73
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   236   4e-73
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   236   6e-73
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   233   6e-72
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   227   6e-70
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   223   3e-68
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   218   6e-67
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   191   3e-56
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   184   2e-53
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   182   6e-53
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   173   6e-49
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   140   8e-37
AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON} S...    59   9e-09
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    57   4e-08
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    56   7e-08
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    55   9e-08
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    56   1e-07
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    54   3e-07
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    53   6e-07
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     53   7e-07
KNAG0D02970 Chr4 (535257..536417) [1161 bp, 386 aa] {ON} Anc_3.5...    52   1e-06
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    52   1e-06
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    51   3e-06
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    50   3e-06
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    50   4e-06
Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar...    50   6e-06
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    49   8e-06
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    49   8e-06
ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} simila...    47   4e-05
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    46   9e-05
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    45   1e-04
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    44   5e-04
KNAG0I00210 Chr9 complement(24413..25537) [1125 bp, 374 aa] {ON}...    40   0.005
TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}...    37   0.086
Kpol_1060.14 s1060 complement(38802..39971) [1170 bp, 389 aa] {O...    32   2.0  
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    33   2.0  
NCAS0D01240 Chr4 complement(226870..227421) [552 bp, 183 aa] {ON...    32   2.1  
TPHA0D03680 Chr4 (775188..776357) [1170 bp, 389 aa] {ON} Anc_6.3...    32   3.2  
Suva_4.501 Chr4 complement(873617..875086) [1470 bp, 489 aa] {ON...    31   4.9  
KNAG0I02420 Chr9 (465065..466234) [1170 bp, 389 aa] {ON} Anc_6.3...    31   6.6  

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/400 (100%), Positives = 400/400 (100%)

Query: 1   MTIPTDELTADISKLSLQHGSQNTANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVS 60
           MTIPTDELTADISKLSLQHGSQNTANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVS
Sbjct: 1   MTIPTDELTADISKLSLQHGSQNTANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVS 60

Query: 61  SGKYLFDDKLGLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNM 120
           SGKYLFDDKLGLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNM
Sbjct: 61  SGKYLFDDKLGLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNM 120

Query: 121 DGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSLEEANLIVTHLDGLLIIS 180
           DGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSLEEANLIVTHLDGLLIIS
Sbjct: 121 DGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSLEEANLIVTHLDGLLIIS 180

Query: 181 SDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVS 240
           SDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVS
Sbjct: 181 SDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVS 240

Query: 241 LLLQAEMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPY 300
           LLLQAEMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPY
Sbjct: 241 LLLQAEMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPY 300

Query: 301 YNQLDALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDE 360
           YNQLDALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDE
Sbjct: 301 YNQLDALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDE 360

Query: 361 PLQSFKLTLTRDLQLSLTKLANTPAGLIPEKFLNSRLAAK 400
           PLQSFKLTLTRDLQLSLTKLANTPAGLIPEKFLNSRLAAK
Sbjct: 361 PLQSFKLTLTRDLQLSLTKLANTPAGLIPEKFLNSRLAAK 400

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  338 bits (868), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 167/383 (43%), Positives = 256/383 (66%), Gaps = 12/383 (3%)

Query: 8   LTADISKLSLQHGSQNT-ANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLF 66
           +  ++  LSLQ  ++   ANCK F H+ ++ FP     FF E +E+ T T ++ + ++L 
Sbjct: 1   MLPNLQDLSLQDRTEEVHANCKNFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLL 60

Query: 67  DDKLGLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNF 126
           DDKLG+  L  D+CE+  +  K A+K K  Y+G+DLL+ F++Y+P++  +L +M G+  F
Sbjct: 61  DDKLGMPELVQDLCEFTES-GKLANKGK--YIGHDLLDHFDEYVPITPKQLEDMAGVQAF 117

Query: 127 IGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSLEEANLIVTHLDGLLIISSDKSKP 186
           +  W++ +G+ +     FTIV +RH+LIDLIM PFS E+ +L +   +G L +S D    
Sbjct: 118 LERWKQLHGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLNLSPDAQYQ 177

Query: 187 KVDSGIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAE 246
           K D GI S DT+++K+CYTGFELENL+T      P + + FYS+VE KL +G+ LLL+AE
Sbjct: 178 KTDQGIHSGDTKIKKICYTGFELENLITA--TSKPDVRSSFYSLVEGKLGDGIKLLLKAE 235

Query: 247 MDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDA 306
           MD +N  T +Y E+KCS   ++K++ HRRKLLRMW+QT LVP T+LLVG RDPYY+QL +
Sbjct: 236 MDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTS 295

Query: 307 LKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITEL----VDKNLTDEPL 362
            + YTR ++Y+KF+ + L   RK YN+N+T++VQW  HVI ++ ++    ++K   +E  
Sbjct: 296 FECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEV- 354

Query: 363 QSFKLTLTRDLQLSLTKLANTPA 385
            +F+LTL ++L + L K+  TPA
Sbjct: 355 -NFRLTLRKNLTIKLRKMPETPA 376

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  326 bits (835), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 248/377 (65%), Gaps = 9/377 (2%)

Query: 12  ISKLSLQH-GSQNTANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKL 70
             KLSL+    +   +C+GF  +++SHFP+ P  FF E +EIGT T  + S K+    K 
Sbjct: 5   FEKLSLEDLPDEACVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQ 64

Query: 71  GLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNW 130
               LK D+   +    K  +K  + Y+G+DLL  ++D+ PL+ ++L +M G+  F+  W
Sbjct: 65  SAPHLKKDLG--LFTITKKLAKTNS-YVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKW 121

Query: 131 EEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSLEEANLIVTHLDGLLIISSDKSKPKVDS 190
           E  +GK Y S + FTIV +RH+LIDLIM PFS E+ +  V +++G L I  DK   K D 
Sbjct: 122 EGDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDD 181

Query: 191 GIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSY 250
           GI S ++ +R++CYTGFELE+LVT+ +  +P   + FYS+V+ K+++ + LL +AEMD +
Sbjct: 182 GIYSSESNIRRICYTGFELEDLVTETQPGAPK--SAFYSLVQGKISKNIKLLFKAEMDCF 239

Query: 251 NPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPY 310
           NP   +Y E+KC+   ++K++ HRRKLLRMW+QT LVP TDLL+G RDPYY+QL + + Y
Sbjct: 240 NPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECY 299

Query: 311 TRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQ--SFKLT 368
           TR E+Y+KF+ RNL+  +K YN+N+ ++VQW  H++ ++ + +   +   P +  SFKLT
Sbjct: 300 TRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLT 359

Query: 369 LTRDLQLSLTKLANTPA 385
           LT+ L+L L K+  TP+
Sbjct: 360 LTKQLELRLRKI-ETPS 375

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  264 bits (675), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 144/372 (38%), Positives = 224/372 (60%), Gaps = 14/372 (3%)

Query: 28  KGFVHSNVSHFPSVPCKFFQESREIGTF-TRMVSSGKYLFDDKLGLRPLKDDICEYIHN- 85
           K F H ++++FP+ P  FFQ SRE+ T+    +        D L L  L  DI +     
Sbjct: 33  KRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPL--LNKDISKIAQGV 90

Query: 86  PAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFT 145
            A +A K K +Y+G DL  GFE++  +S +EL++      +I  WE  +  KY    K+T
Sbjct: 91  SAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYT 150

Query: 146 IVSNRHHLIDLIMCPFSLEEANLI-VTHL-DGLLIISSDKSKP-KVDSGIRSKDTRVRKL 202
           IVS RHH+++LIM  F   +  ++  T+L +GLL  S D S P  ++ GI +K+  ++K+
Sbjct: 151 IVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKI 210

Query: 203 CYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKC 262
           CY+GF LE+L+TK + +        +SI EN+L + ++LLL+ EMD+YN  T NY ELKC
Sbjct: 211 CYSGFALEDLLTKSQKEP------LFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKC 264

Query: 263 SVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTR 322
               ++ +  HR+KLL+ WIQTG++P +DL+ G R PY  +L  ++ Y+RD +Y++F+ R
Sbjct: 265 YAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNR 324

Query: 323 NLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQSFKLTLTRDLQLSLTKLAN 382
           NL EN+K  NFN+ +AV+WSHH I  I EL+  NL  +  Q+F++ +     +S+  L+ 
Sbjct: 325 NLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDAPQAFQIKVDTFRNISIRNLSK 384

Query: 383 TPA-GLIPEKFL 393
            P    IP ++L
Sbjct: 385 IPQNAQIPRQYL 396

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  258 bits (660), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 222/379 (58%), Gaps = 28/379 (7%)

Query: 28  KGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFD-DKLGLRPLKDDICEYIHNP 86
           K F H ++S +P  P  FF+ S+++  +       K L+  D   L P  +     + NP
Sbjct: 42  KQFKHCSISTYPKTPSSFFETSKDVALY-----HNKQLYSSDDTNLIPQLEPAIAKLANP 96

Query: 87  A---KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENK 143
           +     A  +K  YLG DL +G+E +IP+  DEL++++    +I +WE +N   Y   NK
Sbjct: 97  SCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNK 156

Query: 144 FTIVSNRHHLIDLIMCPFSLEEANLIVTHL------DGLLIISSDKSKPKVDSGIRSKDT 197
           FTIVS RHH++++ MC F+  + +  + ++      +G+L+ S D +K K D GI SKD 
Sbjct: 157 FTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNK-KDDGGIYSKDG 215

Query: 198 RVRKLCYTGFELENLVTKGKVDS---------PGMHTCFYSIVENKLTEGVSLLLQAEMD 248
            VRK+ Y+GF LE+L+T  K D           G     ++I+ENKL + +SLLL+ EMD
Sbjct: 216 VVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMD 275

Query: 249 SYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALK 308
           SYNP    + E+KC    ++ N NHRRKLL+ W+QTG++P +D+L+G RDP + +L+ ++
Sbjct: 276 SYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIE 335

Query: 309 PYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPL---QSF 365
            ++R  +Y++ + RNL E +   N+N+ +AVQWS H I  I +LVD+++    L   QSF
Sbjct: 336 WFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSF 395

Query: 366 KLTLTRDLQLSLTKLANTP 384
           ++ +     + + KL + P
Sbjct: 396 QIRINASRAIQIKKLKSVP 414

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  255 bits (651), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 149/362 (41%), Positives = 208/362 (57%), Gaps = 26/362 (7%)

Query: 30  FVHSNVSHFPSVPC---------KFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDIC 80
            V+ N+  FP  P          + F ESRE+GT  R      Y  DDK  L  L D+IC
Sbjct: 22  IVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFRQ--GLVYDLDDKKNLPLLNDEIC 79

Query: 81  EYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGS 140
           EYI + +K  SK+   Y+G DL    E + P++ +EL+ + G+L FI  WE  N   Y S
Sbjct: 80  EYISHRSK--SKL-IGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYAS 136

Query: 141 ENKFTIVSNRHHLIDLIMCPFSLEEANLIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVR 200
            +KFTIVS RHH++D++M PF  E   L+ T   GL +I+   S+    +GI S  +  R
Sbjct: 137 RSKFTIVSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLAPSQRP--TGINSPSSATR 194

Query: 201 KLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVEL 260
           K+CYTGFELE L+T       G    FYS +E KL   +++LLQ EMD+YNPK   Y E+
Sbjct: 195 KICYTGFELERLLTATSGTERG---SFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEI 251

Query: 261 KCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFS 320
           K SV+F ++N  H  KLL++W QT L+P TD+LVGFRDP  + L  + PY+ D+I +K  
Sbjct: 252 KSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLY 311

Query: 321 TRNLNENR-KYYNFNSTVAVQWSHHVIAKITE----LVDKNLTDEPLQSFKLTLTRDLQL 375
            R+   +   Y+NFN  VA  W+H+ I +I E    LVD   T    QSF + + ++LQ+
Sbjct: 312 IRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDA--TSSSPQSFLVEIDKNLQM 369

Query: 376 SL 377
            +
Sbjct: 370 KI 371

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  245 bits (625), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 141/372 (37%), Positives = 209/372 (56%), Gaps = 18/372 (4%)

Query: 30  FVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAKN 89
           F HS++ +FP     FF+   E+ T+        YLF      +PL   +  +    A+N
Sbjct: 55  FEHSDLDYFPDDTADFFEGCEEVATY-----QNGYLFMKDSSKKPLYPCLQMFAALIAEN 109

Query: 90  -ASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVS 148
              K K  Y+G DL  G E Y PL   EL++      +I  WE +   K  +  K TI+S
Sbjct: 110 RGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIIS 169

Query: 149 NRHHLIDLIMCPFSLEEANLIVTHL-DGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGF 207
            RHH++DL+M  F  +E ++I T++  G LI S D+SK + + G+ SK++  RK+CY+GF
Sbjct: 170 PRHHVVDLVMALFHDDEVSIICTNIGKGKLIFSGDRSKEERN-GLNSKNSMTRKICYSGF 228

Query: 208 ELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCSVNFQ 267
            LE+ +T    +  G    FYSIVE K+ E +SLLL+ EMD+YNP  + Y ELKC     
Sbjct: 229 ALEDKLTTSHDERMGP---FYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLN 285

Query: 268 LKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRNLNEN 327
           ++++ HRRKLL+ W+Q GL+P +DL++G RD    QL+ L  Y+R  +YKKF+  ++  N
Sbjct: 286 VQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARN 345

Query: 328 RKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEP------LQSFKLTLTRDLQLSLTKLA 381
            KY NFN+ +AV+W  H I  I +LV KN    P       +SFK+ + +   + + KL 
Sbjct: 346 NKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLT 405

Query: 382 NTPAGL-IPEKF 392
             P  + IP  F
Sbjct: 406 KVPRHVQIPRAF 417

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  236 bits (603), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 134/372 (36%), Positives = 224/372 (60%), Gaps = 23/372 (6%)

Query: 29  GFVHSNVSHFPS-VPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPA 87
            F+H+++ +FP+  P   F ES+E+  FT    +  Y+   K  +  LK+DI     +P 
Sbjct: 70  SFLHTSIRNFPTKPPPDIFYESKEVALFT---DNQLYVAARKDVIPNLKEDISHLYESPL 126

Query: 88  KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKN-GKKYGSENKFTI 146
             A K+KT YLG DL    ++ +P++  EL+ +   +++I +W   N GK +    KFT+
Sbjct: 127 LEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKFTV 186

Query: 147 VSNRHHLIDLIMCPFSL--EEANLIVTHL-DGLLIISSDKSKPKVD-----SGIRSKDTR 198
           V+ RHH++DL M PF    ++ ++I T++ +G + +S +   PK D      GI S D  
Sbjct: 187 VTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRN---PKYDHKASKEGIYSGDPN 243

Query: 199 VRKLCYTGFELENLVTKGKVDS-PGMHTC-FYSIVENKLTEGVSLLLQAEMDSYNPKTDN 256
           ++K+C++GFE EN +T+   +S      C  +SIVE KL+E + LL++ EMD++NP +  
Sbjct: 244 IKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKT 303

Query: 257 YVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIY 316
             ELKC     ++NS+HR+KLL+ WIQTGL+P +D++VG RD Y  QL  ++ Y+RD ++
Sbjct: 304 NTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLF 363

Query: 317 KKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLT----DEPLQSFKLTLTRD 372
           +KF+   L  N+K  N+N+ VAV+W  H I  I +LV+ N++    ++P + F++ +  +
Sbjct: 364 RKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKP-EPFEINIDAN 422

Query: 373 LQLSLTKLANTP 384
             + +TKL+  P
Sbjct: 423 GTIIITKLSTIP 434

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  236 bits (602), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 136/369 (36%), Positives = 219/369 (59%), Gaps = 17/369 (4%)

Query: 29  GFVHSNVSHFPSVPCK-FFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPA 87
            F+H+ + +F + P +  F ES+E+  FT   +   Y    K  +  LK+ I E   +  
Sbjct: 70  SFLHTGMHNFLTKPPRDIFHESKEVALFT---NGRAYTILRKDLIPNLKESIAELYESSL 126

Query: 88  KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKN-GKKYGSENKFTI 146
             A K K  YLG+DL    ++++P++  EL+++    ++I NW   N GK +    KFT+
Sbjct: 127 LEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKKFTV 186

Query: 147 VSNRHHLIDLIMCPFSLE--EANLIVTHLD-GLLIISSDKSKPKVDS--GIRSKDTRVRK 201
           V+ RHH++DL M  F+    + +LIVT++  GLL    +  K    S  GI S D  ++K
Sbjct: 187 VTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKK 246

Query: 202 LCYTGFELENLVTKGK--VDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVE 259
           +CY+GFE EN VT+     D  G     +S+VE+KL+E + LL++ EMD++NP ++   E
Sbjct: 247 ICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPVSETNTE 306

Query: 260 LKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKF 319
           LKC     + NSNHRRKLL+ W+QTGL+P +D+++G RD +  QL  ++ Y+RD + KKF
Sbjct: 307 LKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDLLCKKF 366

Query: 320 STRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTD----EPLQSFKLTLTRDLQL 375
           +   L  N+K  N+N+ +AV+W H+ I  I +LV+ N++D    +P +SF++ +  +  +
Sbjct: 367 NHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKP-ESFEIGIDTNNAI 425

Query: 376 SLTKLANTP 384
            +TKL  TP
Sbjct: 426 VITKLKTTP 434

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  236 bits (602), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 134/367 (36%), Positives = 211/367 (57%), Gaps = 15/367 (4%)

Query: 30  FVHSNVSHFPSVPCK-FFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAK 88
           F HS +  FP+ P +  F ES+E+  FT   +   Y    K  L  LK DI E       
Sbjct: 71  FSHSGMHKFPAKPPRDIFHESKEVALFT---NGQAYTTVRKDILPNLKGDIAELCERSLL 127

Query: 89  NASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKN-GKKYGSENKFTIV 147
           +A + K  YLG+DL      ++P++  EL+++   +++I NW   N G+ +    KFT+V
Sbjct: 128 DARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKFTVV 187

Query: 148 SNRHHLIDLIMCPFSL--EEANLIVTHLDGLLIISSDKSKPKV---DSGIRSKDTRVRKL 202
           + RHH++D+ M  F    ++ +L+ T++   LI  S   K        GI S D  ++K+
Sbjct: 188 TTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNMKKI 247

Query: 203 CYTGFELENLVTKG--KVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVEL 260
           CY+GFE EN VT+G    D  G     +S+VE+KL+E + LL++ EMD++NP +    EL
Sbjct: 248 CYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGANTEL 307

Query: 261 KCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFS 320
           KC     + NSNHRRKLL+ WIQTGL P +D+++G RD +  QL  ++ Y+RD +  KF+
Sbjct: 308 KCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCMKFN 367

Query: 321 TRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPL---QSFKLTLTRDLQLSL 377
              L  N++  N+N+ VAV+W +H I  I EL+  N++D      +SF++++  +  +++
Sbjct: 368 HSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNNTIAI 427

Query: 378 TKLANTP 384
           TKL N P
Sbjct: 428 TKLKNIP 434

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  233 bits (595), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 135/373 (36%), Positives = 216/373 (57%), Gaps = 19/373 (5%)

Query: 29  GFVHSNVSHFP-SVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPA 87
            FVH+++       P   FQ+S+E+  FT   +   Y    K  +  L+D I E   +  
Sbjct: 70  SFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQA---YTTARKDLIPSLRDGITELYESSL 126

Query: 88  KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKN-GKKYGSENKFTI 146
             A + K  YLG+DL    + ++P++  EL+++   ++++ NW+  N GK +    KFTI
Sbjct: 127 LEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTI 186

Query: 147 VSNRHHLIDLIMCPFSL--EEANLIVTHLDGLLIISSDKSKPKVD-----SGIRSKDTRV 199
           VS RHH++DL M  F    +  +LIVT++   LI  S    PK D      GI S D  +
Sbjct: 187 VSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLI--SFSRNPKNDFQMSKEGIYSSDPNM 244

Query: 200 RKLCYTGFELENLVTKG--KVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNY 257
           +K+CY+GFE E+ VT+     D  G     +S+VE+KL+E + LL++ E+D++NP +   
Sbjct: 245 KKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRTN 304

Query: 258 VELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYK 317
            ELKC     + NSNHR+KLL+ WIQTGL+P +D+++G RD +  QL  ++ Y+RD +YK
Sbjct: 305 TELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYK 364

Query: 318 KFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLT---DEPLQSFKLTLTRDLQ 374
           KF+   L  ++K  NFN+ VAV+W +H I  I ELV+ N++       +SF++++  +  
Sbjct: 365 KFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANGT 424

Query: 375 LSLTKLANTPAGL 387
           +++TKL   P  +
Sbjct: 425 IAITKLNTVPKNV 437

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  227 bits (579), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 218/387 (56%), Gaps = 33/387 (8%)

Query: 30  FVHSNVSHFPSVPCKFFQESREIGTFT--RMVSSGKYLFDDKLGLRPLKDDICEYIHNPA 87
           F HS++S FP+    F++ S ++  +   ++  + +Y       +  LK+DI +     A
Sbjct: 31  FSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDI-----IPHLKNDIAQLPKKSA 85

Query: 88  KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIV 147
             A  +K  YLG DL +GFE ++P+S  +L++++  ++FI +WE K   KY    KF IV
Sbjct: 86  SEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIV 145

Query: 148 SNRHHLIDLIMCPFSLEEANL------------IVTHLD--GLLIISSDKSKP--KVDSG 191
           S RHH++++ M  F+ +  N             +V   D  G L+ + D S     ++ G
Sbjct: 146 STRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEG 205

Query: 192 IRSKDTRVRKLCYTGFELENLVTKGKVDSP-------GMHTCFYSIVENKLTEGVSLLLQ 244
           I SK+  ++++CY+GF LE+L+T+   +         G     +++VENKL + + +LL+
Sbjct: 206 IYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVENKLDDDICILLR 265

Query: 245 AEMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQL 304
            E+D++N     + ELKC    ++ N +HRRKLL+ W+QTG++P +D+L+G RD  + +L
Sbjct: 266 CELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGEL 325

Query: 305 DALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPL-- 362
           + ++ Y+RD +  K + RNL E++  +NFN+ VA QWS H I  I +LVD+NL  + +  
Sbjct: 326 EDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISN 385

Query: 363 -QSFKLTLTRDLQLSLTKLANTPAGLI 388
            Q F++ +     + +  L+  P  ++
Sbjct: 386 PQGFQIRIDSRRNIRIKCLSKVPKDIL 412

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  223 bits (567), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 128/360 (35%), Positives = 210/360 (58%), Gaps = 16/360 (4%)

Query: 26  NCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHN 85
           +CK F H +V++      K   + +E+   + +++    L+++      L+ ++C YI +
Sbjct: 43  SCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKD 102

Query: 86  PAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFT 145
                  +K  ++G DL  G++DY+PL  + LN++  +      +E     K  +  K T
Sbjct: 103 SKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYE-----KTLNPEKTT 157

Query: 146 IVSNRHHLIDLIMCPFSLEEANLIVT-HLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCY 204
            VS RHH+ID+IMCPF  E  +L++T   D  ++IS DKSK K +    ++++  +K+CY
Sbjct: 158 FVSLRHHIIDIIMCPFLDEPLSLLMTVQPDKNILISVDKSKDKPNGIHETRNSFNKKICY 217

Query: 205 TGFELENLVTKGKVDSPGM-HTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCS 263
           TGF LE+L+ +   +   + H  +YSIV   L + + LL+QAEMDS N  TD Y E+K S
Sbjct: 218 TGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSS 277

Query: 264 VNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRN 323
           V+F+L N+ HRRKLLRMWIQT L+P++DLL+GFR+ Y N+L+ LK Y   +IY K +  +
Sbjct: 278 VHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSS 337

Query: 324 L-NENRKYYNFNSTVAVQWSHHVIAKITELVDKNL----TDEPLQSFKLTLTRDLQLSLT 378
           +  +  K+Y FN  VA  W  H+     +++ +NL     +    +FK+ +  +L LS++
Sbjct: 338 IVGKPGKFYKFNPNVANDWFQHIF----QVLKQNLLLLSQESTSTTFKVQIDTNLTLSIS 393

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  218 bits (555), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 123/362 (33%), Positives = 198/362 (54%), Gaps = 22/362 (6%)

Query: 30  FVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFD---DKLGLRPLKDDICEYIHNP 86
           F HS+   FPS P   F + +E   +      G  L D   D +GL+   + +       
Sbjct: 21  FQHSSAFRFPSEPRNLFTKYKEASYYY-----GGQLHDSISDSIGLKSPGNKLSH----- 70

Query: 87  AKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTI 146
              +   K  +LG DL  G+ED++PLS + L++  G   +I  WE  N   Y   + F +
Sbjct: 71  -DRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVV 129

Query: 147 VSNRHHLIDLIMCPFSLEEANLIVTHL-DGLLIISSDKSKPKVDSGIRSKDTRVRKLCYT 205
           +S RH+L++L M  F   + +++ THL DG +++S  ++  K         T  +K+ ++
Sbjct: 130 ISPRHYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTTMTKKILHS 189

Query: 206 GFELENLVTKGKV--DSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCS 263
           G+ LE+L+T+G    D P     F++I+E +L   +SL+L+ E+DSYN  T+ + ELKC 
Sbjct: 190 GYALEDLLTRGPRVEDDP-----FFAIIEAELDANISLVLRCELDSYNELTETFTELKCY 244

Query: 264 VNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRN 323
               + N+ HR KLL+ WIQ  + PR DLL+G R+ +   L  L+ +T  E+Y+K + RN
Sbjct: 245 APLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRN 304

Query: 324 LNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQSFKLTLTRDLQLSLTKLANT 383
           L ++ K +N+N+ +AVQW  H I  I +LV +N+     Q FKLT+    ++ L KL + 
Sbjct: 305 LPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSSPQCFKLTIDESHKIQLEKLKHV 364

Query: 384 PA 385
           PA
Sbjct: 365 PA 366

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  191 bits (485), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 207/409 (50%), Gaps = 27/409 (6%)

Query: 2   TIPTDELTADISKLSLQHGSQNTANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSS 61
            I TD+L     +LS+    Q     K F H +   + S P   FQ+S+E+  +T     
Sbjct: 7   AIETDDLLNSFHRLSIN--DQKRVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYT----G 60

Query: 62  GKYLFDD----KLGLRPL-KDDICEYIHNP-AKNASKIKTQYLGYDLLNGFEDYI-PLSE 114
           GK   +D     L + PL K+DI     +   + +   K++YLG  L  GFEDY+  +S 
Sbjct: 61  GKLYINDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSP 120

Query: 115 DELNNMDGILNFIGNWEE--KNGKKYGSENKFTIVSNRHHLIDLIMCPFSLE-EANLIVT 171
           D L++    L++I  W    K  KK+G   +  IV  RHHL++L M  F+ + +  L+ T
Sbjct: 121 DMLDSAKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCT 180

Query: 172 HLDGLLIISS---DKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFY 228
            L G  I+ S   D S+   + GI   D R R LCY+GF +  + +  +   P     FY
Sbjct: 181 VLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQF--FY 238

Query: 229 SIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVP 288
                 +  G       EMD+YN   ++Y ELKC     +K+S H+ KLLR W+QT + P
Sbjct: 239 --YGTPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSP 296

Query: 289 RTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAK 348
            TD+++G R+ Y   L  +   +R+ +Y+KF+ ++       +N+N+ VAV+WS + +  
Sbjct: 297 DTDVVIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKA 356

Query: 349 ITELVDKNLTDEPL---QSFKLTLTRDLQLSLTKLANTPA-GLIPEKFL 393
           I  L++ NL  + +   Q+F +T+ R   + + KL   P    IP++F+
Sbjct: 357 IIRLIEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEIPKEFI 405

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  184 bits (467), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/377 (33%), Positives = 204/377 (54%), Gaps = 22/377 (5%)

Query: 30  FVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAKN 89
           FVHSN   FP      F ES+ +  F +      ++  +   L  LK DI         N
Sbjct: 46  FVHSNARSFPQKTKDLFLESKTVAFFQK---DQLFINVEDAALPLLKKDIANISGKSVLN 102

Query: 90  ASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWE-EKNGKKYGSENKFTIVS 148
           + K K  YLG DL    + Y PL ED L++     +FI +WE E  G+ YG+   +TI+S
Sbjct: 103 SKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTILS 162

Query: 149 NRHHLIDLIMCPFSLEE---ANLIVTHL-DGLLIISSDKSKPKVDS---GIRSKDTRVRK 201
            RHH+ +++M  F  E+     L+ T+L +G++++S D +    +S   G+ S +   RK
Sbjct: 163 PRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPMTRK 222

Query: 202 LCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELK 261
           +CY+GF  E+LV +   ++       +S+VE+KLTE ++LLL+ E+D YN  T+ + ELK
Sbjct: 223 ICYSGFAFEDLVLEDIAENA---RPIFSVVESKLTESINLLLRNELDGYNNVTNMFTELK 279

Query: 262 CSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFST 321
           C     LK     +++L+ W+QTGL+P +D+++G RD     L+ L  Y R ++ + F+ 
Sbjct: 280 CFA--PLKCMFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNN 337

Query: 322 RNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTD--EPLQSFKLTLTRDLQLSLTK 379
            +L     ++NFN+ +AV+W    +  I  LV  ++ D   P  SFKL +     +S+ K
Sbjct: 338 PSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADSNHPC-SFKLKIDNHKTISIQK 396

Query: 380 LANTPAGL---IPEKFL 393
           L+  P  +   IP++F+
Sbjct: 397 LSRIPQTVQRQIPKEFV 413

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  182 bits (463), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 190/357 (53%), Gaps = 18/357 (5%)

Query: 35  VSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRP-LKDDICEYIHNPAKNASKI 93
            SH  ++P +F+  ++ +G F       K    +++ L P LKD I     +     +++
Sbjct: 53  TSHHKNMP-QFYDSAKTLGIF----HDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQL 107

Query: 94  KTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHL 153
              +LG  L    + Y P++  EL+  +    ++  +E  +G+KYG +  F IV+ RHH+
Sbjct: 108 VRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHM 167

Query: 154 IDLIMCPFSLE--EANLIVTHLDG-LLIISSDKSKPKVDS-GIRSKDTRVRKLCYTGFEL 209
           IDL + PFS +    NL+  +  G LL IS D +    D  G+ + +  ++K+C++GF L
Sbjct: 168 IDLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFAL 227

Query: 210 ENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCSVNFQLK 269
           E+++T+   D     T  + IVEN++     LL++ E+D+YNP T +Y ELKC   +   
Sbjct: 228 EDILTESANDEERNPT--FLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFG 284

Query: 270 NSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRNLNENRK 329
           N NHRRKLL+ WIQTG++P TD+++G RD     L  ++ Y R+ +Y K  +++L     
Sbjct: 285 NPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDS 344

Query: 330 YYNFNSTVAVQWSHHVI----AKITELVDKNLTDEPLQSFKLTLTRDLQLSLTKLAN 382
             N++  ++V W   +I      I  L+DK   DEP Q F + +  +  + +    N
Sbjct: 345 ELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEP-QLFSIKVDNNCNIRIEHRQN 400

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  173 bits (438), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 114/392 (29%), Positives = 202/392 (51%), Gaps = 34/392 (8%)

Query: 29  GFVHSNVSHFPSVPCKFFQESREIGTF--TRMVSSGKYLFDDKLGLRPLKDDICEYIHNP 86
            FV  + +HF       ++ S+E+ T+    +  +     +   G+  LKDDIC+     
Sbjct: 47  SFVKPSKTHF----SDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKS 102

Query: 87  AKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNG---KKYGSENK 143
             ++ K K +Y+G DL   +E Y  + ++ L++      +I  +++K+    KKYG + +
Sbjct: 103 LLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKE 162

Query: 144 FTIVSNRHHLIDLIMCPF---SLEEANLIVTHL-DGLLIISSDKSKPKVDSGIRSK-DTR 198
           F I+++RHH+ DL++ PF   S  E ++++T+L D  +++S D +    D     +    
Sbjct: 163 FVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNS 222

Query: 199 VRKLCYTGFELENLVTKGKVDS-------------PGMHTCFYSIVENKLTEGVSLLLQA 245
           +RK+  +GF  E+LV K    S             P +   ++S+VEN ++  +++LL++
Sbjct: 223 MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRS 282

Query: 246 EMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLD 305
           EMD YNP T++Y ELKC     + +  HR+KLL+ W+Q G +P +DLLVG RD     L+
Sbjct: 283 EMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLN 342

Query: 306 ALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQ-- 363
            +  ++RD++  K  +      R + N   T A  W +HV++ IT L    L   P    
Sbjct: 343 DITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPS 402

Query: 364 ----SFKLTLTRDLQLSLTKLANTPAGL-IPE 390
                F+L + ++  ++L  L   PA + IP+
Sbjct: 403 SVPVPFRLIVEKNRTITLLPLKKVPASVPIPD 434

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  140 bits (353), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 107/386 (27%), Positives = 193/386 (50%), Gaps = 30/386 (7%)

Query: 28  KGFVHSNVSHFPSVPCKFFQESREIGTF-----TRMVSSGKYLFDDKLGLRP--LKDDIC 80
           K F +SN +H        FQE++ +  +     T++ ++   L ++     P  L  DI 
Sbjct: 66  KHFSYSN-AHIGKSQPNIFQEAKGVALYYDKRITKITNNEAELINES---NPPFLTKDIS 121

Query: 81  EYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWE-EKNGKKYG 139
                   ++ K K  Y+GY+L +  E + P+    L++      ++   +  +  K Y 
Sbjct: 122 NLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLYN 181

Query: 140 SENKFTIVSNRHHLIDLIMCPFSLEEANL-----IVTHL-DGLLIISSDKSKPKVDSGIR 193
           +   +T ++ RHHL +L+M  +   E+ L     + T + D L++IS D +K    S   
Sbjct: 182 T--PYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQN 239

Query: 194 SK--DTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYN 251
            K  ++  +K+  +GF  E LV +   +    H  ++ I EN+LT   + ++++EMDSYN
Sbjct: 240 HKLQNSFSKKVINSGFTFEELVIENFQEC---HKPYFYISENRLTPKSTFIIRSEMDSYN 296

Query: 252 PKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYT 311
            KT+ + ELKC     L  + HR+KLL+ W QTGL P  D+++G RD     L+ L  Y+
Sbjct: 297 NKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYS 356

Query: 312 RDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTD---EPLQSFKLT 368
           R+ +Y+K    +L + +  ++F   + +QW +H I  I     K+ +D    P+ ++K+ 
Sbjct: 357 RENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPM-TYKVI 415

Query: 369 LTRDLQLSLTKLANTPAGL-IPEKFL 393
           + +   + + KL+  P  + IP  FL
Sbjct: 416 IDKHKSIIIKKLSIVPKNVEIPTDFL 441

>AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 376

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 111/235 (47%), Gaps = 33/235 (14%)

Query: 106 FEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFS--L 163
           F+D    +ED+  ++ G+L  +  +E +  KK  ++    I++ R  +  LI C F    
Sbjct: 66  FQDEQAEAEDDTGSLHGLLQTLMEYERRKSKKVNAD----IIAFRGQVKRLIHCAFGGHA 121

Query: 164 EEANLIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKGK------ 217
            + ++ V   DG L I +  ++ K++     +++      Y+G++ E +    +      
Sbjct: 122 TDVDMYVMSFDGQLFIRA--ARKKLEFPTSPRESWAYLAYYSGYKFERMALLDRPVAETP 179

Query: 218 ---VDSPGMHTC-----FYSIVENKLTEGVSLLLQAEMDSY----NPKTDN---YVELKC 262
              ++S G         + ++V   + E   L+L AE+D       P  DN   YVELK 
Sbjct: 180 REVLESRGKQVVRNGPQYKTVVRTGVGEH-KLVLGAEVDGIFDFREPTGDNLKHYVELKV 238

Query: 263 SVNFQ-LKNS-NHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEI 315
           +   Q LK++ N  +KL  +W+Q  LV    +++GFRD  +  L +++ ++  EI
Sbjct: 239 AKKVQTLKDATNFEQKLFSVWLQCFLVGINRVIIGFRDEKF-VLKSVEEFSTSEI 292

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 101/235 (42%), Gaps = 47/235 (20%)

Query: 99  GYDLLNG---FEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLID 155
           G DL  G   F+DY    +D  + + G+L+ + ++E+K  KK     K  IV+ R  +  
Sbjct: 56  GLDLNGGYKKFKDYYSEFKDA-STLHGLLSSLKDYEQKKNKKM----KVDIVTFRGIIRK 110

Query: 156 LIMCPFSLEE----ANLIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELEN 211
           LIM  F         +L +   DG L I       K  S + +K  +V  L YTG++ E 
Sbjct: 111 LIMSSFETNSKYNVVDLRIVLFDGQLFI-------KDVSTVNAKPEKVTPLEYTGYKFEA 163

Query: 212 LVT----------------KGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSY----N 251
           L T                  K+ S G    F S+V+  +     +LL AE+D+      
Sbjct: 164 LCTLPEPLPYVSRTKLNKRPKKIVSHGDE--FVSVVKTGVG-NCKILLGAEVDAIFDFKE 220

Query: 252 PKTDN---YVELKCSVNFQLKNSNHR--RKLLRMWIQTGLVPRTDLLVGFRDPYY 301
              DN   Y+ELKC+      N   +   KL + WIQ  L+  T +  GFRD  Y
Sbjct: 221 KGKDNLQHYIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITRITYGFRDEQY 275

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 131/300 (43%), Gaps = 53/300 (17%)

Query: 46  FQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNG 105
            ++ +E+G ++R   +G +L +D        D    Y + P  +  K        DLL+G
Sbjct: 18  LKQPKELGHYSRTQDNG-FLVND--------DSRLAYYYLPDTDLDK------KLDLLSG 62

Query: 106 FEDYIPLSEDELNN--MDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSL 163
            + +   + +E ++  + G+L+ +  +E +  KK     K  I++ R  +  LI   F  
Sbjct: 63  IKKFKECNTEEFDSTTLHGLLSTLEEYERRKSKK----TKVDIITFRGIIRKLISSAFDS 118

Query: 164 EE---ANLIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKG---- 216
            +    N  +   DG L I   K+     S  +++++   +  Y+G++ E L T      
Sbjct: 119 SQFNPVNFRIVSFDGQLFIKEVKTDASETSINKNRESLQARAYYSGYKFEALATLSLPLP 178

Query: 217 ------------KVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDS-YNPKTDN------Y 257
                       K+ + G    F S+V   + +   +L+ AE+D  ++ K D+      Y
Sbjct: 179 LVPRTTLEKRPKKIINNGDQ--FISMVRTGIGK-CKILIGAEVDCIFDFKEDSDDNLKHY 235

Query: 258 VELKCSVNFQLKNSNHR--RKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEI 315
            ELKC+      +  H+  RKL + W+Q  LV    ++ GFRD  +  L  ++ +T  E+
Sbjct: 236 AELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRDDNF-MLKTVEEFTTSEV 294

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 134/310 (43%), Gaps = 64/310 (20%)

Query: 46  FQESREIGTFTRMVSSGKYLFDDKLGLRP--LKDDICEYIHNPAKNASKIKTQYLGYDLL 103
            ++ +EIG ++R   + +YL  D + LR   L D   E+  + +  ASK +      D+ 
Sbjct: 18  LKQPKEIGYYSRN-QTEEYLVSDDINLRYYYLPDQEIEHGIDLSAGASKFR------DVA 70

Query: 104 NGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLI---MCP 160
             F+D   L         G+L+ +  +E+K  KK    +   I++ R  +  LI   M P
Sbjct: 71  KDFKDRCSLK--------GLLDTLMEYEKKKNKK----SNVDIITFRGIMSKLIRASMEP 118

Query: 161 FSLEEANLIVTHLDGLLII---------SSDKSKPKVDSGIRSKDTRVRKLCYTGFELEN 211
            +  + +L +   DG L I         +++ +   V+S  ++  +R +   YTG++ E 
Sbjct: 119 PNFNKVDLRIVSYDGQLFIKDVSDYNAATNESNSSGVNSRQQAGTSRQQIDTYTGYKFEG 178

Query: 212 LVTKGKVDSPGMHTC-----------------FYSIVENKLTEGVSLLLQAEMDSY---- 250
           + T   +D P  +                   + ++V   + E   ++L AE+D      
Sbjct: 179 IAT---LDKPLPYVEREVIEKRPRKILNNGDEYITVVRTGVGE-CKVVLGAEIDCIFDFK 234

Query: 251 NPKTDN---YVELKCSVNFQLKNSNHR--RKLLRMWIQTGLVPRTDLLVGFRDPYYNQLD 305
               DN   Y ELKCS      N   R  +K+ R W+Q  LV    ++ GFRD  Y  L 
Sbjct: 235 EEGKDNLKHYTELKCSSQISTTNDVRRFEKKMFRAWLQCFLVGVPRVIYGFRDDQY-MLK 293

Query: 306 ALKPYTRDEI 315
            ++ ++ +EI
Sbjct: 294 TVEEFSTEEI 303

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 104/234 (44%), Gaps = 37/234 (15%)

Query: 106 FEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFS--L 163
           F+D    +ED+  ++ G+L  +  +E +  KK  ++    I++ R  +  LI C F    
Sbjct: 474 FQDEQAEAEDDTGSLHGLLQTLMEYERRKSKKVNAD----IIAFRGQVKRLIHCAFGGHA 529

Query: 164 EEANLIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLV---------- 213
            + ++ V   DG L I +  ++ K++     +++      Y+G++ E +           
Sbjct: 530 TDVDMYVMSFDGQLFIRA--ARKKLEFPTSPRESWAYLAYYSGYKFERMALLDRPVAETP 587

Query: 214 -----TKGKV---DSPGMHTCFYSIV-ENKLTEGVSLLLQAEMDSYNPKTDN---YVELK 261
                ++GK    + P   T   + V E+KL  G  +     +D   P  DN   YVELK
Sbjct: 588 REVLESRGKQVVRNGPQYRTVMRTGVGEHKLVLGAEI--DGIIDFREPTGDNLKHYVELK 645

Query: 262 CSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEI 315
                  KN N   KL   W+Q  LV    +++GFRD  +  L +++ ++  EI
Sbjct: 646 VCQ----KNRNFSEKLFSSWLQCFLVGINRVIIGFRDEKF-VLKSVEEFSTSEI 694

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 120/287 (41%), Gaps = 42/287 (14%)

Query: 113 SEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRH--HLI-DLIMCPFSLEEANLI 169
           SED+  ++ G+L  +  +E +NGKK  ++    I S  H  HLI  L+  P +    ++ 
Sbjct: 69  SEDDAGSLHGLLYMLMEYERRNGKKIDAD---FIASGEHLKHLIYPLLGGPSA--HVDIY 123

Query: 170 VTHLDGLLIISSDKSK---------PKVDSGIRSKDTRVRKLCYT---GFELENLVTKGK 217
           V + DG + I + + K          K+ S  +      R    T    +EL     +  
Sbjct: 124 VRNFDGQIFIRAVQKKHCPLRYENRGKICSCGKRMQEEGRSPSMTINSSYELPFWSKQVV 183

Query: 218 VDSPG-MHTCFYSIVENKLTEGV---SLLLQAEMDSYNPKTDNYVELK-CSVNFQLKNSN 272
            + P  M+     + E+K+  GV    +L   E+   N K  +YVEL  C   + L    
Sbjct: 184 RNGPQYMNVARAGVGEHKMVIGVEADGILASKELKGGNLK--HYVELGVCKERWDLD--- 238

Query: 273 HRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRNLNENRKYYN 332
             R+L  +W+   +V    + +GFRD  +  +D ++ Y   EI + F T  L        
Sbjct: 239 --RRLFFVWLHCFVVGIDRITIGFRDDSFKLVD-VQEYRTMEILQLFETSALRN------ 289

Query: 333 FNSTVAVQWSHHVIAKITELVDKNLTDEPLQSFKLTLTRDLQLSLTK 379
            +    + W   ++  ++    +   D     +KL ++R L + + +
Sbjct: 290 -DCNSVMNWYGEILKNLSRFFKRRADD--FCVYKLNVSRSLGILMAQ 333

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 105/243 (43%), Gaps = 43/243 (17%)

Query: 106 FEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPF---S 162
           F+DY    ED  + + G+L  I + E   GKK  ++    +++ R     LI C F   S
Sbjct: 66  FKDYYNDFEDRCS-LRGLLETIESSERHKGKKINAD----VITFRGIARKLISCAFDSPS 120

Query: 163 LEEANLIVTHLDGLLII---SSDKSKPKVDSGIRSKDTRVRKL-CYTGFELENLVTKGKV 218
               NL V   +G L I   S      K  S + + +   + L  +TG++ E L T   +
Sbjct: 121 FNTVNLRVVSFNGQLFIKEVSEAIGASKTSSTVSAGNNINQDLSAFTGYKFETLAT---L 177

Query: 219 DSPGMHTCFYSIVENKLTEGVS-----------------LLLQAEMDSYNPKTDN----- 256
            +P  +T    ++E +    VS                 L+L AE+D      +N     
Sbjct: 178 SNPLQYTP-REVIEKRTKRIVSHGDEYISVVRTGVGSCKLILGAEVDCIFDFKENGRDNL 236

Query: 257 --YVELKCSVNFQLKNSNHR--RKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTR 312
             Y ELKC+      +  H+  RKL R W+Q  LV    ++ GF+D +Y  L  ++ ++ 
Sbjct: 237 KHYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHY-VLKTVEEFST 295

Query: 313 DEI 315
           +E+
Sbjct: 296 EEV 298

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 83/363 (22%), Positives = 149/363 (41%), Gaps = 67/363 (18%)

Query: 40  SVPCKFFQESREIGTFTRMVSS-GKYLFDDKLGLRPLKDDICEYIHNPAKNASKIKTQYL 98
           S P K   + RE+  ++R     G+ L D+   LR        Y + P     K      
Sbjct: 13  SEPTKAAAKPREVSFYSRTSERYGEILTDNDCNLR--------YYYFPDAELEK------ 58

Query: 99  GYDLLNGFEDYIPLSED--ELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDL 156
            Y+L  G  ++I       ++ +++G+L  + + E    KK+ S+    +++ R  L  L
Sbjct: 59  PYNLAQGRNNFINARSQIKDVCSLEGVLKCVIDVE----KKHDSKLNVNVITFRGILRKL 114

Query: 157 IMCPFS----LEEANLIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENL 212
           IM  +       + N  V   D  + I     K  + + I           YTG++ E L
Sbjct: 115 IMVAYEHNPKFNKINFRVVFFDKQVFIKEINEKEDISNAIDVNS-------YTGYKFEAL 167

Query: 213 V---------TKGKVDSPGMHTC------FYSIVENKLTEGVSLLLQAEMDS-YNPKTD- 255
                      +  +DS     C      + S+V+  + +   +L+  E+D  Y+ K D 
Sbjct: 168 TLLNEPIAFTERDSLDSRA-DACVSNGDEYVSVVKTGIGKH-RVLMGGEVDGIYDFKEDG 225

Query: 256 -----NYVELKC--SVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALK 308
                +Y+ELKC  S++      N  +KL + W+Q  L+    +  GFRD  YN L +++
Sbjct: 226 ADNLKHYLELKCTRSLSSYQDIENFEKKLFKTWLQCFLIGIPRITYGFRDRSYN-LTSIE 284

Query: 309 PYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDE-PLQSFKL 367
            Y  +++ K F+ R +             A+QW   +I  + + +    TD   ++ FKL
Sbjct: 285 EYLTEDVPKLFTNRGVKA-------QCMDAIQWYGEIIGWLYDTLAHLETDANEIRPFKL 337

Query: 368 TLT 370
             +
Sbjct: 338 LFS 340

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 86/365 (23%), Positives = 157/365 (43%), Gaps = 68/365 (18%)

Query: 46  FQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNG 105
            ++ ++ G ++R    G++L +D        D    Y + P  +  K    YL  DL +G
Sbjct: 18  LKQPKQFGQYSR-TQEGEFLIND--------DSRLNYYYLPDSDLDK----YL--DLSSG 62

Query: 106 FEDYIPLSE--DELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSL 163
            + +   S+  ++  ++ G+L  I      N ++     K  I++ R  +  LI   F  
Sbjct: 63  IKKFKDCSKQIEDRCSLRGLLKTIM----INEQRKDIPTKADIITFRGVMRKLISAAFDT 118

Query: 164 EEAN---LIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVT------ 214
            E N   L +   DG + I  D +K +    I          CYTG++ E+L T      
Sbjct: 119 PEYNPVDLRIVSFDGQIFIK-DVTKQETQDPIDLN-------CYTGYKFESLATLSQPLP 170

Query: 215 ----------KGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDS-YNPKTDN------Y 257
                       K+ S G    + ++V+  +     L+L AE+D  ++ K +N      Y
Sbjct: 171 LVSRTTLEKRPKKISSNGDE--YIAVVKTGVGSS-KLVLGAEIDCIFDFKEENKDNLRHY 227

Query: 258 VELKCSVNFQLKNSNHR--RKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEI 315
            ELKCS         HR  RKL + W+Q  LV    ++ GFRD  Y  L +++ ++ +E+
Sbjct: 228 AELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRDENYT-LKSVEEFSTEEV 286

Query: 316 YKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQSFKLTLTRDLQL 375
                   L E+    N +   A++W   +   + +L+ ++  DE ++ ++L    +  L
Sbjct: 287 -----PILLKEHNPKMNTSCIDAIKWYGLLTEWLLKLIPRDSGDE-IRPYRLVFENN-HL 339

Query: 376 SLTKL 380
            LT++
Sbjct: 340 RLTEI 344

>KNAG0D02970 Chr4 (535257..536417) [1161 bp, 386 aa] {ON} Anc_3.570
           YGL246C
          Length = 386

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 85/396 (21%), Positives = 164/396 (41%), Gaps = 81/396 (20%)

Query: 46  FQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNG 105
            ++ RE+G ++R  S   Y+ DD+            Y + P +   +       ++L +G
Sbjct: 16  LRQPRELGCYSRTASDEVYVNDDR---------NLSYYYFPDELVGR------QFNLSHG 60

Query: 106 FEDYIPLSED--ELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSL 163
           FE +   +    +  ++ G+L  I + EEK GK+  ++    IV+ R  +  +I      
Sbjct: 61  FERFQDRNRTIRDTCSLRGLLGVIQDVEEKRGKRLSAD----IVTFRGIIRKVISAAIEP 116

Query: 164 EEAN-----LIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKGK- 217
              N     L V   DG + I  D + P+ DS        V    +TG++ E L T  + 
Sbjct: 117 PRRNDRPLELQVLVFDGQVFIK-DVAYPERDS--------VTVPSFTGYKFETLTTIPRP 167

Query: 218 ---VDSPGMHTCFYSIVEN------KLTEGVS---LLLQAEMDS---YNPKTD------- 255
              +D   + + F   V N       +T G+    ++L AE+D    +   +D       
Sbjct: 168 LPYMDREAVESRFEKTVGNGDEYAIAVTTGIGACKMVLGAEVDGVFDFKEHSDGDADGPV 227

Query: 256 -------NYVELKCSVNF--QLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDA 306
                  +Y+ELKC+++   +   +    K+ R W+Q  LV    ++ GFR+  Y  L  
Sbjct: 228 RAVDNLQHYLELKCTMDIRNEADAAAFEGKMFRTWLQCFLVGVPRIIYGFRNRQY-LLQT 286

Query: 307 LKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQSFK 366
           ++ YT  +I +   + N   +  + +     A++W       + +++ +       ++++
Sbjct: 287 VEEYTTADIPQMVGSHNPQLHSAFRD-----AIRWYGRFTEWLLQVIPRGDRQATTRAYR 341

Query: 367 LTLTRDLQLSLTKLANTPAG-------LIPEKFLNS 395
           L     +   L +L   P+G       +  E+FLNS
Sbjct: 342 LVSDPRVSGKL-QLIEVPSGSDEYTEMVNNEEFLNS 376

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 127/299 (42%), Gaps = 53/299 (17%)

Query: 46  FQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNG 105
            ++ +E+G +++    G++L +DK  L         Y + P  +  K        DL  G
Sbjct: 18  LKQPKELGFYSK-TQEGEFLINDKSKL--------SYYYLPDTDLDK------NLDLTAG 62

Query: 106 FEDYIPLS---EDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPF- 161
            + +   S   E +   +DG+L  +  +EE+   K  ++    I++ R  +  LI   F 
Sbjct: 63  IKKFKECSNNPEVDACTLDGLLKTVQAYEERKQSKVSAD----IITFRGIIRKLISSAFD 118

Query: 162 --SLEEANLIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVT----- 214
                  NL V   +G L I   +    +    ++ D    +  Y+G++ E+L T     
Sbjct: 119 SPKYNHVNLRVVSFNGQLFI---REATPIHEPPKNTDAMQYRSYYSGYKFESLATLSKPL 175

Query: 215 ----KGKVDSPGMHTC-----FYSIVENKLTEGVSLLLQAEMDS---YNPKTDN----YV 258
               +  ++      C     F ++V + +     L+L AE+D    +   T N    Y 
Sbjct: 176 PQTPRSSLEKRSKKICNNGDQFVTVVRSGVG-NCKLVLGAEVDCVFDFAEDTSNNLKHYA 234

Query: 259 ELKCS--VNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEI 315
           ELKC+  V+   +  +  RKL + W+Q  LV    ++ GFRD ++  L +++ Y   EI
Sbjct: 235 ELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINRIIYGFRDEHF-ILRSVEEYGSHEI 292

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 101/224 (45%), Gaps = 36/224 (16%)

Query: 120 MDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPF---SLEEANLIVTHLDGL 176
           ++G+L+ I   E+   KK  ++    I++ R  +  LI   F   +    NL +   DG 
Sbjct: 79  LNGLLDTIMEHEKCKNKKIKAD----IITFRGIIRKLISSAFETANFNPINLRIVSFDGQ 134

Query: 177 LIIS--SDKSKPKVDSGIRSKDTRVRKLCYTGFELENL---------VTKGKVDSPGMHT 225
           L I   +D +  KV +    ++  +    Y+G++ E L         V++  +D      
Sbjct: 135 LFIKDMADLNDKKVLNA--KENDHIDLGSYSGYKFETLATLSQPVPYVSRATLDKRSKKI 192

Query: 226 C-----FYSIVENKLTEGVSLLLQAEMDS-YNPKTD------NYVELKCSVNFQLKNSNH 273
           C     + ++V+  +     L+L AE+D  ++ K D      +Y ELKC+         H
Sbjct: 193 CNNGDEYVTVVKTGVGSA-KLVLGAEIDCVFDFKEDGKDNLKHYAELKCTTQVITAADAH 251

Query: 274 R--RKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEI 315
           +  RK+ R W+Q  LV    ++ GFRD  Y  L  ++ Y+ DEI
Sbjct: 252 KFERKIFRTWLQCFLVGIPRIIYGFRDENY-VLKTIEEYSTDEI 294

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 112/255 (43%), Gaps = 54/255 (21%)

Query: 101 DLLNGFE---DYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLI 157
           DL +GF+   DY    ED  + + G+L  I + E   GKK  ++    I++ R     LI
Sbjct: 58  DLSSGFQKFKDYYKDFEDRCS-LRGLLETIESSERHKGKKINAD----IITFRGIARKLI 112

Query: 158 MCPF---SLEEANLIVTHLDGLLII-------SSDKSKPKVDSGIR-SKDTRVRKLCYTG 206
            C F   S    +L +   +G L I       ++ K+    ++G   ++D  V    +TG
Sbjct: 113 SCAFDSPSFNTVDLRIVSFNGQLFIKEVPEAVNAAKASSATEAGRNINQDLNV----FTG 168

Query: 207 FELENLVTKGKVDSPGMHTCFYSIVENKLTEGVS-----------------LLLQAEMDS 249
           ++ E L T   + +P  +T    ++E +    VS                 L+L AE+D 
Sbjct: 169 YKFETLAT---LSNPLQYTP-REVIEKRTKRIVSHGDEYISVVRTGVGNCKLILGAEVDC 224

Query: 250 YNPKTDN-------YVELKCSVNFQLKNSNHR--RKLLRMWIQTGLVPRTDLLVGFRDPY 300
                +N       Y ELKC+      +  H+  RKL R W+Q  LV    ++ GF+D +
Sbjct: 225 IFDFKENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

Query: 301 YNQLDALKPYTRDEI 315
           Y  L  ++ ++ +E+
Sbjct: 285 Y-VLKTVEEFSTEEV 298

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 122/269 (45%), Gaps = 56/269 (20%)

Query: 87  AKNASKIKTQYL-------GYDLLNG---FEDYIPLSEDELNNMDGILNFIGNWEEKNGK 136
            K+ S+++  YL         DL  G   F+D+    +D    + G+L  I  +EE   K
Sbjct: 37  VKDDSRLRYYYLPDAELDMNLDLCGGIKKFKDHYKNFQDP-GTLKGLLKTIQAYEEIKQK 95

Query: 137 KYGSENKFTIVSNRHHLIDLIMCPF---SLEEANLIVTHLDGLLIISSDKSKPKVDSGIR 193
           K     K  I++ R  +  LI   F      + NL +   DG + +   K  P+ +    
Sbjct: 96  KV----KVDIITFRGVIRKLISSAFDSPKFNQVNLRIVLFDGQIFM---KEVPRKEE--E 146

Query: 194 SKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVS------------- 240
            KD ++    Y+G++ ENLVT   V  P  +T   + +E +  + VS             
Sbjct: 147 PKDGKIAPPVYSGYKFENLVT---VSKPIPYTS-RTTIEKRPKKIVSNGDEYISVVRTGV 202

Query: 241 ----LLLQAEMDS-YNPKTDN------YVELKCSVNFQLKNSNHRR---KLLRMWIQTGL 286
               L+L AE+D+ ++ K ++      YVELK + N  L  S+ R+   K+ + WIQ  L
Sbjct: 203 GNCKLMLGAEVDAIFDFKEEDKDNLKHYVELKTT-NAVLTPSDARKFEQKIFKTWIQCFL 261

Query: 287 VPRTDLLVGFRDPYYNQLDALKPYTRDEI 315
           V    ++ GFRD  +  L +++ ++ DE+
Sbjct: 262 VGIPRIIYGFRDNNF-ILKSVEEFSTDEV 289

>Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar to
           Ashbya gossypii AFR263C AFR262C
          Length = 384

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 92/226 (40%), Gaps = 35/226 (15%)

Query: 101 DLLNG---FEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLI 157
           DL  G   F D +  S  + + + G+L+ I  +EE+  KK  ++    I++ R  +  LI
Sbjct: 58  DLTGGIKKFRDSMADSNVDHSTLHGLLSTIQKYEERKEKKIKAD----IITFRGVMRKLI 113

Query: 158 MCPFS---LEEANLIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVT 214
            C        + +L V   +  LII       +  +G  S D R     Y+G++ E L T
Sbjct: 114 SCALENPKYNKVSLYVVSFNEQLIIKDATKVGQPSTGTDSIDYRNY---YSGYKFETLTT 170

Query: 215 KGKVDSPGMHTCFYSIVENKLTEG-------------VSLLLQAEMDSY----NPKTDN- 256
             K  S        S  +  ++ G               L+L AE+D         +DN 
Sbjct: 171 LSKSFSETPRQVLESRPKKIVSNGEQFVTVVRTGIGKCKLILGAEVDCVFDFKEVGSDNL 230

Query: 257 --YVELKCS--VNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRD 298
             Y ELKCS  VN          KL + W+Q  LV    ++ GFRD
Sbjct: 231 KHYAELKCSKAVNTVADARTFELKLFKTWVQCFLVGINRIIYGFRD 276

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 107/252 (42%), Gaps = 48/252 (19%)

Query: 101 DLLNGFE---DYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLI 157
           DL  GF+   DY    ED  + + G+L  I + E   GKK   +    I++ R     LI
Sbjct: 58  DLSTGFQKFKDYYKDFEDRCS-LRGLLGTIESSERHKGKKVNVD----IITFRGIARKLI 112

Query: 158 MCPF---SLEEANLIVTHLDGLLII-----SSDKSKPKVDSGIRSKDTRVRKLCYTGFEL 209
              F   +    NL +   +G L I     ++D  KP   +G    + +     +TG++ 
Sbjct: 113 SSAFDSPAFNAVNLRIVSFNGQLFIKEVPEAADVVKPASAAGAVPNNNQELS-GFTGYKF 171

Query: 210 ENLVTKGKVDSPGMHTCFYSIVENKLTEGVS-----------------LLLQAEMDSYNP 252
           E L T   + +P  +T    ++E +    VS                 L+L AE+D    
Sbjct: 172 ETLAT---LSNPLQYTP-REVIEKRTKRIVSHGDEYISVVRTGVGNCKLILGAEVDCVFD 227

Query: 253 KTDN-------YVELKCSVNFQLKNSNHR--RKLLRMWIQTGLVPRTDLLVGFRDPYYNQ 303
             +N       Y ELKC+      +  H+  RKL R W+Q  LV    ++ GF+D +Y  
Sbjct: 228 FKENGKDNLKHYAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHY-V 286

Query: 304 LDALKPYTRDEI 315
           L  ++ ++ +E+
Sbjct: 287 LKTVEEFSTEEV 298

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 103/245 (42%), Gaps = 47/245 (19%)

Query: 106 FEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPF---S 162
           F+DY    ED  + + G+L  I + E   GKK  ++    I++ R     LI C F   +
Sbjct: 66  FKDYYKDFEDRCS-LRGLLETIESSERHKGKKINAD----IITFRGIARKLISCAFDSPA 120

Query: 163 LEEANLIVTHLDGLLIISS-----DKSKPKVDSGI-RSKDTRVRKLCYTGFELENLVTKG 216
               NL +   +G L I       D +      G   S D  +    +TG++ E LVT  
Sbjct: 121 FNAVNLRIISFNGQLFIKEVPDVIDATTAASTPGTGHSNDQDLN--AFTGYKFETLVT-- 176

Query: 217 KVDSPGMHTCFYSIVENKLTEGVS-----------------LLLQAEMDSYNPKTDN--- 256
            + +P  +T    ++E +    VS                 L+L AE+D      +N   
Sbjct: 177 -LSNPLQYTP-REVIEKRTKRIVSHGDEYISVVRTGVGNCKLILGAEVDCVFDFKENGKD 234

Query: 257 ----YVELKCSVNFQLKNSNHR--RKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPY 310
               Y ELKC+      +  H+  RKL R W+Q  LV    ++ GF+D  Y  L  ++ +
Sbjct: 235 NLKHYAELKCTQQVMNISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDQY-VLKTVEEF 293

Query: 311 TRDEI 315
           + +E+
Sbjct: 294 STEEV 298

>ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} similar
           to uniprot|P53063 Saccharomyces cerevisiae YGL246C RAI1
           Nuclear protein that binds to and stabilizes the
           exoribonuclease Rat1p required for pre-rRNA processing
          Length = 380

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 119/287 (41%), Gaps = 42/287 (14%)

Query: 122 GILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSLEEANLI---VTHLDGLLI 178
           G+L  I N+E++  KK  ++    IV+ R  +  LI   F     N I   +   DG L 
Sbjct: 81  GLLQSIQNYEQRKNKKIKAD----IVTFRGIMRKLISAAFDTSNFNPIDLRIVSFDGQLF 136

Query: 179 ISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCF----------- 227
           I   K  PK ++   +  +  +   Y+G++ E L T  +       T             
Sbjct: 137 I---KEVPKQEAK-PAPGSPAQLAWYSGYKFETLATLPQPLPLVSRTTLDKRPKKLVNTG 192

Query: 228 --YSIVENKLTEGVSLLLQAEMDSY----NPKTDN---YVELKCSVNFQLKNSNHR--RK 276
             Y  V       V ++L AE+D          DN   Y ELKCS +        +  RK
Sbjct: 193 EEYITVVKTGVGNVKVILGAEVDCIFDFKEEGKDNLKHYAELKCSADVSTPADARKFERK 252

Query: 277 LLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRNLNENRKYYNFNST 336
           + R W+Q  LV    ++ GFRD   N L  ++ YT  E+        L  N    N +  
Sbjct: 253 VFRTWLQCFLVGIPRIIYGFRD-NNNVLKTVEEYTTTEV-----PVLLKSNNPAMNSSCL 306

Query: 337 VAVQWSHHVIAKITELVDKNLTDEPLQSFKLTLTRDLQLSLTKLANT 383
            A++W   +   + +++ ++   + +++++L    +  L LT++ +T
Sbjct: 307 DAIKWYGTLTEWLLKMIPRD--GDTIRAYRLVYENN-HLRLTEIEDT 350

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 101/221 (45%), Gaps = 33/221 (14%)

Query: 120 MDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFS---LEEANLIVTHLDGL 176
           +  +L+ I ++E++  KK     K  I++ R  +  LI   F        NL +   DG 
Sbjct: 80  LRALLSTIQSYEQRKNKK----AKADIITFRGIIRKLISSAFDNPRYNRVNLRIVSFDGQ 135

Query: 177 LIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTK----GKVDSPGMHTCFYSIVE 232
           L I  +  +P V    ++ D+   +  Y+G++ E+LVT     G+V    +      IV 
Sbjct: 136 LFIK-EVGEPFVPP--KTTDSIEHRSYYSGYKFESLVTLPKPLGEVSRTTLEKRPKKIVN 192

Query: 233 NK------LTEGVS---LLLQAEMDS-YNPKTDN------YVELKCS--VNFQLKNSNHR 274
           N       +  GV    L+L AE+D  ++ K D+      Y ELKC+  V    +     
Sbjct: 193 NGEQYISVVRTGVGKSKLILGAEVDCVFDFKEDSGDNLKHYTELKCTKGVTTIAEARAFE 252

Query: 275 RKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEI 315
           RK+ + W+Q  LV    ++ GFRD  +  L +++ ++  EI
Sbjct: 253 RKIFKTWLQCFLVGVNRVIYGFRDDNF-ILKSVEEFSTQEI 292

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 85/204 (41%), Gaps = 33/204 (16%)

Query: 120 MDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFS---LEEANLIVTHLDGL 176
           + G+L  + + EEK  K+     K  I++ R  +  LI   F      + +L V   DG 
Sbjct: 79  LRGLLATVQSVEEKKQKR----TKADIITFRGVIRRLISAAFDSPKFNKVDLRVVAFDGQ 134

Query: 177 LIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENLVTKGK----VDSPGMHTCFYSIVE 232
           + I    SK   D  +R   T  R   YTG++ E + T  +    VD   +      +V 
Sbjct: 135 IFIRDVASK---DEELRMT-TESRNAWYTGYKFETVATLSQPLPYVDRETVEKRPKKLVN 190

Query: 233 NK------LTEGVS---LLLQAEMDSY----NPKTDN---YVELKCS--VNFQLKNSNHR 274
                   +  GV    L+L AE+D          DN   Y ELKCS  V+ Q       
Sbjct: 191 TGDEYITVVRTGVGNSKLILGAEVDCIFDFKEEGKDNLKHYAELKCSAMVSTQADARKFE 250

Query: 275 RKLLRMWIQTGLVPRTDLLVGFRD 298
           +K+ + W+Q  LV    ++ GFRD
Sbjct: 251 KKIFKTWLQCFLVGIPRIIYGFRD 274

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 114/276 (41%), Gaps = 40/276 (14%)

Query: 120 MDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSLEEAN---LIVTHLDGL 176
           + G+L  I  +EE+  KK  ++    I++ R  +  LI   F   + N   L V   +G 
Sbjct: 80  LSGLLKTIQAYEERKNKKVPAD----IITFRGIMRKLISAAFDSPKYNRVDLRVLSFNGQ 135

Query: 177 LIISSDKSKPKVDSGIRSKDTRVRKLCYTGFELENL---------VTKGKVDSPGMHTC- 226
           L I          +   S + R     Y+G++ E L         VT+  ++      C 
Sbjct: 136 LFIREPNQAHPPPANTSSMEYRSY---YSGYKFETLSTISKPLPQVTRNSLEKRHKRICC 192

Query: 227 ----FYSIVENKLTEGVSLLLQAEMDSYNPKTDN-------YVELKCS--VNFQLKNSNH 273
               + ++V + +     L+L AE+D     T++       Y ELKC+  V+   +    
Sbjct: 193 NGDQYITVVRSGVGH-CKLVLGAEVDCVFDFTEDSSDNLKHYAELKCTKGVSTFAEARAF 251

Query: 274 RRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRNLNENRKYYNF 333
            RK+ + W+Q  LV    ++ GFRD  +  L +++ Y+  E+        L  N      
Sbjct: 252 ERKMFKTWLQCFLVGINRVIYGFRDENF-ILRSVEEYSTQEV-----PLLLKNNNPQLTN 305

Query: 334 NSTVAVQWSHHVIAKITELVDKNLTDEPLQSFKLTL 369
               AV+W   +   +   + +  + E +++++LT 
Sbjct: 306 ACMDAVRWYGALTEWLLSSIPREESAEHIRAYRLTF 341

>KNAG0I00210 Chr9 complement(24413..25537) [1125 bp, 374 aa] {ON}
           Anc_3.570 YGL246C
          Length = 374

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 129/305 (42%), Gaps = 43/305 (14%)

Query: 101 DLLNGFEDYIPLSED--ELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHLIDLIM 158
           DL +GF+ +     D  ++ ++  +L+ I  +EE   K   ++    IV     +I +I+
Sbjct: 58  DLSSGFKRFKNCERDFQDVGSIHPLLDTIMGYEETKSKPLSAD----IVGFSDTIIKIIL 113

Query: 159 CPFSLEEANLI---VTHLDGLLIISSDKSKPKVDSGIR--------SKDTRVRKLCYTGF 207
             F   + N I   V    G L I +  S    D  +R        +  T    L YT  
Sbjct: 114 SAFHNTKINPIDMRVVSYRGQLFIKNMASTGVHDPDMREYASYKFETLATLAEPLAYTDR 173

Query: 208 ELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEM----DSYNPKTDN---YVEL 260
           E+ N   K K+ + G    +Y++V+  +     L+L +E+    D      DN   Y  L
Sbjct: 174 EILNRRPK-KISNNGDK--YYTLVKTGVASA-KLVLASEVNCIFDFKQQGKDNLRHYCFL 229

Query: 261 KCSVNFQLKNSNHR--RKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEI--- 315
           +CS      N + R   +  R W++  LV    ++ GF D  Y  +  ++ Y+ DE+   
Sbjct: 230 ECSSAVNNINDSRRFENQFFRNWLKCFLVGIPRIICGFYDEKY-IVKTVEEYSLDEVPLL 288

Query: 316 YKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQSFKLTLTRDLQL 375
            K+ S    N+         T A++W       + +++ ++  D  ++ FKL L  D  L
Sbjct: 289 LKEHSPEAANK--------CTNAIKWYGLFTEWLLKIIPRDKNDHSIRPFKLQLA-DNHL 339

Query: 376 SLTKL 380
            LT++
Sbjct: 340 KLTEI 344

>TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 80/187 (42%), Gaps = 42/187 (22%)

Query: 143 KFTIVSNRHHLIDLIMCPFSLEEAN---LIVTHLDGLLIISSDKSKPKVDSGIRSKDTRV 199
           K  I++ R  +  LI   F  E+ N   L V   DG + I   K  P+ +  +  K    
Sbjct: 98  KADIITFRGIIRKLISAAFDSEQFNHVDLRVLVFDGQIFI---KEIPQDEPELVGK---A 151

Query: 200 RKLCYTGFELENLVT----------------KGKVDSPGMHTCFYSIVENKLTEGVSLLL 243
           +   Y+G++ E L T                  K+ + G    + S+V+  ++    L+L
Sbjct: 152 KLNAYSGYKFETLATIPQPLPFVSRELLEKRPKKIVTTGDE--YVSVVKTGIS-NCRLVL 208

Query: 244 QAEMDSY-----NPKTDN---YVELKCSVNFQLKNSNHRR----KLLRMWIQTGLVPRTD 291
            AE+D       + KT+N   Y ELKC+   Q+  +   R    K+ R W+Q  LV    
Sbjct: 209 GAEVDCIFDFKESSKTNNIYHYAELKCTQ--QICTAQQARGFDKKIFRTWLQCFLVGIPR 266

Query: 292 LLVGFRD 298
           ++ GFRD
Sbjct: 267 IIYGFRD 273

>Kpol_1060.14 s1060 complement(38802..39971) [1170 bp, 389 aa] {ON}
           complement(38802..39971) [1170 nt, 390 aa]
          Length = 389

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 12/80 (15%)

Query: 207 FELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCSVNF 266
           +E    V +G +DS G   CF   +E K+   +S+L   E+D +  ++    +L C + F
Sbjct: 309 YEYRQSVYRGTIDSNGKVACF---LERKILPTLSVLFCGEIDQFKQES----KLGCGLQF 361

Query: 267 QLKNSNHRRKLLRMWIQTGL 286
           +   S   ++LL M  Q GL
Sbjct: 362 ETAGS---QELLMM--QQGL 376

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 45/106 (42%), Gaps = 8/106 (7%)

Query: 24  TANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYI 83
           T+N  G  H N S+ P  P K  Q+++E        S+   L   + G  P ++D  + +
Sbjct: 457 TSNEIGLSHFNSSNSPISPHKLMQKTKE-------GSNDDVLVSFQFGQPPNREDDLDKL 509

Query: 84  HNPAKNASKIKTQYL-GYDLLNGFEDYIPLSEDELNNMDGILNFIG 128
            N  K+   I  QY+ G +     +D +P S    N   G   F G
Sbjct: 510 CNMTKDVQAIFNQYMKGEESKRSLDDCVPTSNGNENPDTGNYTFYG 555

>NCAS0D01240 Chr4 complement(226870..227421) [552 bp, 183 aa] {ON}
           Anc_2.393
          Length = 183

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 15/115 (13%)

Query: 258 VELKCSVNFQLKNSNHRRKLLRMW---IQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDE 314
           VE+  ++ FQ+ N NH    + MW    QT L P       F D Y+++++AL       
Sbjct: 45  VEITPTIGFQIVNFNHGGYTISMWDIGGQTTLRP-------FWDNYFDKMEALVWCVDVS 97

Query: 315 IYKKFSTRNLNENRKYYNFNSTV----AVQWSHHVIAKITELVDKNLTDEPLQSF 365
              +F   +L E  +  N + TV     + +   V+    +LVD N  +  L S 
Sbjct: 98  APSRFQ-ESLRELSQLLNLDRTVESGETLPFKLIVVLNKIDLVDWNSVEGQLDSL 151

>TPHA0D03680 Chr4 (775188..776357) [1170 bp, 389 aa] {ON} Anc_6.302
           YMR203W
          Length = 389

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 12/80 (15%)

Query: 207 FELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCSVNF 266
           +E    V +G +DS G   CF   +E K+   +S+L   E+D +  ++    +L C + F
Sbjct: 310 YEYRQSVYRGTIDSNGKIACF---LEKKILPTLSILFSGEIDHFKQES----KLGCGLQF 362

Query: 267 QLKNSNHRRKLLRMWIQTGL 286
           +   +   ++LL M  Q GL
Sbjct: 363 ETAGN---QELLMM--QQGL 377

>Suva_4.501 Chr4 complement(873617..875086) [1470 bp, 489 aa] {ON}
           YBR241C (REAL)
          Length = 489

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 12/69 (17%)

Query: 80  CEYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILN--------FIGNWE 131
           C   ++P +N S   T +LG    +G +  IPLS+ +   +  IL+        + GNW 
Sbjct: 54  CSKFNSPDENISYGDT-WLGQ---HGLKQCIPLSDSQFGAVTSILSIGGLFGSYYAGNWA 109

Query: 132 EKNGKKYGS 140
            + G+KY S
Sbjct: 110 NRFGRKYVS 118

>KNAG0I02420 Chr9 (465065..466234) [1170 bp, 389 aa] {ON} Anc_6.302
           YMR203W
          Length = 389

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 207 FELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCSVNF 266
           +E    V +G VDS G   CF   +E K+   +S+L   E+D +  K +N  +L C + F
Sbjct: 306 YEYRQSVYRGTVDSQGKVACF---LERKVLPTLSILFCGEIDHF--KNEN--KLGCGLQF 358

Query: 267 Q 267
           +
Sbjct: 359 E 359

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,904,609
Number of extensions: 2280483
Number of successful extensions: 6368
Number of sequences better than 10.0: 54
Number of HSP's gapped: 6534
Number of HSP's successfully gapped: 55
Length of query: 400
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 288
Effective length of database: 40,638,807
Effective search space: 11703976416
Effective search space used: 11703976416
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)