Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02574g5.436ON48448425300.0
Kwal_55.214185.436ON48448713830.0
KLTH0F16016g5.436ON48448013670.0
KLLA0E02223g5.436ON48046712531e-169
AER403C5.436ON48046912211e-164
Ecym_47605.436ON47846911271e-150
ZYRO0F10076g5.436ON48246710641e-140
TDEL0E018905.436ON47446510191e-134
Kpol_1062.285.436ON4654834921e-55
TPHA0E017505.436ON4594754168e-45
TBLA0A028105.436ON4814843105e-30
KLLA0E08735g2.304ON4922252061e-16
Ecym_33422.304ON4952522042e-16
Kwal_27.114562.304ON4962271901e-14
Kpol_1003.512.304ON4782381873e-14
SAKL0E07194g2.304ON4952271847e-14
TDEL0G023402.304ON4942271812e-13
KLTH0G10824g2.304ON4952581793e-13
Smik_14.3042.304ON5001631766e-13
YNL026W (SAM50)2.304ON4841631704e-12
NDAI0G007102.304ON4912651679e-12
KNAG0H019402.304ON4562361651e-11
Suva_14.3192.304ON4841631652e-11
Skud_14.3022.304ON4841631642e-11
TBLA0B060602.304ON5032051599e-11
AGR392C2.304ON4951341562e-10
TPHA0G008302.304ON4782251543e-10
CAGL0M06853g2.304ON4662271534e-10
ZYRO0A02310g2.304ON4922841518e-10
NCAS0G038602.304ON4611581454e-09
NCAS0G037502.304ON4611581454e-09
KAFR0H032502.304ON4621341349e-08
NCAS0B030608.390ON85381800.33
Smik_5.3398.232ON85086723.6
Skud_13.342singletonON116589714.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02574g
         (484 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   979   0.0  
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   537   0.0  
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   531   0.0  
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   487   e-169
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   474   e-164
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   438   e-150
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   414   e-140
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    397   e-134
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   194   1e-55
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    164   8e-45
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436    124   5e-30
KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} simila...    84   1e-16
Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar t...    83   2e-16
Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {...    78   1e-14
Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON} (1170...    77   3e-14
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    75   7e-14
TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.3...    74   2e-13
KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} simila...    74   3e-13
Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026...    72   6e-13
YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}  SAM50Esse...    70   4e-12
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    69   9e-12
KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.3...    68   1e-11
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    68   2e-11
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    68   2e-11
TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON} Anc_2...    66   9e-11
AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}...    65   2e-10
TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.3...    64   3e-10
CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} simil...    64   4e-10
ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} simila...    63   8e-10
NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {O...    60   4e-09
NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON}               60   4e-09
KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.3...    56   9e-08
NCAS0B03060 Chr2 (528273..530834) [2562 bp, 853 aa] {ON} Anc_8.3...    35   0.33 
Smik_5.339 Chr5 (517721..520273) [2553 bp, 850 aa] {ON} YER167W ...    32   3.6  
Skud_13.342 Chr13 (586679..590176) [3498 bp, 1165 aa] {ON} YMR17...    32   4.3  

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/484 (100%), Positives = 484/484 (100%)

Query: 1   MASPSLSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPL 60
           MASPSLSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPL
Sbjct: 1   MASPSLSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPL 60

Query: 61  QNIDNAMNNFSEIKKKLFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVA 120
           QNIDNAMNNFSEIKKKLFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVA
Sbjct: 61  QNIDNAMNNFSEIKKKLFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVA 120

Query: 121 KIDLIPALYNKLCLTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKS 180
           KIDLIPALYNKLCLTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKS
Sbjct: 121 KIDLIPALYNKLCLTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKS 180

Query: 181 LDGKFLLPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKT 240
           LDGKFLLPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKT
Sbjct: 181 LDGKFLLPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKT 240

Query: 241 GNAPILFNGVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPIS 300
           GNAPILFNGVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPIS
Sbjct: 241 GNAPILFNGVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPIS 300

Query: 301 GSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPT 360
           GSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPT
Sbjct: 301 GSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPT 360

Query: 361 GSKAAIVHTMDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQ 420
           GSKAAIVHTMDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQ
Sbjct: 361 GSKAAIVHTMDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQ 420

Query: 421 VFFNAGDSLNKRELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVE 480
           VFFNAGDSLNKRELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVE
Sbjct: 421 VFFNAGDSLNKRELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVE 480

Query: 481 LSFF 484
           LSFF
Sbjct: 481 LSFF 484

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/487 (53%), Positives = 342/487 (70%), Gaps = 6/487 (1%)

Query: 1   MASPSLSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPL 60
           M  P  S   Q++ +   L +S+ KPLY TS+SVDG+ +  PLSDA Y S+L+PVLSQPL
Sbjct: 1   MTLPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPL 60

Query: 61  QNIDNAMNNFSEIKKKLFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVA 120
           Q ++ ++ NF+EIKKKL +TG+F DVKI+LD D SG     L ++  KE  +E P+PT+A
Sbjct: 61  QTLEQSLANFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIA 120

Query: 121 KIDLIPALYNKLCLTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKS 180
           +I L P  +NKLC TS T+D + S+G R SF+NALGKAE + LQS++ Y+PF     EK+
Sbjct: 121 RILLKPLEFNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKT 180

Query: 181 LDGKFLLPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKT 240
           LD K ++PLQKNPS+KAV D NYA IDL  QPF+   DQH+Q+Q S N+GVQK WL +K 
Sbjct: 181 LDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKM 240

Query: 241 GNAPILFNGVSTVIRNLYGFNDIAN-VSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPI 299
             +P+ +NG S V RNL+   D+ N  S +I+QFN  F+K+SFVSQ+  D RKF GLFP 
Sbjct: 241 NLSPVFYNGFSVVARNLH---DVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPA 297

Query: 300 SGSRFNLVNEYVLTQAFSKNK--TVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAI 357
           SG +  L NEYVL+Q F K+    +  +  F+K  LS E   S+  N+I +SLD +CG I
Sbjct: 298 SGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGI 357

Query: 358 IPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPL 417
           +PTG+ A++VH MD+FYLGGL SLKGFE N VG  GGNFFY+L + SS++LP     SPL
Sbjct: 358 LPTGNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPL 417

Query: 418 RFQVFFNAGDSLNKRELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSF 477
           R Q F NAG+  N++    S AA++G SL+YK+ LANMDLTYALPL+ R QDVAKPGFSF
Sbjct: 418 RLQFFLNAGEVSNEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSF 477

Query: 478 GVELSFF 484
           GV LS +
Sbjct: 478 GVSLSLY 484

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/480 (54%), Positives = 340/480 (70%), Gaps = 4/480 (0%)

Query: 7   STEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNA 66
           S E QK  +   + +S+ KPLY TS+SVDGDN  +PLS+ +Y S+L+PVL QPLQ +D +
Sbjct: 7   SKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQS 66

Query: 67  MNNFSEIKKKLFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIP 126
           ++NF+EIKKKL +TGLF+DVKI+LDN+VS      L +++ K Y +E+P+PT+A+I L P
Sbjct: 67  LSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTP 126

Query: 127 ALYNKLCLTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFL 186
              N+  LTS T D LSSMGGR S IN  GKAE L LQ  + Y PF    +EK L+ K L
Sbjct: 127 INLNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLL 186

Query: 187 LPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPIL 246
           +PLQKNPS+KAV D NYA IDL  QPF+   DQH+Q+Q S N+GVQK W+  KTG AP+L
Sbjct: 187 IPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVL 246

Query: 247 FNGVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNL 306
           +NG S V RNL      A  SE+I+QF+  F+K+SFVSQ+  D RKF GLFP SG +F++
Sbjct: 247 YNGFSVVARNLDEVRKEA--SEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSI 304

Query: 307 VNEYVLTQAFSKNK--TVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKA 364
            NEYVL+++F K     V Q   FDK  + +E H ++  N+I +SL+ +CG I   G  +
Sbjct: 305 NNEYVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSS 364

Query: 365 AIVHTMDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFN 424
           ++VH +D+FYLGG+ SLKGFE N+VG  GG  FY+LG+ SS++LPN  ANSPLR Q FFN
Sbjct: 365 SLVHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFN 424

Query: 425 AGDSLNKRELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           AGD  NK+    S AA++G SL+YK++LANMDLTYA PLT R QD+ KPGFSFGV LS +
Sbjct: 425 AGDVQNKKPTQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY 484

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  487 bits (1253), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/467 (50%), Positives = 325/467 (69%), Gaps = 4/467 (0%)

Query: 22  SATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKLFFTG 81
           S  K +Y T V+VDGDNQ +P+SD LY+SI + +L+ PLQ +D+A  +  +I+KKL FTG
Sbjct: 14  SCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTG 73

Query: 82  LFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYNKLCLTSGTSDM 141
           LFQ  +ITLD+DV   S   L ENV K   +ELP+PT+A++ L+PA+YNK  L++ T D 
Sbjct: 74  LFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDT 133

Query: 142 LSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIKAVIDV 201
            SS G R+ +IN  G AET+ LQ D+NY PF+GKL+E+ L  K  LP  KNPS+KA +  
Sbjct: 134 YSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYA 193

Query: 202 NYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRNLYGFN 261
           N+  +DLFKQPF+   D+HKQ Q+  + G++KN+L N   +    FNG++ V RN+YGF 
Sbjct: 194 NHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFA 253

Query: 262 DIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKT 321
           D   VS+SIKQF G+F KSSF+S++ +D+R+F   FP+SG R  L +EY+L+Q F+ +K 
Sbjct: 254 DALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKP 313

Query: 322 VPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKA-AIVHTMDRFYLGGLKS 380
           +P E+NFDK  +SYE H  + N ++ +SL    GAI P  +K+  +VH +D FYLGG KS
Sbjct: 314 LPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKS 373

Query: 381 LKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLNKRE---LPQS 437
           LKGFE N VG+ GG +FY+LGI+SS++LPN   +SPLR Q F N GD LN      L + 
Sbjct: 374 LKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERK 433

Query: 438 FAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
            A +TG SL+Y  + AN+DL+Y+LPL  R+ D+AKPG +FG++LSFF
Sbjct: 434 PALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  474 bits (1221), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 239/469 (50%), Positives = 321/469 (68%), Gaps = 8/469 (1%)

Query: 17  DALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKK 76
           D L +S TKPLYITSV V+ D +  PLSD + KSIL PVL++PLQ++ + + +   I+K 
Sbjct: 17  DQLGKSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKN 75

Query: 77  LFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYNKLCLTS 136
           L +TGL+QD+ ITLD+D S     FL     KEY +ELPLP  A + ++PA Y +L L +
Sbjct: 76  LMYTGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIELPLPVKALVKVLPAPYQRLSLVT 135

Query: 137 GTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIK 196
            T D  +S GGR++ +N  G AE   LQ+D+NY PFSGKL++K +D + L+P Q NPSIK
Sbjct: 136 TTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIK 195

Query: 197 AVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRN 256
           AV DVNYA +DL+ QP++   DQHKQ+Q  FNIG+QK WL  +   +P  F GVS V RN
Sbjct: 196 AVFDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRL-YSPTAFAGVSIVGRN 254

Query: 257 LYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAF 316
           L+G   +   S  +  +  S +K+SFV+Q  +  RK +G FP+ G +FN VNE VL+Q  
Sbjct: 255 LHGIQ-LDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTV 313

Query: 317 SKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKA-AIVHTMDRFYL 375
           +     PQE  F+K  ++YE+H S+L N +T+SLD SCG++I T   A  +VH MD+FYL
Sbjct: 314 AGT---PQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYL 370

Query: 376 GGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLN-KREL 434
           GGL SLKGF  N+VGS GG+ FYRL + SS  LP    +SPLR Q FFNAGD  + +R++
Sbjct: 371 GGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQI 430

Query: 435 PQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSF 483
           P+  AAATG SLVY++ +AN+DLTYALPLT R  D+AKPGFSFGV +++
Sbjct: 431 PEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  438 bits (1127), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 233/469 (49%), Positives = 315/469 (67%), Gaps = 8/469 (1%)

Query: 18  ALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKL 77
           AL++  TKPL+ITSV V+ D + +PLS+++++SIL PVLSQP QN+ + ++    I+KKL
Sbjct: 16  ALAKVQTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKL 74

Query: 78  FFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYNKLCLTSG 137
            +TGL+ DV ITLD D S    D+L+E   KEYG+ELP+P  A+I L+PA Y  L L + 
Sbjct: 75  MYTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTT 134

Query: 138 TSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIKA 197
           T D  ++ G  +S +N   +AET+ILQ ++N  PFSGK++EK L  K L+PLQK PS+KA
Sbjct: 135 TRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKA 194

Query: 198 VIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRNL 257
           V D+NYA +DLFKQ +L   DQHKQ Q  FNIG+Q+  + +     PI+++G+S + RNL
Sbjct: 195 VFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISILGRNL 254

Query: 258 YGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFS 317
                   VS SI  +  S  K S+V QI  + +KF+G  PISG +FNL NE VL Q  +
Sbjct: 255 LDLKK-TEVSSSINSWVES-SKVSYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQTVA 312

Query: 318 KNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAAI-VHTMDRFYLG 376
             K   QE+ F K   SYE ++S+L N I +SLD S G I    S + + VH MD+FYLG
Sbjct: 313 GEK---QESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMDQFYLG 369

Query: 377 GLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLN-KRELP 435
           GL SLKGF+ N+VG+ GGN FY++   SS+ +P     SPLR Q F NAGD  N +R +P
Sbjct: 370 GLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSERGIP 429

Query: 436 QSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           +  A ATG SLVY++ LA++DLTYALPL+ R QDVAKPGFSFGV +++ 
Sbjct: 430 EDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  414 bits (1064), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 217/467 (46%), Positives = 298/467 (63%), Gaps = 3/467 (0%)

Query: 19  LSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKLF 78
           L  + TKPLYI+ + +DGDN  +PLSD+L ++I    L+QPLQ+++N++N F +I+KKL 
Sbjct: 18  LHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLL 77

Query: 79  FTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYNKLCLTSGT 138
           FTGLF DV ITLD D    S   L + +S+ YG+E PL T AK+ L    YN +  T+  
Sbjct: 78  FTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNTISGTTTL 137

Query: 139 SDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIKAV 198
           SD   S+ G  ++ N LG+A+   L+   N+ P + + + K     F LPL K PS++A+
Sbjct: 138 SDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAI 197

Query: 199 IDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRNLY 258
           ++       L  +PF+A  D+H QQQY+   G QK W+CN + + P+L+ GVS V RNL 
Sbjct: 198 VEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLN 257

Query: 259 GFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSK 318
            F   A  SE    F G F K+SFV+  T+DTR+F+G FP+SG +F L NEYV++Q+   
Sbjct: 258 EFKPTA--SELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGS 315

Query: 319 NKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGL 378
           +K +  +NNF+K     E H S+  ++IT S     G I P GS+A  VH +DRF LGGL
Sbjct: 316 SKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGL 375

Query: 379 KSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGD-SLNKRELPQS 437
            SLKGF LN VG+ G NFFY+LG++ S++L N    SPLR Q FFN G+ S + + +  S
Sbjct: 376 NSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTIFNS 435

Query: 438 FAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           +AAATG SLVYKT  A +DLTYA PLT R QD++KPG S GV L+FF
Sbjct: 436 YAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  397 bits (1019), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 202/465 (43%), Positives = 293/465 (63%), Gaps = 5/465 (1%)

Query: 22  SATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKLFFTG 81
           S TKPLYI+ +S+DGDN  +PLS ++YK+ILD  LS P+QN+ +++  F +I++KL  TG
Sbjct: 13  SETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCTG 72

Query: 82  LFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPA-LYNKLCLTSGTSD 140
           L+QDV+ITL+ D    S +F  ++  KEYG+E PL T A+I L P+ +YN    T+   D
Sbjct: 73  LYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTSLVD 132

Query: 141 MLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIKAVID 200
             +S+    S++N LG+A++      + Y P + K   KSL G F LPL KNPS++A ++
Sbjct: 133 DSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRASLN 192

Query: 201 VNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRNLYGF 260
            +   ++   + ++A  D H + QYS + G+QK W+  +T + P  + G+++  R++ G 
Sbjct: 193 FDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDISGL 252

Query: 261 NDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNK 320
              A  S+    ++G F K S  S+  NDTRK+ G FP+SG    + NEYV++Q    ++
Sbjct: 253 G--AQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTKGSSQ 310

Query: 321 TVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKS 380
            +PQE+NF K   S + H S+  N++T+SLD   G IIP   K   VH MD++YLGGL S
Sbjct: 311 VLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTE-VHPMDKWYLGGLDS 369

Query: 381 LKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLNK-RELPQSFA 439
           +KGF+ N VG  G +FFY++ +T+S +L N   +SPLR   F N G++ N       S+A
Sbjct: 370 MKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTATNSYA 429

Query: 440 AATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           AATG SL YKT  ANMDLTYA PLT R QD+ KPGFSFGV  S+F
Sbjct: 430 AATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  194 bits (492), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 150/483 (31%), Positives = 249/483 (51%), Gaps = 31/483 (6%)

Query: 6   LSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDN 65
           L  EF K    + +S S TKPLYI+ VSV+ D+   PLS +  +++L+ V+S P+QN+D 
Sbjct: 8   LKNEFVK----ENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDT 63

Query: 66  AMNNFSEIKKKLFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLI 125
           A+ +F +IK+ L FTGL+ DV +TL  D  G+  +   + V+ + G+E  +PT A I L 
Sbjct: 64  ALGSFIDIKRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLK 123

Query: 126 P-ALYNKLCLTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGK 184
           P  L   L  T  T+    S+     + N LG A+   +     Y   S    +K   G+
Sbjct: 124 PNDLVTNLQTTFTTTSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGE 183

Query: 185 FLLPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAP 244
           F+LP  K PS++ V+ V+ +            V   ++   ++  G+QK WL +     P
Sbjct: 184 FILPFTKVPSLRTVLSVDVSE---------DKVSHLQRLNCNYKAGIQKLWLKDDLNTFP 234

Query: 245 ILFNGVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRF 304
           + ++G+S ++ N   FN    +     +   S+ +S +++  + D+ K++G FP SG   
Sbjct: 235 VFYSGLS-IVNNKPIFNGEIPIDVPSPEQTPSY-QSGWLTTFSKDSTKWLGSFPNSGECL 292

Query: 305 NLVNEYVLTQAFSKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKA 364
           NL NEYVL+Q  S NK  P   N ++   ++E++ S LN+R+ +++  + G   P     
Sbjct: 293 NLKNEYVLSQLDSDNK--PINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFP----- 345

Query: 365 AIVHTMDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFN 424
            I  +    ++G     +   +  +  +  +  ++ G  SS++LPN   +SPLR Q+   
Sbjct: 346 -IDESTRSTFVGESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQI--- 401

Query: 425 AGDSLNK-RELPQSF---AAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVE 480
           +  + NK + L   F   AA TG SLVYKT   NM L+Y +PL +     A  GFSF + 
Sbjct: 402 SALTENKFKGLANYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIA 461

Query: 481 LSF 483
           +++
Sbjct: 462 ITY 464

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  164 bits (416), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 133/475 (28%), Positives = 239/475 (50%), Gaps = 28/475 (5%)

Query: 17  DALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKK 76
           D++  S TKP+Y+T V V        LSD  Y++IL  V+S P++++ +    F  I+  
Sbjct: 4   DSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNN 63

Query: 77  LFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYN--KLCL 134
           L  +GL+++V + LD D   +  +   +  +++ G+E  +P  A +++ P      K  +
Sbjct: 64  LILSGLYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYV 123

Query: 135 TSGTSDMLSSMGGRISFINALGKAE--TLILQSDINYVPFSGKLNEKSLDGKFLLPLQKN 192
           T  TS+  +S+     +IN  G ++  T+ L +D+N      ++++KS+D KF +PL +N
Sbjct: 124 TFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQT--KSEIDKKSIDAKFTMPLLRN 181

Query: 193 PSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVST 252
            SI+ +++   +         +A       +Q+  NIG+ K  L     + PI ++G++ 
Sbjct: 182 SSIRTILESKCS---------IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNI 232

Query: 253 VIR--NLYGFNDIANVSESIKQFNGSFIKS-SFVSQITNDTRKFVGLFPISGSRFNLVNE 309
             +   L   +D  + +E I   +   I S S  S+   D+R +   FP  G  F LV++
Sbjct: 233 QRKQTTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQ 292

Query: 310 YVLTQAFSKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAAIVHT 369
           +VL +  S +  + +  N     +S+E+H S LN++ITSS  F     +P  S  A +++
Sbjct: 293 HVLNETNSISNEIKK--NISNINMSFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNS 350

Query: 370 MDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQV-FFNAGDS 428
            + F+    +  K    N +  S     +++G+ SS+R+PN    SP+RFQ+       S
Sbjct: 351 GE-FWDNEKEIFKTLCQNDIKVS-----HKVGLVSSFRVPNIPITSPIRFQLSVLGINKS 404

Query: 429 LNKRELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSF 483
               E  ++++A TG SLVYK   + M L+Y +PL     D    G SF V +++
Sbjct: 405 KRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVTY 458

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score =  124 bits (310), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 138/484 (28%), Positives = 219/484 (45%), Gaps = 44/484 (9%)

Query: 23  ATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKLFFTGL 82
           +TKPLYI+ V++   N+   +SD+  KS+L+PVLS PLQN+   +  F  I+ KL+ T L
Sbjct: 20  STKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDL 79

Query: 83  FQDVKITLD-NDVSGASFDFLKENVS-KEYGVELPLPTVAKIDLIPALYNKLCL----TS 136
           F+DVKI+LD N  + +    L +++S  +  V+ P+P  A I + P   NK  +    T 
Sbjct: 80  FEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKP---NKPLVDPNYTW 136

Query: 137 GTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIK 196
             S+  S      ++IN+L +A+   + +   Y   S K      DG    PL    S+K
Sbjct: 137 TISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVK 196

Query: 197 AVIDVNYAGIDLFKQ--------PFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFN 248
           +V     +GI LFK          +L      K  ++   +GV+ + L   TG A     
Sbjct: 197 SV-----SGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNLY--TGLA----- 244

Query: 249 GVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVN 308
            ++  I++  G N+   ++++I +    + K+S +S+ + D+R FV   P  GS FN+  
Sbjct: 245 -INGAIKD-EGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYY 302

Query: 309 EYVLTQAFSKNKTVPQ---ENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAA 365
           EYVL       K  P+    +N  +  +++E++ +   + I  SL    G  I       
Sbjct: 303 EYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMF 362

Query: 366 IVHTMDR----FYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQV 421
              T  R    F +      +  E N      G  FY + + +S  L +    SPLRFQ 
Sbjct: 363 NWETKRREANEFPVPSYLEERPHEKN-----DGIAFYNVCLNASVPLFSKCKFSPLRFQN 417

Query: 422 FFNAGDSLNKRELPQSFAAATG-FSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVE 480
                   N     Q     TG   LVYK+  A  D+ Y LP+ +      K GF+    
Sbjct: 418 SIQLERYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNAS 477

Query: 481 LSFF 484
           +SF 
Sbjct: 478 ISFL 481

>KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 102/225 (45%), Gaps = 29/225 (12%)

Query: 275 GSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLS 334
           G  +K S V  IT DTR  + + P SG  +  +NE  L + +  N     E NF K+  +
Sbjct: 280 GDDVKHSVVHSITRDTRDNI-IAPSSGQMWKFINEVSLGKFWKTN----LEYNFTKSWFN 334

Query: 335 YEQHNSYLNNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVGSS-- 392
                    N IT S     G I    +K   +H  D+FY GG   ++ F+L  +G    
Sbjct: 335 --------RNFITMSSTVKAGYIHNFHAKTYPLHLADKFYNGGSNDVRSFQLMGLGPKDI 386

Query: 393 ----GGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNKR---------ELPQSF 438
               GG+     G++   RLP     +S  R  +FFN G  +N+          ++    
Sbjct: 387 YDYVGGDTSLSYGLSLFSRLPFKRFYDSNFRLHLFFNGGRLINRNNANTTDTLMQMLSQH 446

Query: 439 AAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSF 483
           + +TGF LV++  +A  +L + +P+T    D  + GF +G+ +SF
Sbjct: 447 SLSTGFGLVFRHPVARFELNFTVPITAHTSDATRKGFQYGIGISF 491

>Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii AGR392C
          Length = 495

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 107/252 (42%), Gaps = 33/252 (13%)

Query: 250 VSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNE 309
           + +V+R     N  A  S+S+    G   K+S    I+ D+R    +FP  G    L NE
Sbjct: 260 IESVLRTTSNRNPQA--SDSLLLQCGDDFKNSISHAISRDSRD-NAIFPSRGQYIKLFNE 316

Query: 310 YVLTQAFSKNKTVPQENNFDKACLSYEQHNSYLNNR-ITSSLDFSCGAIIPTGSKAAIVH 368
             L               + K+ L +    S+L+   IT S     G I    S    +H
Sbjct: 317 LSL-------------GTYWKSILEFTDAKSWLDKDFITMSTTIKGGYIANLNSDNKFIH 363

Query: 369 TMDRFYLGGLKSLKGFELNTVG------SSGGNFFYRLGITSSYRLP-NATANSPLRFQV 421
             D+F+ GG   ++GF+   +G      S GG+ F   GI+   RLP N  +NS  R   
Sbjct: 364 MKDKFHSGGSNDVRGFQQMGLGPRDIYDSIGGDTFVAYGISVFSRLPVNKWSNSGFRLHW 423

Query: 422 FFNAGDSLNKR---------ELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAK 472
           F N G  +N           +L    + ATG  +++K  +A  +L + LPL     D  +
Sbjct: 424 FLNGGRLINHNNSDLSGVLDQLCMEHSIATGIGILFKHPVARFELNFTLPLAAHSSDSVR 483

Query: 473 PGFSFGVELSFF 484
            GF +G+ LSF 
Sbjct: 484 KGFQYGIGLSFL 495

>Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {ON}
           YNL026W - 1:1 [contig 27] FULL
          Length = 496

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 97/227 (42%), Gaps = 31/227 (13%)

Query: 275 GSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLS 334
           G+ IK+S    I  DTR    +FP++GS   + NE  L             N F K+   
Sbjct: 284 GNDIKNSLCHSIFWDTRD-KPIFPLAGSFLKISNEIAL-------------NKFWKSSFE 329

Query: 335 YEQHNSYLNNRI-TSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG--- 390
           +    S+ NN   T+S     G I     +   +H  D+F+ GG   ++ F+L  +G   
Sbjct: 330 FSNVRSWCNNDFFTASGTVKGGYINNFHPQTKPLHVSDKFHNGGSNDVRSFQLMGLGPKD 389

Query: 391 ---SSGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNKRELP---------QS 437
              S GG+ F   G++   RLP    + S  R   FFN    +N    P           
Sbjct: 390 LYDSMGGDAFVSYGVSIFSRLPIKRWSESNFRLHAFFNGARLINTNGTPFKSSLSTLASE 449

Query: 438 FAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
            + +TG  LV+   +A  +L + +PLT    D  + GF +G+ LSF 
Sbjct: 450 HSTSTGVGLVFGHPVARFELNFCVPLTAHSSDSIRKGFQYGIGLSFL 496

>Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON}
           (117089..118525) [1437 nt, 479 aa]
          Length = 478

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 106/238 (44%), Gaps = 31/238 (13%)

Query: 264 ANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKTVP 323
           +N S+S+    GS  K +    I+ DTR  V + P  G+   + NE  L Q F       
Sbjct: 255 SNCSDSLLFQAGSDAKLTIGHSISWDTRD-VPVTPNKGNLLKISNELALNQYF------- 306

Query: 324 QENNFDKACLSYEQHNS-YLNNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLK 382
                 K+ + +    S Y +N  T    +  G I         +H  D+F+LGG   ++
Sbjct: 307 ------KSQMEFSSSKSWYQDNFFTLMGTYKFGWITKIDDNDKPLHISDKFHLGGSNDVR 360

Query: 383 GFELNTVG------SSGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNK---- 431
           GF+L  +G      + GG+ F   GI+   +LP    ++S  R   FFN G  +N+    
Sbjct: 361 GFQLMGLGPKQINDAIGGDMFSAYGISLFSKLPFKKFSDSNFRLHAFFNGGKLVNQNTNT 420

Query: 432 --RELPQSF---AAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
             R L   F   + A G  +++K  +A  +L + LPLT    D  + GF +G+ +SF 
Sbjct: 421 FDRNLQSLFKENSLAIGTGIIFKHPVARFELNFTLPLTSYSTDHVRKGFQYGIGMSFL 478

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 97/227 (42%), Gaps = 31/227 (13%)

Query: 275 GSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLS 334
           G  +K S    +T D R    + P  G+   L+NE  L +             F K  L 
Sbjct: 283 GDDLKVSLCHIMTIDDRD-NAISPTRGNYAKLLNELALGK-------------FWKTTLE 328

Query: 335 YEQHNSYLNNR-ITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG--- 390
           + Q NS+  N  IT +     G I     K+  +H  D+F+ GG   ++GF+   +G   
Sbjct: 329 FSQTNSWFTNDFITMTGTLKGGYISNFHPKSQPLHMGDKFHNGGSNDVRGFQAMGLGPKD 388

Query: 391 ---SSGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNK---------RELPQS 437
              S GG+ F   G++   RLP      S  R   F N G  +N          + L Q 
Sbjct: 389 LYDSMGGDAFVAYGVSLFSRLPVRRWYESNFRLHWFVNGGRLINHNNTNLSSCIKSLAQE 448

Query: 438 FAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
            + +TG  LV+K  +A  +L + +P++    D  + GF +G+ L+F 
Sbjct: 449 HSTSTGVGLVFKHPVARFELNFTVPISAHSSDSVRKGFQYGIGLTFL 495

>TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.304
           YNL026W
          Length = 494

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 95/227 (41%), Gaps = 31/227 (13%)

Query: 275 GSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLS 334
           G  IK S    +  D R    + P  GS   L NE  + Q             F K  + 
Sbjct: 282 GDDIKCSLGHTLAIDNRD-NPIAPSRGSLLKLTNELAIGQ-------------FWKGQIE 327

Query: 335 YEQHNSYLNNR-ITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG--- 390
             Q+NS+L +  + S      G I    S    ++T D+F+ GG   ++ F +  +G   
Sbjct: 328 VSQNNSWLKDDFLGSCCTLRSGYIQNLSSSRKPINTFDKFHNGGANDIRSFHIMGLGPKD 387

Query: 391 ---SSGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNK---------RELPQS 437
              S GG+ F   G++   RLP    ++S  R   FFN G  +N           +L   
Sbjct: 388 LYDSIGGDAFVAYGVSFFSRLPIKRWSHSNFRLHWFFNGGKLINHNNAPFTNILEQLASE 447

Query: 438 FAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
            + + GF ++ +  +A  +L + LPLT    D  + GF +G+ +SF 
Sbjct: 448 HSTSVGFGILLRHQVARFELNFTLPLTCHSGDALRKGFQYGIGISFL 494

>KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 495

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 117/258 (45%), Gaps = 44/258 (17%)

Query: 249 GVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVN 308
           GV ++ R+    +   + S+S+    G  +K+S    +  DTR    +FP++GS + L N
Sbjct: 260 GVESLWRSTQATS--THSSDSLLLLAGDEVKNSLSHSVFWDTRD-RPIFPLAGSFYKLTN 316

Query: 309 EYVLTQAF------SKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGS 362
           E   ++ +      SK K+  ++N+F  A  S+     Y+NN                 S
Sbjct: 317 ELSPSKYWKCFFEASKVKSW-RKNDFFTA--SFTLKGGYINNF----------------S 357

Query: 363 KAAIVHTMDRFYLGGLKSLKGFELNTVG------SSGGNFFYRLGITSSYRLP-NATANS 415
            +  +H  D+F+ GG   ++ F+L  +G      S GG+ F   G++   RLP    ++S
Sbjct: 358 ASKPLHISDKFHNGGSNDVRSFQLMGLGPKDLHDSLGGDAFVSYGVSLFSRLPFKRWSDS 417

Query: 416 PLRFQVFFNA-------GDSLNK--RELPQSFAAATGFSLVYKTALANMDLTYALPLTER 466
             R   FFN        GD L      L +  + +TG  LV    +A  +L + +PLT  
Sbjct: 418 NFRLHAFFNGARLINTNGDQLKNCISSLAREHSTSTGIGLVLGHPVARFELNFGIPLTAH 477

Query: 467 EQDVAKPGFSFGVELSFF 484
             D A+ GF +G+ LSF 
Sbjct: 478 TSDSARKGFQYGIGLSFL 495

>Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026W
           (REAL)
          Length = 500

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 79/163 (48%), Gaps = 18/163 (11%)

Query: 340 SYLNNR-ITSSLDFSCGAIIPTGSKAAI-VHTMDRFYLGGLKSLKGFELNTVG------S 391
           S+LN+  IT S  F  G +    S+ ++ VH  D+F  GG   ++ F+   +G      +
Sbjct: 338 SWLNDDFITFSTTFKTGYLKNISSQQSLPVHICDKFQSGGPNDIRSFQTFGLGPRDLYDA 397

Query: 392 SGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNKR---------ELPQSFAAA 441
            GG+ F   G++   RLP      S  R   FFN G  +N           +L +  + +
Sbjct: 398 IGGDAFVSYGVSMFSRLPWKKVEKSNFRLHWFFNGGKLINHDNTSLSNCIGQLSREHSTS 457

Query: 442 TGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           TG  LV +  LA  +L ++LP+T  E D+ + GF FG+ L+F 
Sbjct: 458 TGIGLVLRHPLARFELNFSLPITAHENDLMRKGFQFGLGLAFL 500

>YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}
           SAM50Essential component of the Sorting and Assembly
           Machinery (SAM or TOB complex) of the mitochondrial
           outer membrane, which binds precursors of beta-barrel
           proteins and facilitates their outer membrane insertion;
           homologous to bacterial Omp85
          Length = 484

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 78/163 (47%), Gaps = 18/163 (11%)

Query: 340 SYLNNR-ITSSLDFSCGAIIPTGSKAAI-VHTMDRFYLGGLKSLKGFELNTVG------S 391
           S++N+  IT S     G +    S+ ++ VH  D+F  GG   ++GF+   +G      +
Sbjct: 322 SWMNDDFITFSTTIKTGYLKNLSSQQSLPVHICDKFQSGGPSDIRGFQTFGLGPRDLYDA 381

Query: 392 SGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNKR---------ELPQSFAAA 441
            GG+ F   G++   RLP      S  R   FFN G  +N           +L +  + +
Sbjct: 382 VGGDAFVSYGLSVFSRLPWKKVEKSNFRLHWFFNGGKLVNHDNTSLGNCIGQLSKEHSTS 441

Query: 442 TGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           TG  LV +  +A  +L + LP+T  E D+ + GF FG+ L+F 
Sbjct: 442 TGIGLVLRHPMARFELNFTLPITAHENDLIRKGFQFGLGLAFL 484

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 116/265 (43%), Gaps = 36/265 (13%)

Query: 250 VSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGL----FPISGSRFN 305
           + +VIR+  G   + N S S+    G   K+S  S    D+R    L    FP +G  F 
Sbjct: 233 MQSVIRSC-GNTSLNNTSNSLLFQTGEDWKNSLGSNFVWDSRNNSVLDPNAFPSNGQLFK 291

Query: 306 LVNEYVLTQAFSKNKTVPQENN-FDKACLSYEQHNSYL-NNRITSSLDFSCGAI------ 357
             NE      F  N++       F K  L + Q  S+L N+ IT +  F  G I      
Sbjct: 292 WFNEL----NFIGNRSSTANGGPFWKNQLEFTQIRSWLPNDFITMNCTFRTGYIKQLLTK 347

Query: 358 --IPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG------SSGGNFFYRLGITSSYRLP 409
             +  GS ++ +H  D+F  GG   ++ F+   +G      S GG+ F   GI+   +LP
Sbjct: 348 NEVQKGS-SSFLHISDKFQNGGPNDIRSFQTMGLGPKDIFNSIGGDAFVSYGISIFSKLP 406

Query: 410 -NATANSPLRFQVFFNAGDSLNKR---------ELPQSFAAATGFSLVYKTALANMDLTY 459
               + S  R   F N G  +N           +L +  + +TG  ++ +  +A  +L +
Sbjct: 407 IKDWSKSNFRLHWFLNGGKLINHNGMSINNCFTDLSRQHSISTGVGILLRHPMARFELNF 466

Query: 460 ALPLTEREQDVAKPGFSFGVELSFF 484
           ++PLT  + D  + GF FGV LSF 
Sbjct: 467 SVPLTIHQGDDVRKGFQFGVGLSFL 491

>KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.304
           YNL026W
          Length = 456

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 98/236 (41%), Gaps = 27/236 (11%)

Query: 266 VSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKTVPQE 325
           +SE +    GSF++S   +  T D R      P  G+ + + NE            +   
Sbjct: 231 LSEYLLIQEGSFVRSVIKNNFTKDNRD-SPFNPTKGTMYKINNEL---------GAMDNG 280

Query: 326 NNFDKACLSYEQHNSYL-NNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGF 384
           ++F K  L      S+   + IT S     G I       + +H  D+F  GG   ++ F
Sbjct: 281 SSFWKTVLELNHVKSWFPRDFITLSTTLRSGYIKNLNPAKSYIHFTDKFQNGGPNDVRNF 340

Query: 385 ELNTVG------SSGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNK------ 431
           +LN +G      S GG+ F   G++   ++P     +S  R   +FN G  +N       
Sbjct: 341 QLNGIGPRHMHHSMGGDAFIAYGVSLFSKIPLKRFQDSNFRLHWYFNGGKLINHNNLPIH 400

Query: 432 ---RELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
              REL    + + G  +V +  +A  +L + +PLT    D+ + GF FG+   F 
Sbjct: 401 TLLRELTLEHSTSIGAGIVMRHPMARFELNFGVPLTSHVGDLQRKGFQFGLGFEFL 456

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 76/163 (46%), Gaps = 18/163 (11%)

Query: 340 SYLNNR-ITSSLDFSCGAIIPTGSKAAI-VHTMDRFYLGGLKSLKGFELNTVGSS----- 392
           S+LN+  IT S  F  G +    S+ ++ VH  D+F  GG   ++ F+   +G       
Sbjct: 322 SWLNDDFITFSTTFKTGYLKNISSQQSLPVHICDKFQNGGPNDIRSFQTFGLGPRDLYDA 381

Query: 393 -GGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNKR---------ELPQSFAAA 441
            GG+ F   G++   RLP      S  R   FFN G  +N           +L +  + +
Sbjct: 382 IGGDAFVSYGVSVFSRLPWKKVQKSNFRLHWFFNGGKLINHDNMSLSNCIGQLSKEHSTS 441

Query: 442 TGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           TG  LV +  +A  +L ++LP+   E D+ + G  FG+ L+F 
Sbjct: 442 TGIGLVLRHPMARFELNFSLPIAAHENDLMRKGLQFGIGLAFL 484

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 76/163 (46%), Gaps = 18/163 (11%)

Query: 340 SYLNNR-ITSSLDFSCGAIIPTGSKAAI-VHTMDRFYLGGLKSLKGFELNTVG------S 391
           S+LN+  IT S  F  G +    S+ ++ +H  D+F  GG   ++ F+   +G      +
Sbjct: 322 SWLNDDFITFSTTFKTGYLENISSQRSLPIHICDKFQSGGPNDIRSFQTFGLGPRDLYDT 381

Query: 392 SGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNKR---------ELPQSFAAA 441
            GG+ F   G++   RLP      S  R   FFN G  +N            L +  + +
Sbjct: 382 IGGDAFVSYGVSVFSRLPWEKVKKSNFRLHWFFNGGKLINHDNMSLSNCMGRLSKEHSTS 441

Query: 442 TGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           TG  LV +  +A  +L ++LP+   E D+ + GF FG+ L F 
Sbjct: 442 TGLGLVLRHPMARFELNFSLPIAAHENDLMRKGFQFGLGLVFL 484

>TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON}
           Anc_2.304 YNL026W
          Length = 503

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 89/205 (43%), Gaps = 31/205 (15%)

Query: 298 PISGSRFNLV---NEYVLTQAFSKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSC 354
           PI  SR  L+   NE+   + F  N  + +  +F            + ++ IT +  F  
Sbjct: 310 PIVSSRGTLIKLGNEFAPDRFFKTNLEIVKNKSF------------FRDDFITMACTFKT 357

Query: 355 GAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG------SSGGNFFYRLGITSSYRL 408
           G I      +  +H  D+F  GG   ++GF+   +G      S GG+ F   G +   ++
Sbjct: 358 GYIHNFFPNSKAIHRNDKFQNGGANDIRGFQFMGLGPKDRFDSVGGDAFISYGFSVMNKI 417

Query: 409 PNAT-ANSPLRFQVFFNAGDSLNKR---------ELPQSFAAATGFSLVYKTALANMDLT 458
           P     +S  RF  F N G  +N           +L +  + + G  +V++  +A  +L 
Sbjct: 418 PIWKFYDSNFRFHWFVNGGKLINSNGKGLLNTFNDLSKQNSMSVGMGIVFRHPMARFELN 477

Query: 459 YALPLTEREQDVAKPGFSFGVELSF 483
           +A+P+     D+ + GF +G+ LSF
Sbjct: 478 FAIPVVTHSGDITRKGFQYGIGLSF 502

>AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL026W
           (SAM50)
          Length = 495

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 16/134 (11%)

Query: 367 VHTMDRFYLGGLKSLKGFELNTVG------SSGGNFFYRLGITSSYRLP-NATANSPLRF 419
           +H  D+F+ GG   ++GF+L  +G      S GG+ F   G++   RLP    A S  R 
Sbjct: 362 IHIRDKFHCGGANDVRGFQLMGLGPKDAQDSLGGDAFLTYGLSLFSRLPVQRWAGSDFRL 421

Query: 420 QVFFNAGDSLNKR---------ELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDV 470
             F N G  L+            L +  + + G  L+++  +A  +L + LPL     D 
Sbjct: 422 HWFLNGGRLLSHNGASLLDVGTTLLEEHSISCGTGLLFQHPVARFELNFTLPLATHSSDT 481

Query: 471 AKPGFSFGVELSFF 484
           A+ GF +G+ +SF 
Sbjct: 482 ARKGFQYGIGVSFL 495

>TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.304
           YNL026W
          Length = 478

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 93/225 (41%), Gaps = 33/225 (14%)

Query: 279 KSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLSYEQH 338
           K S    I  DTR    + P  GS   + NE  L             N + K+ +     
Sbjct: 268 KVSIGHSIAWDTRD-NHIIPTYGSFLKVFNEVAL-------------NRYLKSQIEVNTA 313

Query: 339 NSYLNNR-ITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG------S 391
            S+L N  IT +     G I    S    +H  DRF LGG   ++ F+   +G      S
Sbjct: 314 MSFLKNSLITVNGTMRLGYISNISSTLRPLHIGDRFQLGGGNDVRSFQPMGLGPKDIYDS 373

Query: 392 SGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNK-----------RELPQSFA 439
            GGN +   GI+    LP  +   S  +   F N G  +N            ++L +  +
Sbjct: 374 IGGNSYTAYGISVFTALPFKSLMTSNFKIHTFINGGKLINHNSSNGTFTDAVKDLIKENS 433

Query: 440 AATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
            +TG  +++K  +A  +L + LPL   + D+ + GF +G+ +SF 
Sbjct: 434 LSTGVGIIFKHPVARFELNFTLPLITHKSDMVRKGFQYGIGISFL 478

>CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026w
          Length = 466

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 96/227 (42%), Gaps = 31/227 (13%)

Query: 275 GSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLS 334
           G+  KSS       DTR  V + P  G+ F L NE  L + +             K+   
Sbjct: 254 GTDFKSSIGHTYAIDTRDSV-MAPNRGNLFKLNNEVALGKYW-------------KSQFE 299

Query: 335 YEQHNSYLNNR-ITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG--- 390
             +  S+  N  IT++     G +         +H  D+F  GG   ++ F+   VG   
Sbjct: 300 LSKVQSWFKNDFITTTTTLKGGYLGNFHPDKKTLHINDKFMSGGPNDIRSFQSFGVGPKD 359

Query: 391 ---SSGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNKR---------ELPQS 437
              + GG+ F   G++   +LP     +S  R   FFN G  +N +         +L + 
Sbjct: 360 LQDAIGGDTFLSYGVSIFSKLPIKKFEDSHFRLHWFFNGGKLINHQNKPVIDTLHDLSRQ 419

Query: 438 FAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
            + + G  +V +  +A  +L ++LPLT   +D  + GF FG+ +SF 
Sbjct: 420 HSTSVGCGIVLRHPVARFELNFSLPLTVSTEDSLRKGFQFGLGMSFL 466

>ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 114/284 (40%), Gaps = 48/284 (16%)

Query: 237 CNKTGNA---PILFNGVSTVIRN-LYG--------FNDIANVSESIKQFNGSFIKSSFVS 284
           C + GN      L  G  T +R+  YG        F D+A  +  +   +      + + 
Sbjct: 221 CKQMGNRNSIETLLRGFRTCLRSGFYGDSVLNHEFFCDVALRNNKMNSLDTC---DTLLY 277

Query: 285 QITNDTRKFVGLF--------PISGSRFNLVNEYVLTQAFSKNKTVPQENNFDKACLSYE 336
           Q  +D +K +G          P+S SR +L   Y      S  K    +    KA     
Sbjct: 278 QAGDDVKKSLGHIMIWDRRDNPVSASRGSLFRWY---NELSLGKFWKSQIELSKA----- 329

Query: 337 QHNSYLNNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG------ 390
             + + ++ +T +     G I      +  ++  D+F  GG   ++ F+   +G      
Sbjct: 330 -QSWFRDDWLTVNGTLKTGYIHNFHPTSQSLNICDKFQNGGGNDVRSFQYMGLGPKDIYD 388

Query: 391 SSGGNFFYRLGITSSYRLP-NATANSPLRFQVFFNAGDSLNK---------RELPQSFAA 440
           S GG+ F   G++   RLP +  ++S  R   F N G  +N          + L    + 
Sbjct: 389 SIGGDAFVSYGVSVFTRLPFHKISHSNFRLHWFLNGGKLINHNNSSLQDVIKNLSTQHST 448

Query: 441 ATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           + GF LV K  +A  +L +ALP+T    D  + GF +G+ LSF 
Sbjct: 449 SIGFGLVLKHPVARFELNFALPVTCHTGDCIRKGFQYGIGLSFL 492

>NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 73/158 (46%), Gaps = 18/158 (11%)

Query: 343 NNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG------SSGGNF 396
           N+ +T S +F  G I    S++  VH  D+F  GG   ++ F+   +G      S GG+ 
Sbjct: 306 NDFVTMSCNFKTGYIHSLSSQS--VHISDKFQSGGPNDIRSFQSMGLGPKDHMNSIGGDA 363

Query: 397 FYRLGITSSYRLP-NATANSPLRFQVFFNAGDSL--NKRELPQSFAA-------ATGFSL 446
           F   G++   RLP    + S  R   F N G+ +  N + L    AA       + G  +
Sbjct: 364 FVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTSAGVGI 423

Query: 447 VYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           + +  +A  +L +++PLT    D  + G  FGV LSF 
Sbjct: 424 ILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 73/158 (46%), Gaps = 18/158 (11%)

Query: 343 NNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVG------SSGGNF 396
           N+ +T S +F  G I    S++  VH  D+F  GG   ++ F+   +G      S GG+ 
Sbjct: 306 NDFVTMSCNFKTGYIHSLSSQS--VHISDKFQSGGPNDIRSFQSMGLGPKDHMNSIGGDA 363

Query: 397 FYRLGITSSYRLP-NATANSPLRFQVFFNAGDSL--NKRELPQSFAA-------ATGFSL 446
           F   G++   RLP    + S  R   F N G+ +  N + L    AA       + G  +
Sbjct: 364 FVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTSAGVGI 423

Query: 447 VYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484
           + +  +A  +L +++PLT    D  + G  FGV LSF 
Sbjct: 424 ILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.304
           YNL026W
          Length = 462

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 62/134 (46%), Gaps = 16/134 (11%)

Query: 367 VHTMDRFYLGGLKSLKGFELNTVG------SSGGNFFYRLGITSSYRLP-NATANSPLRF 419
           +H  D+F  GG   ++ F+   +G      S GG+ F   G++   +LP     +S  R 
Sbjct: 329 IHFTDKFQNGGPNDIRSFQSMGIGPRHNSYSLGGDAFLSYGVSIFSKLPIQKFHDSNFRL 388

Query: 420 QVFFNAGDSLNK---------RELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDV 470
             FFN G  +N          + L    + + G  +V +  +A  ++ +A+P+T+ + D+
Sbjct: 389 HWFFNGGKLINHDNASIWNCMQNLTIENSTSAGVGVVLRHPMARFEMNFAVPITDHQDDL 448

Query: 471 AKPGFSFGVELSFF 484
            + GF FG+   F 
Sbjct: 449 TRKGFQFGLGFEFL 462

>NCAS0B03060 Chr2 (528273..530834) [2562 bp, 853 aa] {ON} Anc_8.390
           YDR186C
          Length = 853

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 3   SPSLSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQN 62
           +PSL +     V L+AL+      +  +S ++   N+F  LS      ++DP L  P   
Sbjct: 512 APSLLSRTASTVDLEALNNETNNDINKSSATIRRKNRFRSLS------LMDPALKGPFTQ 565

Query: 63  IDNAMNNFSEIKKKLFFTGLF 83
            +NA NN S++     F  ++
Sbjct: 566 TNNANNNLSKVNSTSNFKNIY 586

>Smik_5.339 Chr5 (517721..520273) [2553 bp, 850 aa] {ON} YER167W
           (REAL)
          Length = 850

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 5/86 (5%)

Query: 372 RFYLGGL-KSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSP--LRFQVFFNAGDS 428
           R    GL  S + F L     SG N    L + S    P++T +SP   R    FN GDS
Sbjct: 290 RLQESGLYHSTESFNLK--DQSGSNNRSSLSLNSDLGTPHSTKHSPDSPRTSRSFNCGDS 347

Query: 429 LNKRELPQSFAAATGFSLVYKTALAN 454
            +  ++P+   A+  FS ++    AN
Sbjct: 348 QSGVKVPEENDASIAFSKMFTRKRAN 373

>Skud_13.342 Chr13 (586679..590176) [3498 bp, 1165 aa] {ON} YMR176W
           (REAL)
          Length = 1165

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 12/89 (13%)

Query: 325 ENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGLKSLKGF 384
           E +F K+ L  EQ+  +LN R TS  + S    IPTG+ +         +  GL+S   F
Sbjct: 336 ETDFYKSLLEAEQNTDFLNTRNTSR-NTSSEYKIPTGANS---------FRDGLQSDLQF 385

Query: 385 ELNTVGSSGGNFFYRLGITSSY--RLPNA 411
           E N V S+G   +       SY  R P A
Sbjct: 386 EPNFVSSNGIKLYKTRQEQGSYVFRFPKA 414

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,257,786
Number of extensions: 2433190
Number of successful extensions: 7031
Number of sequences better than 10.0: 52
Number of HSP's gapped: 7222
Number of HSP's successfully gapped: 52
Length of query: 484
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 371
Effective length of database: 40,524,141
Effective search space: 15034456311
Effective search space used: 15034456311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)