Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02552g5.435ON83483442130.0
KLTH0F16038g5.435ON7928638511e-101
Kwal_55.214225.435ON7824106142e-67
TDEL0E019005.435ON7628715823e-63
ZYRO0F10054g5.435ON6606915755e-63
Ecym_47615.435ON7987224722e-48
KLLA0E02201g5.435ON8354163228e-30
NDAI0B056805.435ON8564293211e-29
AER402C5.435ON8694133085e-28
TBLA0A028205.435ON9254302773e-24
Skud_4.6385.435ON8435032754e-24
KAFR0E038305.435ON8454392585e-22
YDR369C (XRS2)5.435ON8542122523e-21
KNAG0C049005.435ON7694802381e-19
NCAS0F033905.435ON8611992362e-19
Suva_2.5415.435ON8694782211e-17
Smik_4.6355.435ON8632062192e-17
Kpol_1016.55.435ON8121852183e-17
CAGL0A02838g5.435ON8281971978e-15
TPHA0J025905.435ON7753721396e-08
KAFR0A006202.454ON664108810.52
Ecym_55145.414ON854118727.1
TDEL0G046906.2ON21542699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02552g
         (834 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...  1627   0.0  
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   332   e-101
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   241   2e-67
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   228   3e-63
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   226   5e-63
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...   186   2e-48
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...   128   8e-30
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   128   1e-29
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...   123   5e-28
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   111   3e-24
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   110   4e-24
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   103   5e-22
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   101   3e-21
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...    96   1e-19
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...    96   2e-19
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...    90   1e-17
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...    89   2e-17
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....    89   3e-17
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...    80   8e-15
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    58   6e-08
KAFR0A00620 Chr1 complement(112316..114310) [1995 bp, 664 aa] {O...    36   0.52 
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    32   7.1  
TDEL0G04690 Chr7 (857805..858452) [648 bp, 215 aa] {ON} Anc_6.2 ...    31   9.5  

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score = 1627 bits (4213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 793/834 (95%), Positives = 793/834 (95%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQ        
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKENE 60

Query: 61  XXXXXXXXXXXXXAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120
                        AEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN
Sbjct: 61  LNLLNTGKLTTLNAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120

Query: 121 SMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQSH 180
           SMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQSH
Sbjct: 121 SMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQSH 180

Query: 181 LYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAGGELL 240
           LYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAGGELL
Sbjct: 181 LYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAGGELL 240

Query: 241 YCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARXXXXXXXXXXSLG 300
           YCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDAR          SLG
Sbjct: 241 YCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARKLEELKAAAESLG 300

Query: 301 YKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPDKVSET 360
           YKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPDKVSET
Sbjct: 301 YKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPDKVSET 360

Query: 361 APFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFFAGGNIQAKNEGIQKNQ 420
           APFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFFAGGNIQAKNEGIQKNQ
Sbjct: 361 APFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFFAGGNIQAKNEGIQKNQ 420

Query: 421 EFGMTRVTEGNSEGFHDVDKDDVIDEQNVEXXXXXXXXXXVKSLENLMIREKTQAEQHNK 480
           EFGMTRVTEGNSEGFHDVDKDDVIDEQNVE          VKSLENLMIREKTQAEQHNK
Sbjct: 421 EFGMTRVTEGNSEGFHDVDKDDVIDEQNVEPPRKKPRRKPVKSLENLMIREKTQAEQHNK 480

Query: 481 EIGKKPTGNECANKKPGSEDKKQKEPEAVPPYAMNEISIIPERPGQLEQSNNTASANRPR 540
           EIGKKPTGNECANKKPGSEDKKQKEPEAVPPYAMNEISIIPERPGQLEQSNNTASANRPR
Sbjct: 481 EIGKKPTGNECANKKPGSEDKKQKEPEAVPPYAMNEISIIPERPGQLEQSNNTASANRPR 540

Query: 541 HIPVQVDNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQDTKSREVSRLKNTLIQIDKN 600
           HIPVQVDNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQDTKSREVSRLKNTLIQIDKN
Sbjct: 541 HIPVQVDNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQDTKSREVSRLKNTLIQIDKN 600

Query: 601 ELTENAINSLSNLAIVEKKDLIRKNSERGHCISSDTCLWEGRKNFKKFIKVQPRRSQRET 660
           ELTENAINSLSNLAIVEKKDLIRKNSERGHCISSDTCLWEGRKNFKKFIKVQPRRSQRET
Sbjct: 601 ELTENAINSLSNLAIVEKKDLIRKNSERGHCISSDTCLWEGRKNFKKFIKVQPRRSQRET 660

Query: 661 FDSDGKNIVKNSAFLITREYVPLKKFDPNEKEQIDDTFFLNHSANEGPIPAQPRRIDETS 720
           FDSDGKNIVKNSAFLITREYVPLKKFDPNEKEQIDDTFFLNHSANEGPIPAQPRRIDETS
Sbjct: 661 FDSDGKNIVKNSAFLITREYVPLKKFDPNEKEQIDDTFFLNHSANEGPIPAQPRRIDETS 720

Query: 721 NFTDDEEGPVFNFKRTKSKDPSISPRKEHTLTNGDIEMKETSRSENRLFVTDEDDFQSLN 780
           NFTDDEEGPVFNFKRTKSKDPSISPRKEHTLTNGDIEMKETSRSENRLFVTDEDDFQSLN
Sbjct: 721 NFTDDEEGPVFNFKRTKSKDPSISPRKEHTLTNGDIEMKETSRSENRLFVTDEDDFQSLN 780

Query: 781 ITDNSIEAPERSISNPLRVNDKPSSGGNTSRLPRFTEASDDDDDEPRFRFSSRR 834
           ITDNSIEAPERSISNPLRVNDKPSSGGNTSRLPRFTEASDDDDDEPRFRFSSRR
Sbjct: 781 ITDNSIEAPERSISNPLRVNDKPSSGGNTSRLPRFTEASDDDDDEPRFRFSSRR 834

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  332 bits (851), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 268/863 (31%), Positives = 402/863 (46%), Gaps = 100/863 (11%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MWILRY+Y  E G+   +SCCLK+G  Y +GRS KSPL IK DKSISRKH+Q        
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60

Query: 61  XXXXXXXXXXXXXAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120
                         + + +DQ L F     + LE+G  P+  T+ ++  +WK+ HDL   
Sbjct: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT 120

Query: 121 SMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQSH 180
              K    + Y I VT +++++T++QIIK++Q ++ NCLF+LVK I I+ E F+ DF S 
Sbjct: 121 ESLKNH-LSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFVSQ 179

Query: 181 LYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAGGELL 240
              T  D+D  W+ +  K+  F    T  + F+ ++ +V ++  + ++K  I+   G L 
Sbjct: 180 FADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGNLW 239

Query: 241 YCENMEKFEQFIQEAAHSKDVIILKHITE--ANLTNDKNSNIDMSEDARXXXXXXXXXXS 298
            C ++     FI++   S++V+IL H+ E    L +++N+++ + E             S
Sbjct: 240 LCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQE----AKLLKNKARS 295

Query: 299 LGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPDKVS 358
           LG+K  DVND+VDAVLK D   LL+++P       EK LEE                   
Sbjct: 296 LGFKTRDVNDIVDAVLKNDILSLLDRVP------QEKALEENSA---------------- 333

Query: 359 ETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFFA-GGNIQAKNEGIQ 417
                 G +  S    D       +  KRKR NR +++PL+SL FF  G ++  K E + 
Sbjct: 334 -----GGSIAGSQVLADIVADAPNLRNKRKRANR-QIQPLNSLAFFGGGSSLSQKLEQVS 387

Query: 418 KNQEFGMTRVTEGNSEGFHDVDKDDVIDEQNVEXXXXXXXXXXVKSLENLMIREKTQAEQ 477
              +     + EG   G H   +   + ++  E               +     +T   Q
Sbjct: 388 TPAKEQNLELQEG--LGVHTNPEVHPLSKKPREEKNTLHSAGN----NSTTTFSETPIHQ 441

Query: 478 HNKEIGKKPTGNECANKKPGSEDKKQKEPEAVPPYAMNEISIIPERPGQLEQSNNTASAN 537
            + +IG +P  +  A+     ED               E +   ER   L    N+A   
Sbjct: 442 EDVQIGSEPLNHSAAHSVISKED---------------ESTHTDERNKTLV---NSAKDA 483

Query: 538 RPRHIPVQVDN-----CTLSNETRIPPNTLLTHEGVHNHST----ALVEAIQDTKSREVS 588
           R    P    N      TLSNE ++  N  ++H      +     +L++A Q+ K  EV 
Sbjct: 484 RTVTFPSIHKNELKSSRTLSNEAKVEGN--ISHADTEVQAIKRPRSLIQAFQEAKQHEVH 541

Query: 589 RLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHCISSDTCL----WEGRKN 644
           RLK  +  +   ELTE AIN L NLA VEK DL+R+ SE     S+   L    W  RKN
Sbjct: 542 RLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPEN-SNQRILTNPQWARRKN 600

Query: 645 FKKFIKVQPRRSQRETFDSDGKNIVKNSAFLITREYVPLKKFDPNEKEQIDDTF---FLN 701
           FKKF+K+ P  S R + D +  + V+N A+LITR+YV L  +D       DD F      
Sbjct: 601 FKKFVKLWPSHSSRSSPD-NITDAVRNKAYLITRDYVSLCPYDGTRNNSADDGFGDACQQ 659

Query: 702 HSANE-GPIPAQPRRIDETSNFTDDEEGPVFNFKRTKSKDPSISPRKEHTLTNGDIEMKE 760
           H+A E   + A P  +       + E GP F F+  ++ +   +     T  N  +E + 
Sbjct: 660 HAAAEQSNLTASPGNLALLG--VEVENGPAFAFQSQRAANSQANSLFNET-DNRRVEERS 716

Query: 761 TSRSENRLFVTDEDDFQSLNITDNSIEAPERSISN-PLRVNDKPSS-GGNTSRLPRFT-- 816
             R++  LFV DEDD Q        +     ++S  P R+ D   S   +  R+PR    
Sbjct: 717 PERNQ-ELFVVDEDDSQP------QVACYSNNVSQVPSRLEDADQSLQPDERRVPRVASL 769

Query: 817 -----EASDDDDDEPRFRFSSRR 834
                  SDD DDEP+FRF SRR
Sbjct: 770 RNTVQHESDDSDDEPQFRFQSRR 792

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  241 bits (614), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 139/410 (33%), Positives = 210/410 (51%), Gaps = 33/410 (8%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MWILRY+Y   +G    +SCCLKQGL Y IGRSTK+PL IK+DKSISR H++        
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 61  XXXXXXXXXXXXXAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120
                         + +   Q L F    ++  E+G  PI AT+  Q   WK+ HDL  +
Sbjct: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120

Query: 121 SMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQSH 180
               R     + I VT ++S+ T++QIIK +  ++SNCLFSL+K I I+RE F+ DF + 
Sbjct: 121 QSLSRH-LADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFVTQ 179

Query: 181 LYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAGGELL 240
           +     D+D  W  ++ ++  FPN+      F  I  +V ++  + +FK+ I+   G L 
Sbjct: 180 INDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGTLW 239

Query: 241 YCENMEKFEQFIQEAAHSKDVIILKHITEAN-LTNDKNSNIDMSEDARXXXXXXXXXXSL 299
            C+++   + FI+    S +VI+L H+       +    + D+  D +          +L
Sbjct: 240 LCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDL--DVQEAKLLKNKAQNL 297

Query: 300 GYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPDKVSE 359
           G+++HDVND+V AVL  +  +LLE++P +             LP K              
Sbjct: 298 GFRIHDVNDIVGAVLDHNFEKLLERVPVR------------NLPSK-------------- 331

Query: 360 TAPFKGQLENSTARNDFEIMEQKIPV-KRKRTNRSKVRPLDSLDFFAGGN 408
            AP    LE +T ++  +  +   P  KRKRTNR +V PLDSL FF GG+
Sbjct: 332 -APTGFPLEEATNKSVIKSADTPKPSNKRKRTNR-QVVPLDSLAFFGGGS 379

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  228 bits (582), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 253/871 (29%), Positives = 368/871 (42%), Gaps = 149/871 (17%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXX-XXXXX 59
           MWIL+Y Y+ EDG    +S CL +   + IGRS+K+PL+IKNDKSISR HI         
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 60  XXXXXXXXXXXXXXAEVLMVDQSLNFHPKGQLR----LELGIKPIIATIEWQDQVWKVSH 115
                          + L V +S++F  K  +R    +ELG KPI   + WQD V+ +  
Sbjct: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120

Query: 116 DLLYNSMFKRQEFNSYGISVTT-TMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFL 174
            L   S F     +  GI V   T+  R+   I+         CLF L+ G  I    FL
Sbjct: 121 QL---SQFI-DTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFL 176

Query: 175 SDFQSHLYMTPTDYDGIWKNLLQ--KHMVFP-NFTTCVSIFQNISI-IVASKSIYNLF-K 229
            +  + L    T ++  W +L+Q   +M++P N      I +     ++AS  I   + +
Sbjct: 177 VEVTNILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQ 236

Query: 230 YTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARXX 289
             +E   GEL+  EN E+    +++   + D+I+LK      +  DK             
Sbjct: 237 EALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDK------------- 283

Query: 290 XXXXXXXXSLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEF 349
                       KLH + DLV+AV     + LL  +P             P      D  
Sbjct: 284 -----------IKLHTLVDLVNAVSHNTVKTLLGGVP-------------PMEAGPGDVI 319

Query: 350 ITPVPDKVSETAPFKGQLENSTARNDFEIM-EQKIPVKRKRTNRSKVRPLDSLDFFAGGN 408
            +  P            L N     +  +   +K PVKR+R NR  V+PLDSL FFAGG+
Sbjct: 320 GSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPVKRRRYNR--VKPLDSLMFFAGGD 377

Query: 409 IQAKNEGIQKNQEFGMTRVTEGNSEGFHDVDKDDVIDEQNVEXXXXXXXXXXVKSLENLM 468
              +    +  QE     V    S    D  K  +  + NV               EN  
Sbjct: 378 YSTE----EPEQEISTQPVNPAAS----DTAKTSITTQINVP--------------ENDA 415

Query: 469 IREKTQAEQHNKEIGKKPTGNECANKKPGSE-------DKKQKEPEAVPPYAMNEISIIP 521
            +E +  ++    I  K +        PG            Q   +      MN     P
Sbjct: 416 SQESSAFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEINTANQHVKDIAQQIEMNH----P 471

Query: 522 ERPGQLEQSNNTASANRPRHIPVQVDNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQD 581
           E   Q EQ+N       PR    +       +    P N+  + EG       LV+ I+D
Sbjct: 472 ESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEG-------LVDLIKD 524

Query: 582 TKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKD-LIRKNSERGHCISSDTCL-- 638
            KSREV RLK+TL+Q+D +ELTE+AIN L +LAIV+  D LIR    R    S++T    
Sbjct: 525 AKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIR----RQKIDSAETSRND 580

Query: 639 ----WEGRKNFKKFIKVQPR-RSQR--ETFDSDGKNIVKNSAFLITREYVPLKKFDPNEK 691
               W+GRKNFK F+KVQ + + QR  E +     + ++NS +L+TR+YVP K +     
Sbjct: 581 QHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKESS 640

Query: 692 EQIDDTFFLNHSANEGPIPAQPRRIDETSNFTDDEEGPVFNFKRTKSKDPSISPRKEHTL 751
           +++ D  F   S       + P+ ID      D E+   F F R  S  P          
Sbjct: 641 KEMQD--FPEASEQTSRQFSVPQVID------DPEDAEPFTFTRHTSGTP---------- 682

Query: 752 TNGDIEMKETSRSENRLFVTDEDDFQSLNITDNSIEA--PERSIS----NPLRVNDKPSS 805
                       + N LFV DEDD Q+ ++   + E+  PE ++     +P R    P S
Sbjct: 683 ------------ANNGLFVVDEDDSQN-DVVLAARESIRPEEAVQLVDPSPRRSRSLPYS 729

Query: 806 GGNTSRLPR---FTEASDDDDDEPRFRFSSR 833
            G   R  R   + +  D+DDDEP+F+FS R
Sbjct: 730 PGKRKRENRRSPYDDDDDEDDDEPKFKFSRR 760

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  226 bits (575), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 189/691 (27%), Positives = 307/691 (44%), Gaps = 124/691 (17%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MWILRY+YD EDGN   +SCCL+ G  Y+IGRS+K+ L+IKNDKSISR+H+         
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60

Query: 61  XXXXXXXXXXXXXAE-VLMVDQSLNFHPK-GQLRLELGIKPIIATIEWQDQVWKVSHDLL 118
                        +E  L + +S++F    G + +ELG KP+   ++W D +W V     
Sbjct: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQ--- 117

Query: 119 YNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQ 178
             S          GI V ++  +R NL +I + Q+ YS  L+ LVK I ++   FL+   
Sbjct: 118 -GSRSDHSALEELGIEVLSSELSRANLIVIDEQQN-YSRWLYGLVKRIPLMNLEFLNVVS 175

Query: 179 SHLYMTPTDYDGIWKNLLQ-KHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAGG 237
             +    T++D IW  ++    + + ++     + QN+  +   K         IE AGG
Sbjct: 176 QKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKD--EDTSLAIEAAGG 233

Query: 238 ELLYCENMEKFEQFIQEAAHSKDVIILK-HITEANLTNDKNSNIDMSEDARXXXXXXXXX 296
           +     ++E+  + ++      +V+ILK H+T A                          
Sbjct: 234 KYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAE-----------------------EL 270

Query: 297 XSLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPDK 356
             LG K   V D+V+A+LK +   L   +  +++ R E +                VP  
Sbjct: 271 APLG-KTFTVQDVVEAILKDEVNSLKNGVIGEVAKRPEAE----------------VP-- 311

Query: 357 VSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFFAGGNIQAKNEGI 416
                                 ME+ +  K++R NR +V+PLD L FFAGG+   +++G 
Sbjct: 312 ----------------------MEKPV-TKKRRLNRPRVKPLDILSFFAGGDSMKESQG- 347

Query: 417 QKNQEFGMTRVTEGNSEGFHDVDKDDVIDEQNVEXXXXXXXXXXVKSLENLMIREKTQAE 476
                       + NS+     D   + D +              +S E+  + +    +
Sbjct: 348 --------ESTMKLNSQEEESKDPRKLEDPKE-------------ESKESKEVLQPEVPK 386

Query: 477 QHNKEIGKKPTGNECANKKPGSEDKKQKEPEAVPPYAMNEISIIPERPGQLEQSNNTASA 536
           + N E  K+  G +   +    E++K  E    P   + E    P      E+ NN    
Sbjct: 387 EFN-EYSKEEPGQKSYEESKADENEKSLEETVEPTLQVTE----PPPTSAAEKPNNA--- 438

Query: 537 NRPRHIPVQVDNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQDTKSREVSRLKNTLIQ 596
            RP   P      TLS+            +G       +++ IQDTK+ EV RL +T+IQ
Sbjct: 439 -RPHRKP------TLSD----------YRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQ 481

Query: 597 IDKNELTENAINSLSNLAIVEKKDLIRKNSERGHCISSDTCLWEGRKNFKKFIKVQPRRS 656
           +   ELTE+AIN L NL +V++ D + +  +R   + S    W  RKNFK F+KV P+  
Sbjct: 482 VGDEELTEDAINQLGNLVLVDRNDNLMRRRDRSPTVDSHNPNWNNRKNFKNFVKVWPKYG 541

Query: 657 QRETFDSDG-KNIVKNSAFLITREYVPLKKF 686
            +++   +G  + ++N AFL+TR+YVP + +
Sbjct: 542 GQDSTSREGSSDTIRNRAFLLTRQYVPTRTY 572

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score =  186 bits (472), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 195/722 (27%), Positives = 316/722 (43%), Gaps = 87/722 (12%)

Query: 1   MWILRYRYDTEDG--NWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXX 58
           MWI + +Y  +       +IS  +K    Y +GR++KS L I +++ +SR H+Q      
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59

Query: 59  XXXXXXXXXXXXXXXAEVLMVDQSLNFHPK-GQLRLELGIKPIIATIEWQDQVWKVSHDL 117
                           + +    S  FHPK   LRLE+G   I   + W    +KV  DL
Sbjct: 60  IIEITLLGAQLKIGH-KTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDL 118

Query: 118 LYNSMFKRQEFNSYGISVTTTMSTRTNLQIIK--QNQDTYSNCLFSLVKGIDIVRESFLS 175
             N +   + F   GI +  ++S  T+ QI++  Q Q  Y   LF+LVKG+ +V   FL 
Sbjct: 119 EINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178

Query: 176 DFQSHLYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVA 235
              S L      ++   K L ++  +FP F    +  + +  IV  K  +++ KYTIEV 
Sbjct: 179 GISSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVG 238

Query: 236 GGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARXXXXXXXX 295
           GG +  C   E F +       SK VI++K       +N+ +  ID ++           
Sbjct: 239 GGTVYNCITFEDFVKVTSTIPSSK-VILIK------CSNNISPAID-TQKPTDHNILLEK 290

Query: 296 XXSLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPD 355
             S+G+K HD  +L  AVL  +  + L  I + I   S+K L       K+         
Sbjct: 291 AHSIGFKQHDTRELTIAVLNNNFEETL--IDSSI---SDKRLISCNSNDKL--------- 336

Query: 356 KVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFFAGGNIQAKNEG 415
           K + T+   G   N +A +   +  +  P K++R N   V+PLDSL FFAGG+I+     
Sbjct: 337 KTTSTSLEDGLKVNVSATSGLNLNTEGPPAKKRRIN--SVKPLDSLSFFAGGSIERSTRV 394

Query: 416 IQKNQEFGMTRVTEGNSEGFHDVDKDDVIDEQNVEXXXXXXXXXXVKSLENL-------- 467
            + + E    +  E N            I E ++           +K + ++        
Sbjct: 395 ERNSSEKQTVQPAEHNK-----------IAETSIASIELLPTKSGIKEITDVVPETENEP 443

Query: 468 --MIREKTQAEQHNKEIGKKPTGNECANKKPGSEDKKQKEPEAVPPYAMNEISIIPERPG 525
             M+  K ++   N+ +     G+   + K   E +K  EP       +    I  E+  
Sbjct: 444 EPMVSPKKRSPAKNESLADMRAGDNHVSIKTTLEVEKSAEPSH---KKLKVEGIFDEK-- 498

Query: 526 QLEQSNNTASANRPRHIPVQVDNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQDTKSR 585
            +E SN      +  H+  +  + TLS ++               HS ++V AI++ K R
Sbjct: 499 -VEMSN-----EQKYHLNAESKDSTLSTQS---------------HS-SIVNAIKEIKER 536

Query: 586 EVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHCISSDTCLWEGRKNF 645
           EVSR+K T+++I  +ELTE AI  LS LA+VE  D++RK   R H  +        R+NF
Sbjct: 537 EVSRIKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQSR-HMKTETNKRHHVRRNF 595

Query: 646 KKFIKVQPRRSQRETF-DSDGKNIVKNSAFLITREYVPLKKFDPNEKEQIDDTFFLNHSA 704
           K+F+KV P    +    D  G     N      R+ VPLK ++P  K ++ D   ++ ++
Sbjct: 596 KRFVKVWPAYLNKAICQDPMGAQRYSN------RQCVPLKVYEPMNKNELTDDQLVDENS 649

Query: 705 NE 706
           +E
Sbjct: 650 SE 651

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score =  128 bits (322), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 103/416 (24%), Positives = 185/416 (44%), Gaps = 58/416 (13%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MWI+ + +D E      +   L+ G+ Y IGRS K    I+ DKSISR H+         
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHL-LIKFDGSD 59

Query: 61  XXXXXXXXXXXXXAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120
                         E++ +D+++  H +  + + +G  PI   + +  + WK+ H L  N
Sbjct: 60  LIITNKGKLTKFNEEIIPLDETIVVHNQNTV-INIGGMPIDVNVRYFYEEWKIPHRLELN 118

Query: 121 SMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQSH 180
               +   + +G+ ++ + S +T  QI   +  +YS CLF+L+KG+ +V   FL+     
Sbjct: 119 ET--KSLVSDFGVKLSESFSKKTTTQIC-SDSSSYSGCLFALLKGVPVVSIEFLNQMGKL 175

Query: 181 L----YMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAG 236
           L    Y+   D+  +++ LL +H +FP++    ++  N+++IV  + +Y+  +YTIEV G
Sbjct: 176 LQQGNYL---DFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGG 232

Query: 237 GELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARXXXXXXXXX 296
           G+     N  + ++F+    H   V++   I++    N +++ +    D           
Sbjct: 233 GDAKLLANSSELDKFL-STNHEPAVVLGSSISQK--MNSESTKLLEEFDKSIAETSLRH- 288

Query: 297 XSLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPDK 356
              G KL ++N  V+         LLE     +  R   DL  P          +PV  K
Sbjct: 289 ---GVKLLNINQFVNI--------LLENKINGLKKRDVVDLTSP----------SPVQQK 327

Query: 357 VSETAPFKGQLENSTARNDFEIMEQKIPVKRKRT-NRSKVRPLDSLDFFAGGNIQA 411
                               +I   K  V  K+T ++  ++ LDSL+FF GGN++ 
Sbjct: 328 --------------------KIQSAKASVNGKKTKSKPNIQSLDSLNFFGGGNLEV 363

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (55%), Gaps = 9/118 (7%)

Query: 572 STALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHC 631
           ST ++ AI +TK +EV RL+  +I++D++ELTE+A+    + A +     I+        
Sbjct: 591 STNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQ-IKPRVLASIP 649

Query: 632 ISSDTCLWEGRKNFKKFIKVQPRRSQR--ETFDSDGKNIVKNSAFLITREYVPLKKFD 687
           IS+    W GRKNFKKF K  P   +R  E   SD      N++  I REY+ ++K+D
Sbjct: 650 ISNGNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSD------NTSNQIGREYITMRKYD 701

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 114/429 (26%), Positives = 198/429 (46%), Gaps = 59/429 (13%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MWILRY+Y  EDG    +S CL++ + Y IGRS+K+PL IKNDKSISR+HI         
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60

Query: 61  XXXXXXXXXXXXXAEVLMVDQSLNFH--PKGQLRLELGIKPIIATIEWQDQVWKVSHDLL 118
                           L +D+SL F+     +L + LG  P+I  I WQ        +L 
Sbjct: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPM------NLY 114

Query: 119 YNSMFK--RQEFNSYGISVTT-TMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLS 175
             +M++  R     YGI VT+  +   +++  +    + Y   L +L  GI + +  +L+
Sbjct: 115 IPNMYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLT 174

Query: 176 DFQSHLYMTPTDYDGIWK--NLLQKHMVFPNFT---TCVSIFQNISIIV----------A 220
           +  + L      +D   +  N ++   + P+F+      + FQ+   I+          A
Sbjct: 175 EVSNMLRPDNITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNKSSVSEHA 234

Query: 221 SKSIYNLFKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNI 280
            KS   + + ++++ GGE          E+ I++    ++      +T+   T+ KN  I
Sbjct: 235 DKSF--ILRKSLQLIGGE----------EEIIKDPTELQN-----SVTKILSTSGKNIVI 277

Query: 281 DMSEDARXXXXXXXXXXSLGYKLHDVNDLVDAVLKRDPRQLLEKIPTK--ISFRSEKDLE 338
              ED             + ++  +V D+ D+ +K DP+ L   +     +S ++ +  E
Sbjct: 278 VTDED-------NGKRMIMNFECRNVKDIFDSFVKNDPKLLKSNLTETGVVSPKAPEIFE 330

Query: 339 EPKLPLKIDEFITPVPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPL 398
             KL ++I E   P+   ++E +     L+++      E +   I VK++R  R +V+PL
Sbjct: 331 NEKLMVEIQE--PPIEAAITEESTSSKNLKHTPP----EPVTTHI-VKKRRLARKRVKPL 383

Query: 399 DSLDFFAGG 407
           +SLDFF GG
Sbjct: 384 ESLDFFVGG 392

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 81/132 (61%), Gaps = 19/132 (14%)

Query: 574 ALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEK-KDLIRK-------N 625
           ++VE IQD K+REV+RL++++  +D  ELTE+AIN  SNLAIVE    LIR+       N
Sbjct: 540 SMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTN 599

Query: 626 SERGHCISSDTC-----LWEGRKNFKKFIKVQPRR------SQRETFDSDGKNIVKNSAF 674
                 +  D+      + EGR+NFK+F+KV P+       S  E  D+   + ++N+AF
Sbjct: 600 KSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAF 659

Query: 675 LITREYVPLKKF 686
           LITR YVPLK++
Sbjct: 660 LITRNYVPLKQY 671

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 107/413 (25%), Positives = 176/413 (42%), Gaps = 38/413 (9%)

Query: 1   MWILR--YRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXX 58
           MW+ +  Y+   + G   +ISC L     + +GR++KS L I+ +K +SR H++      
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVIDD 59

Query: 59  XXXXXXXXXXXXXXXAEVLMVDQSLNFHP-KGQLRLELGIKPIIATIEWQDQVWKVSHDL 117
                           E       L F P +  + LE+G   +   +EW    +KV + L
Sbjct: 60  HVNILLLGSQLKVG-GEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTL 118

Query: 118 LYNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDT--YSNCLFSLVKGIDIVRESFLS 175
           L       +     GI V T+ S  T   II+ ++D   Y   LF+LVKGI I+   FL 
Sbjct: 119 LQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFLK 178

Query: 176 DFQSHLYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVA 235
            F + L    TD+D   +++ ++H  F  FT   +    +  IV  K  + + KYT+E+ 
Sbjct: 179 QFTALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEIG 238

Query: 236 GGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARXXXXXXXX 295
           GG + +C ++      ++        I +         +  ++ +   +D R        
Sbjct: 239 GGTVHFCHDINDLSACLK-------TIPINGALALKYDHGISAEVKKVDDTR----YCEV 287

Query: 296 XXSLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPD 355
             S G +L  V++L  A+L     QLL K P  +                  + + PVP 
Sbjct: 288 LHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMM-----------------KLVEPVPS 330

Query: 356 KVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNR-SKVRPLDSLDFFAGG 407
            +S+T   K +  +  +  +  I +  +P K K   R  K +PLDSL FFAGG
Sbjct: 331 TISQTQEMKQESLSPISLGNTTIKD--LPRKDKTRKRLKKPQPLDSLSFFAGG 381

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 129/296 (43%), Gaps = 61/296 (20%)

Query: 575 LVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHCISS 634
           +V+AI+  K REV+R++ T++++   ELTE+AI  L +LAIV+  D++R+     H + +
Sbjct: 599 IVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQ----HTVDT 654

Query: 635 --DTCLWEGRKNFKKFIKVQPRRSQRETFDSDGKNIVKNSAFLITREYVPLKKFD----- 687
              + L   RKN+K F KV P+   R+          +N+  +  R+Y+PL+ ++     
Sbjct: 655 VGSSPLTFARKNYKNFKKVWPKYMNRKNSPE-----TRNATAISNRKYLPLELYETDLQS 709

Query: 688 ---------PNEKEQID---DTFFLNH--SANEGP-IPAQPRRIDETSNFTDDEEG--PV 730
                    P +K+ I     T  L++  ++N G   PA        +   +D  G  P+
Sbjct: 710 RTLFEDGAPPRQKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFSNHALLGNDNAGPEPI 769

Query: 731 FNF---KRTKSKDPSISPRKEHTLTNGDIEMKETSRSENRLFVTDEDDFQSLNITDNSIE 787
           FNF    R  +  P+ SP    T              +N LFV D+++     + D SI 
Sbjct: 770 FNFSSRSREDTNSPTASPAPNLT-------------HDNTLFVVDDENEDGDGMADTSI- 815

Query: 788 APERSISNPLRVNDKPSSGGNT---------SRLPRFTEASDDDDDEPRFRFSSRR 834
              + +S       KP+              +  P    A  D+D EP F F   R
Sbjct: 816 --AQRVSRERHATTKPAEPDTAEPRHTRRKHAPRPSAAAADSDEDGEPTFAFKRAR 869

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 113/430 (26%), Positives = 185/430 (43%), Gaps = 49/430 (11%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHI--------Q 52
           MWI+ Y Y + D    ++SCCLKQ   Y IGRS KSPL +KNDKSISR+H+         
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 53  XXXXXXXXXXXXXXXXXXXXXAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWK 112
                                AE L+ +  +  HP     +ELG  P++    W + V+ 
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNADIE-HPA---EVELGATPVVVCGAWTNHVYN 116

Query: 113 VSHDL-LYNSMFKRQEFN-SYGISVTTTMSTRTNLQIIKQNQDTYSNCL-FSLVKGIDIV 169
           +  +   + S  K   FN ++G      ++   +++    N +  S  L +SLV    I+
Sbjct: 117 IPIEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIIL 176

Query: 170 RESFLSDFQSHLYMTPTDYDGIWKNLLQKHMVFP----NFTTCVSIFQNISIIVASKSIY 225
           + SFL+   + L    T ++  ++NLL    +      N  +       I +IV + +  
Sbjct: 177 KSSFLTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTT 236

Query: 226 NL--FKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMS 283
           +L  F   +EV     +  E+   F   ++  +HS++ +IL  +T +N  + +   +   
Sbjct: 237 DLIYFIAAMEVINLPTITTEDDTIFINTVK--SHSEERLIL--LTTSNSRHIETIKVHTF 292

Query: 284 EDARXXXXXXXXXXSLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLP 343
           +D              G K  ++N L+  + K  P  +       IS  +E        P
Sbjct: 293 KDFYQ-----------GIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSP 341

Query: 344 LKIDEFITPVPDKVSETAPFKGQLENST-----ARNDFEIMEQKIPVKRKRTNRSKVRPL 398
              D       +KV+        L+ ++     + ND     +K PVKR+R NR +V+PL
Sbjct: 342 YIEDN------NKVNSNTISDSLLKQTSELIKPSVNDH--APEKPPVKRRRLNRKRVQPL 393

Query: 399 DSLDFFAGGN 408
           DSL FF GGN
Sbjct: 394 DSLHFFVGGN 403

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 94/323 (29%), Positives = 144/323 (44%), Gaps = 69/323 (21%)

Query: 575 LVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKD--LIRKNSERGHCI 632
            + A+QD K+RE  RL +  ++I   ELTE AIN  SNLA+VE     +I +  +    I
Sbjct: 609 FISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNNESI 668

Query: 633 SSDTCLWEGRKNFKKFIKVQP--RRSQRETFDSDGKNIVKNSAFLITREYVPLKKFDPNE 690
           +     W+GRKNFK F+K  P  R     + D+   + ++NSAFL+ REYVP+++F  N 
Sbjct: 669 TDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPMQEFKMNN 728

Query: 691 KEQIDDTFFLNHSANEGPIPAQPRRIDE-----------TSNFTDDEEGPV---FNFKRT 736
           +      F       E P+   P++ ++           T  F+ D+   +   F+F R 
Sbjct: 729 QGNRIQEF------PEFPVEYSPQQAEQLPSNGASMNTITQTFSSDDLETLEQSFSFSRA 782

Query: 737 KSKD--PSISPRKEHTLTNGDIEM---------------KETSRSEN------RLFVTDE 773
              D   ++ P    T     + +                ETS   N      R  V+ +
Sbjct: 783 SGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFDTETSPDHNLVANLARNMVSID 842

Query: 774 DDFQSLNITDNSIEAPERSIS----NPLR--------VNDKPSSGGNTSR-LP------- 813
           D   +++I  N+    E S+S    N +R        +N   S+  + SR LP       
Sbjct: 843 DTHPNISIDQNNDLGIEISMSGNDDNHIRSTSSNMNSLNRNHSTKLHNSRSLPSNNSRQS 902

Query: 814 -RFTEAS-DDDDDEPRFRFSSRR 834
            R  E S DDDDD P+F+FS +R
Sbjct: 903 FRVMEGSEDDDDDAPKFKFSRKR 925

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 150/503 (29%), Positives = 221/503 (43%), Gaps = 115/503 (22%)

Query: 395 VRPLDSLDFFAGGNIQAKNEGIQKNQEFG-MTRVTEGNSEGFHDVDKDDVIDEQNVEXXX 453
           V+PLDSL FFAGG + +K+    ++Q+F    +++ G       +    VI   N+    
Sbjct: 362 VQPLDSLSFFAGG-LSSKSSS--EHQDFADAEKLSPG-------LGLKTVISSPNI---- 407

Query: 454 XXXXXXXVKSLENLMIREKTQAEQHN-KEIGKKPTGNECANK-----KPGSEDKKQKEPE 507
                  +    +L +R   + +++N KE G+K TG    +      +  SED + K P 
Sbjct: 408 -----GRMDETSSLAVRNIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPR 462

Query: 508 AVPPYAMNEISIIPERPGQLEQSNNTASANRPRH------IPVQVDNC------------ 549
             P        +   RPG   QSN   S   P H      I    +N             
Sbjct: 463 LSP--------LTVTRPGL--QSNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLE 512

Query: 550 -------------TLSNETRIPPNTLLTHEGVHNHSTALVEAIQDTKSREVSRLKNTLIQ 596
                        + S   R  P   L  +   N   + VEAIQ+TK+REV R K+T++Q
Sbjct: 513 ENHEPPEQSQEKNSYSQVDRKSPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQ 572

Query: 597 IDKNELTENAINSLSNLAIVE-KKDLIRK------NSERGHCISSDTCL----WEGRKNF 645
           ++ +EL+E  IN L NLAIVE  +DL+RK      NS R     +++ +    W  RKNF
Sbjct: 573 LEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNF 632

Query: 646 KKFIKVQPR-RSQRETFDSDGKN--IVKNSAFLITREYVPLKKFDPNEKEQIDDTFFLNH 702
           K FIKV P+ + Q E    D +N   ++++AFLITR YVPL+K+  N K         N 
Sbjct: 633 KTFIKVWPKFKMQNEGNKGDTQNSDFIRSAAFLITRNYVPLRKYSKNNK-----ATECNG 687

Query: 703 SANEGPIPAQPRRIDETSNFTDDEEGPVFNFKRTKSKDPSISPRKEHTLTNGDIEMKETS 762
             NE  +      + E  N   +  G   N   T S      PR ++T  N DI  +   
Sbjct: 688 KENEDMLG-----LIEMENLVSN-TGVSGN---TSSAVIQQGPRTQNTFINEDISDEGNQ 738

Query: 763 RS-------------ENRLFVTDEDDFQSL-NITDNSIEAPE-RSISNPLRVNDKPSSGG 807
           +S             +N+LFVT++DD  ++ N ++N  E    + I       D+PS G 
Sbjct: 739 QSFSFSRHSDIAQPAKNKLFVTEDDDKNNMVNDSENGCELITLKKIGLRPSNFDEPSKGN 798

Query: 808 NTSR-----LPRFTEASDDDDDE 825
             SR     L    EA D++DDE
Sbjct: 799 RRSRSTAAGLHESCEAFDENDDE 821

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 125/286 (43%), Gaps = 27/286 (9%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MW++RY+   EDG+   ISCCL+    Y IGRS+K+ L IKNDKSISR+HI         
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 61  XXXXXXXXXXXXXAEVLMVDQS--------LNFHPK--GQLRLELGIKPIIATIEWQDQV 110
                         ++  +++         + + P+      +ELG  P    + W  ++
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 111 WKVSHDLLYNSMFKRQEFNSYGISVTTTMSTR-TNLQI--IKQNQDTYSNCLFSLVKGID 167
           W +   L   + F R   + +GIS  +++     NL I     + D     L++LV  I 
Sbjct: 121 WNIPSHL---TEF-RTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIP 176

Query: 168 IVRESFLSDFQSHLYMTPT---DYDGIWKNLLQ--KHMVFPNFTTCV--SIFQNISIIVA 220
           + +   L D    L         +D +WK++L   +  VF NF   V  S F  ++ I+ 
Sbjct: 177 LKKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVF-NFDASVLSSKFMKLNRIIV 235

Query: 221 SKSIYNLFKYTIEVAG--GELLYCENMEKFEQFIQEAAHSKDVIIL 264
             +  N  + +  + G   +LL  +NM+   + +     S   +IL
Sbjct: 236 LTTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLIL 281

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 114/439 (25%), Positives = 179/439 (40%), Gaps = 62/439 (14%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQ-----XXX 55
           MWILRY  + EDG    +SCCL++  +Y IGRS+K+PL IKNDKSISR+HI         
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 56  XXXXXXXXXXXXXXXXXXAEVLMVDQSLNFHPK--GQLRLELGIKPIIATIEWQDQVWKV 113
                                +  D+S  F  +    + ++LG KP++  I W    W +
Sbjct: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFWDL 120

Query: 114 SHDLLYNSMFKRQEFNSYGISVTTTMSTRTNLQ-IIKQNQDTYSNCLFSLVK-GIDIVRE 171
           S D L    F++   NS GI      S   ++  +I   +  +S  +F+L+K    +V+ 
Sbjct: 121 SKDFL---QFEKS-INSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKP 176

Query: 172 SFLSDFQSHLYM-TPTDYDGIWKNLLQK---HMVFPNFTT----CVSIFQNISI-IVASK 222
             LS+  + L     T++D IW  L +    + V+P FT      +  FQ++    V S 
Sbjct: 177 VLLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSI 236

Query: 223 SIYNL--FKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNI 280
           S  +L   K T+    G     +  +    +I+   H+    +LK I             
Sbjct: 237 SHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHN----LLKCIALK---------- 282

Query: 281 DMSEDARXXXXXXXXXXSLGYKLHDVNDLVDAVLKRDPRQLLEKI-----------PTKI 329
              ED              G K++ + ++V A+L  + + L   I              I
Sbjct: 283 --QEDPAPDEIQ-------GIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSI 333

Query: 330 SFRSEKDLEEPKL-PLKIDEFITPVPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRK 388
           S  +E       + P       T     +S  A  +   E   +     +M      +R+
Sbjct: 334 SHYNEDAQRNSHVHPDNTSTLNTNTHATISAAA--EASREGGESLEPPTVMGPSPTKRRR 391

Query: 389 RTNRSKVRPLDSLDFFAGG 407
              R+ V+PLDSL FFAGG
Sbjct: 392 LVRRT-VKPLDSLSFFAGG 409

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 131/281 (46%), Gaps = 34/281 (12%)

Query: 573 TALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKK-DLIRKNSERGHC 631
            A +EA+Q TK+REV R++  ++ +  +EL+E AIN LSNL IVE   +LIR+   R   
Sbjct: 580 AAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRE--RRADK 637

Query: 632 ISSDTCLWEGRKNFKKFIKVQPRRSQRETFDSDGKNIVKNSAFLITREYVPLKKFDPNEK 691
             S   +W+GR+NFKKF KV P+   R+ +DS     ++N+AFLI R YV LK +D    
Sbjct: 638 NDSVNDMWKGRRNFKKFNKVWPQ--HRDGYDS-----LRNNAFLIIRNYVELKPYDGKRN 690

Query: 692 EQIDDTFFLNHSANEGPIPAQPRRIDETSNFTDDEEGPVFNFKRTKSKDPSISPRKEH-- 749
           +     F   H             +    N    E+  + N  RTK+   + +   E   
Sbjct: 691 DNDSSDF---HEGRSHFNDENDYEVIRRGNPAVSEDDILLNEMRTKAIGLTDNGNDEDFT 747

Query: 750 TLTNGDIEMKETSRSENRLFVTDEDDFQSL-----------NITDNSIEAPERSISNPLR 798
            + N D +   T    +RLFV D+D    L           N   N     E S S  L 
Sbjct: 748 RIANSD-QAVPTVHGVSRLFVADDDSEDELQEERLEKGFGSNRNSNHSFVKEGSTSGIL- 805

Query: 799 VNDKPSSGGNTSRLPR---FTE--ASDDDDDEPRFRFSSRR 834
            ND        S L R   FT+  + D+DDD P+F+F   R
Sbjct: 806 -NDFSKDTVLRSHLGRKKAFTQIDSGDEDDDGPKFKFRRNR 845

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 110/212 (51%), Gaps = 42/212 (19%)

Query: 574 ALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVE-KKDLIRKN-SERGHC 631
           A VEAIQ+TK+REV R+K+T++++   EL+E AIN L NLAIVE   +L+RK+    G+ 
Sbjct: 558 AFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNK 617

Query: 632 ISSDTCLWEG---------RKNFKKFIKVQPR-RSQRETFDSDGKN------IVKNSAFL 675
            S  T  WE          RKNFK F+KV+P+ ++ +E    +GKN       ++N+AFL
Sbjct: 618 TSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKE----EGKNNTQSSDFIRNAAFL 673

Query: 676 ITREYVPLKK------------------FDPNEKEQIDDTFFLNHSANEGPIPAQPRRID 717
           ITR YVPLKK                  F   E E+     F++ + N   I  + + ++
Sbjct: 674 ITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSDNINSNTIQKRSQALN 733

Query: 718 ETSNFTDDEEGP--VFNFKRTKSKDPSISPRK 747
             +N     EG    F+F R      S+ P K
Sbjct: 734 RFTNEDSSNEGEEDSFSFSRCSGTAASVQPLK 765

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 108/429 (25%), Positives = 180/429 (41%), Gaps = 76/429 (17%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MW++RY+   EDG+   ISCCL+    Y IGRS+K+PL IKNDKSISR+HI         
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 61  XXXXXXXXXXXXXAEV-------LMVDQSLNFHPKGQLR---LELGIKPIIATIEWQDQV 110
                         ++       + V ++   +    L+   +ELG  PI    EW ++V
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 111 WKVSHDLLYNSMFKRQEFNSYGISVTTTMS-TRTNLQI--IKQNQDTYSNCLFSLVKGID 167
           W +   L   + F R   + YGIS   +++    NL I    +++D     L++LV  I 
Sbjct: 121 WNIPPHL---TQF-RTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIP 176

Query: 168 IVRESFLSDFQSHLYMTP---TDYDGIWKNLLQ--KHMVF---PNFTTCVSI-FQNISII 218
           + +  FL +  + L  T      +D +W +++   ++ VF   PN      +   NI ++
Sbjct: 177 MKKSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVL 236

Query: 219 VASKSIYNLFKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNS 278
              KS   L    +      L   +N++   +++     S + +IL        T DK  
Sbjct: 237 TTIKSEPRL-SSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILT-------TTDKKE 288

Query: 279 NIDMSEDARXXXXXXXXXXSLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLE 338
           N                    G  L  +  ++ +++      ++      +   S + L+
Sbjct: 289 N--------------------GKILCTIKTMLTSIIDGTLSAVIN-----MKGASSRTLD 323

Query: 339 EPKLPLKIDEFITPVPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPL 398
             K             D++SE       L+ S A    E+    +  K+++ NR +V PL
Sbjct: 324 NGKF------------DQISEG--MSTILKTSRAP---EVEASPVVSKKRKLNRRRVLPL 366

Query: 399 DSLDFFAGG 407
           DSLDFFAGG
Sbjct: 367 DSLDFFAGG 375

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 126/480 (26%), Positives = 209/480 (43%), Gaps = 73/480 (15%)

Query: 378 IMEQKIPVKRKRTNRSKVRPLDSLDFFAGGNI-----QAKNEGIQKNQEFGMTRVTEGNS 432
           + +  +P+K++R NR KV+PL+ L+FFAGG+      Q+ ++G+   +    T V++   
Sbjct: 338 VEDTAVPLKKRRLNRRKVQPLNPLEFFAGGDTATTTKQSSDDGLAATKAVDETEVSD-KM 396

Query: 433 EGFHDVDKDDVIDEQN-VEXXXXXXXXXXVKSLENLMIREKTQAEQHNKEIGKKPTGNEC 491
            G  DV  +   + Q+ V           + +L   +   K     H  E  +    ++C
Sbjct: 397 HGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEV--PKGDESSHVVEPDRTYEKDDC 454

Query: 492 ANKKPGSEDKKQKEPEAV----PPYAMNEISIIPERP--GQLEQSNNTASANRPRHIPVQ 545
                   +   KEPE V       ++NE    P+ P     ++       + P H+   
Sbjct: 455 LPDN-LEVNGMMKEPEPVIEKTRQSSINESLRTPKEPVAEMEDELEEVDEVDEPTHLKAS 513

Query: 546 VDNCTLSNETRIPPN----TLLTHEGVHNHSTALVEAIQDTKSREVSRLKNTLIQIDKNE 601
            +   +     + P+     L        +S++LVE IQ  K  E  RL+ TL  +D +E
Sbjct: 514 REASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLVETIQSVKDNETRRLQCTLTPVDPSE 573

Query: 602 LTENAINSLSNLAIVEKK-DLIRKNSERGHCISSDTCLWEGRKNFKKFIKVQPRRSQRET 660
           LT+ AI   SN+AIVE   +++RK       + +++ +   R NFKKF+KV P+  +   
Sbjct: 574 LTDEAIADFSNMAIVEPTVNIVRKKP----AMVTESSIRSDRPNFKKFMKVWPKARK--- 626

Query: 661 FDSDGKNIVKNSAFLITREYVPLKKFDPNEKEQIDDTFFLNHSANEGPIPAQPRRIDETS 720
               G + ++N+A+LITR+YVP+K ++ NE                      P+  DE  
Sbjct: 627 ----GNDSLRNNAYLITRDYVPMKAYNRNE----------------------PKVFDEFE 660

Query: 721 NFTDDEEGPVFNFKRTKSKDPSISPRKEHTLTNGDIE--MKETSRSENRLFV---TDEDD 775
           N T     P          +P I P +     N D    + + + SEN LFV   +DED+
Sbjct: 661 NVTKAGILPDI-------IEPPIQPSQS---LNHDTPPLLDDKAVSENELFVAEDSDEDE 710

Query: 776 F--QSLNITDNSIEAPERSISNPLRVNDKPSSGGNTSRLPRFTEASDDDDDEPRFRFSSR 833
              +    TD   +   R     L   ++  +  +T+ L    + SD DD  PRF+FS R
Sbjct: 711 IPAEHARYTDTLPKEAARPRRRLLTTEEQ--ADNSTTHLTSSGDESDSDDQGPRFKFSRR 768

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 129/282 (45%), Gaps = 23/282 (8%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKS-PLHIKNDKSISRKHIQXXXXXXX 59
           MWILRY Y++ED     +SCCL++   Y IGRS+K+  L IKNDKSISR+HI        
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 60  XXXXXXXXXXXXXXAEVLMVDQS--LNFHPKGQLRLELGIKPIIATIEWQD------QVW 111
                            L   ++  ++     +  +++G  P+I  + W+D       + 
Sbjct: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120

Query: 112 KVSHDLLYNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRE 171
                L    ++     +++G+++   M T      IK  +  + + L +L++G + + +
Sbjct: 121 DTGQSLKLIGIYPAG--STHGVNIEDAMKT----LCIKIKEIKWPHQLIALIRGANRLYK 174

Query: 172 SFLSDFQSHLYMTP----TDYDGIWKNLLQ--KHMVFPNFTTCVSIFQNISIIVASKSIY 225
           + L D  +   +      + +D IW   +   ++  +PNF    + F++ +II    +  
Sbjct: 175 ADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDS 234

Query: 226 NL--FKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILK 265
           ++   +  +E  GG LL   N E FE++        +V++L+
Sbjct: 235 DISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLR 276

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 93/199 (46%), Gaps = 9/199 (4%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MW+LRY+YD EDG+   IS C+++ + Y IGRS K+ L IKNDKSISR+H+         
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60

Query: 61  XXXXXXXXXXXXXAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120
                         + L V QSL F     L ++LG KP++  +E+    W     L+ N
Sbjct: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNW-----LIPN 115

Query: 121 SMFKRQE-FNSYGISVTTTMSTRTNLQ---IIKQNQDTYSNCLFSLVKGIDIVRESFLSD 176
            + +  E    +G++V T +      Q   I+ +   +    L+  +K I + +  F S 
Sbjct: 116 GLTQFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFST 175

Query: 177 FQSHLYMTPTDYDGIWKNL 195
               L     D+D  W  L
Sbjct: 176 ACEILSSNDNDFDNSWHRL 194

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 110/478 (23%), Positives = 198/478 (41%), Gaps = 83/478 (17%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MW++RY+   EDG+  SISCCL+    Y IGRS+K+ L IKNDKSISR+H+         
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 61  XXXXXXXXXXXXXAEVLMVDQSLNFHPKGQL------------RLELGIKPIIATIEWQD 108
                         ++  +++   F   G+              +ELG  PI    EW D
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKK--FMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWID 118

Query: 109 QVWKVSHDLLYNSMFKRQEFNSYGISVTTTMSTRTNLQIIK---QNQDTYSNCLFSLVKG 165
           ++W +  +L        Q    +GI+  T++   +   +I     N D     L++LV  
Sbjct: 119 EIWNIPSNLAQFQTILSQ----FGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHT 174

Query: 166 IDIVRESFLSDFQSHLYMTPT---DYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASK 222
           I + +   L D  + L  +      +D  W N++                        +K
Sbjct: 175 IPLKKSQLLVDLCNSLLSSSVMNLKFDETWNNMV------------------------NK 210

Query: 223 SIYNLFKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHIT----EANLTNDKNS 278
            ++ +F Y   V   + +  +N+        E+       IL+ +       +  ND   
Sbjct: 211 PLFKVFDYDPSVLFSKFMRLDNVITLTTIGNESGLPN---ILRRLNVRLFHFDCLNDLYK 267

Query: 279 NIDMSEDA-RXXXXXXXXXXSLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDL 337
           ++D+ + + +            G KL  + +L+ +++        + +P+ I+ ++    
Sbjct: 268 HVDLLKPSEKYLILTFTNKRENGQKLCTLQNLITSIID-------DTLPSVINTKA---- 316

Query: 338 EEPKLPLKIDEFITPVPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRP 397
               +P ++ E  TP  +KV     F+G    S   +  E       +K++R NR +V+P
Sbjct: 317 ----VPFEVQENNTP--EKV-----FEGHTAISKTVHTPETEATPAVLKKRRLNRRRVQP 365

Query: 398 LDSLDFFAGG---NIQAKNEGIQKNQE--FGMTRVTEGNSEGFHDVDKDDVIDEQNVE 450
           LDSL+FFAGG   +  +K++G    +E  F +   T  +S    ++D+      QN +
Sbjct: 366 LDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQNTQ 423

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 111/206 (53%), Gaps = 34/206 (16%)

Query: 574 ALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEK-KDLIRKNSE-RGHC 631
           + V+AIQ TK REV R+K+T+++++ +EL+E AIN L  LAIVE   DL+RK  + R + 
Sbjct: 554 SFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNT 613

Query: 632 ISSDT---------CLWEGRKNFKKFIKVQPR-RSQRETF--DSDGKNIVKNSAFLITRE 679
           +SS T           W+ RKNFK F+K  P+ ++Q+E    D+   + ++ +AFLITR 
Sbjct: 614 VSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRN 673

Query: 680 YVPLKKFDP------------------NEKEQIDDTFFLNHSANEGPIPAQP--RRIDET 719
           YVPLKK+                     E E+I    +++ + N   I  +P  +RI  +
Sbjct: 674 YVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISDTTNSTTIHKRPQTQRIFIS 733

Query: 720 SNFTDDEEGPVFNFKRTKSKDPSISP 745
            + +D+ E   F+F R     P+  P
Sbjct: 734 EDSSDNGEEDSFSFSRGSDAAPNAQP 759

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 98/213 (46%), Gaps = 20/213 (9%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MW++RY+   EDG    ISCCL+    Y IGRS+K+PL IK+DKSISR+HI         
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 61  XXXXXXXXXXXXXAEV-------LMVDQSLNFHPKG---QLRLELGIKPIIATIEWQDQV 110
                         ++       + V ++      G      +ELG  PI   +EW++QV
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 111 WKVSHDLLYNSMFKRQEFNSYGISVTTTMS-TRTNLQI--IKQNQDTYSNCLFSLVKGID 167
           W +   L   + F R   + +GIS  T+++   TN+ I     + D     L +L + I 
Sbjct: 121 WNIPSHL---AQF-RTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIP 176

Query: 168 IVRESFLSDFQSHLY---MTPTDYDGIWKNLLQ 197
           + +   L    + L    +T   +D  W ++++
Sbjct: 177 LKKSQLLVKLCNTLLSASITDLTFDERWNDIVK 209

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 99/185 (53%), Gaps = 19/185 (10%)

Query: 566 EGVHNHSTALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKN 625
           E +   S  LV AIQD K RE  R+K ++++I +NELTE AIN  S+L +V+    + K+
Sbjct: 515 ERIERPSVDLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLFKD 574

Query: 626 SE----RGHCISSDTCLWEGRKNFKKFIKVQP--RRSQRETFDSDG-KNIVKNSAFLITR 678
                 +    + +   W G+KNFKKF+K+ P  +RSQ     +D     ++NSA LITR
Sbjct: 575 KSLDINKPANSNQNNMDWSGKKNFKKFVKMVPKYKRSQGNGQHADSCSTFIRNSAMLITR 634

Query: 679 EYVPLKKF-----DPNEKEQIDDTFFLNHSANEGPIPAQPRRIDETSNFTDDEEGPVFNF 733
            +VP+K++     + N  E  D   F N   N+ P+  +  R   +S+ + DE  P F F
Sbjct: 635 NFVPMKQYSKLDNNSNSNEMTD---FSNIEVNKKPV--EKNREAYSSDDSVDE--PSFTF 687

Query: 734 KRTKS 738
            R  S
Sbjct: 688 TRNSS 692

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 117/266 (43%), Gaps = 33/266 (12%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MW+LRY+Y  +DG+   ISCC++    Y +GRS+K+ L ++NDKSISR+ I         
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 61  XXXXXXXXXXXXXAEVLMVD-QSLNFHPKGQL-RLELGIKPIIATIEWQDQ---VWKVSH 115
                         E  + D ++L+F  K  L  +++G  PI+  + W+ +     K   
Sbjct: 61  CIMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNLSWEVKRCNYMKTDM 120

Query: 116 DLLYNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQN-----QDTYSNCLFSLVKGIDIVR 170
           D+++          SYG   TT  ++ + L +I QN      D Y  C +S++    ++ 
Sbjct: 121 DMVH-------LLQSYGFQPTTIENSHS-LDMIIQNDVTTISDKYLKC-YSMIHDTILIN 171

Query: 171 ESFLSDFQSHLYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKY 230
              L D  ++  +    +D  W  L        N T        I++   +KS+  +  +
Sbjct: 172 SKTLRDILTNNIIMTKKFDSYWVKLNSHESNIQNHT--------INVTKLAKSLKGMHMF 223

Query: 231 TIEVAGGELLYCENMEKFEQFIQEAA 256
            ++          N E FE+F++E  
Sbjct: 224 LLDPES------YNCEYFEKFLEEIG 243

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 21/22 (95%)

Query: 386 KRKRTNRSKVRPLDSLDFFAGG 407
           K++R NRS+V+PLDSL+FFAGG
Sbjct: 349 KKRRLNRSRVKPLDSLNFFAGG 370

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 92/197 (46%), Gaps = 7/197 (3%)

Query: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQXXXXXXXX 60
           MW+LRY Y  E G    +SCC++Q + Y IGRS+K+ L IKNDKSISR+H+         
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  XXXXXXXXXXXXXAEVLMVDQSLNFHPKGQLRLE--LGIKPIIATIEWQDQVWKVSHDLL 118
                        +E  +    L  +   + ++E  LG+ P+   +   D+++ + + L 
Sbjct: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSL- 119

Query: 119 YNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQ 178
             S F R+   + GI ++   +   +  +I      Y   LF+    I+I     L++  
Sbjct: 120 --SQF-RETLETLGIQISVDNANVNSTSLITVGDFGYRE-LFAACNDINIYSSGLLTEIC 175

Query: 179 SHLYMTPTDYDGIWKNL 195
           + L     ++D  W+++
Sbjct: 176 NKLVNDHDNFDAEWRSM 192

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 77/115 (66%), Gaps = 10/115 (8%)

Query: 575 LVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEK-KDLIRKNSERGHCIS 633
           +V+ +Q TK  EV RL +T+++I+ +ELTE AIN L++L +VE   DLIR  S+    IS
Sbjct: 553 IVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSD----IS 608

Query: 634 SDTCL---WEGRKNFKKFIKVQPR-RSQRETFDSDGKNIVKNSAFLITREYVPLK 684
           ++      W+ RKNFKKF+K+ P+ +S++ + +S  ++I + S  ++TRE++  K
Sbjct: 609 ANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHI-RGSGEILTREFLQTK 662

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 55/133 (41%), Gaps = 28/133 (21%)

Query: 299 LGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDE---FI----- 350
           L  ++HD     D +L+    +  ++IP  IS    K L E  L +  D+   FI     
Sbjct: 238 LSVEIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYLPEDTLQIHSDDIYKFIESGDL 297

Query: 351 ------------TPVPDKVSETA----PFKGQLENSTARNDFEIMEQKIPVKRKRTNRSK 394
                        P+ D   ET     P K  L N++   D  +       K+KR  R K
Sbjct: 298 YRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQPTDTSLES----TKKKRVRRHK 353

Query: 395 VRPLDSLDFFAGG 407
           V PL+SL FFAGG
Sbjct: 354 VEPLNSLSFFAGG 366

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 103/372 (27%), Positives = 163/372 (43%), Gaps = 53/372 (14%)

Query: 368 ENSTARNDFEIMEQKIPV-KRKRTNRSKVRPLDSLDFFAGG--------NIQAKNEGIQK 418
           E  + ++D  I +Q+ P  KR+R NRSKV+PLD+L FFAGG        N +  N+ +Q 
Sbjct: 316 EVKSPKDDNIIEKQEPPAPKRRRMNRSKVKPLDTLSFFAGGMSHDTHSINTKPSND-VQS 374

Query: 419 NQEFGMTRVTEGNSEGFHDVDKDDVIDEQNVEXXXXXXXXXXVKSLENLMIREKTQAEQH 478
           +QE      TE       DV+   +   Q+VE             L+      K   ++ 
Sbjct: 375 HQE------TEK------DVNNSKIESIQDVESNQDQTKYDKSTELQKSKAVSKNADDKL 422

Query: 479 NKEIGKKPTGNECANK----KPGSEDKKQKEPEAVPPYAMNEISIIPERPGQLEQSNNTA 534
                +KP       K     P   DK  +   A     M E + + ++P  L+  NN  
Sbjct: 423 QDSTAEKPINFNPTTKTPSFSPSINDKAIENSNANLDPTM-EKTRVNKKPASLDTKNNLL 481

Query: 535 SANRPRHIPVQVDNCTLSNETRIPP-----NTLLTHEGV-HNHSTALVEAIQDTKSREVS 588
                + I  Q+ N  LS +T   P      TLL +     + ST LV  IQ+ KSR V 
Sbjct: 482 DN---KLIAEQI-NEALSAKTNDAPVVRRRRTLLDYGNTDKSSSTDLVRTIQNVKSRGVD 537

Query: 589 RLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHCISSDTCL-----WEGRK 643
           R+ + ++ +D+NEL E  +N   ++ +V+  D + K       +  +  +     ++ RK
Sbjct: 538 RVNSKIVTVDENELNEEELNKFFDVVVVDVNDKLMKKHPNAQKVIDNANIDHNSNFKNRK 597

Query: 644 NFKKFIKVQPR-----RSQRETFDSD-GKNIVKNSAFLITREYVPLKKFDPNEKEQIDDT 697
           ++K F K  P+       Q  +  SD G+N+V +      R  +PL+K++ NEK    D 
Sbjct: 598 DYKLFKKSIPKWQSKLNKQHHSMTSDNGENLVVSK----NRNKIPLRKYNENEKIHEADI 653

Query: 698 F-FLNHSANEGP 708
           F F +    E P
Sbjct: 654 FEFESSKKTENP 665

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 34/51 (66%)

Query: 1  MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHI 51
          M ILRY+    DG    +SCCL   + Y IGRS+K+   IKNDKSISR+H+
Sbjct: 1  MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHV 51

>KAFR0A00620 Chr1 complement(112316..114310) [1995 bp, 664 aa] {ON}
           Anc_2.454 YMR100W
          Length = 664

 Score = 35.8 bits (81), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 50/108 (46%), Gaps = 13/108 (12%)

Query: 96  GIKPIIATIEWQDQVWKVSHDLLYNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTY 155
           GI PI+ATI     ++  ++D   +S +K      YG     +++ +T  ++ +++ + Y
Sbjct: 136 GILPILATILDNFLIYHGNYDFFTDSYYK------YGFQ---SLTLKTGFEMFRKHDEDY 186

Query: 156 SNCLFSLVKGIDIVRESFLS----DFQSHLYMTPTDYDGIWKNLLQKH 199
              L  L+    +     +S    DF     M P++Y+ IWK   + H
Sbjct: 187 MAYLAFLLGNDSLSLSDDVSFKNEDFFKPAMMVPSNYEMIWKRYAKYH 234

>Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar to
           Ashbya gossypii AER241W
          Length = 854

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 65/118 (55%), Gaps = 13/118 (11%)

Query: 578 AIQDTKSREVSRLKN---TLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHCISS 634
           +IQDTK RE++  +N   +L Q  +N L ++  N  +N+ + ++++ ++    R + +++
Sbjct: 561 SIQDTKEREIALWENKYESLKQTYENMLKQDRNNDFNNI-LEQRREELKSLMRRYNDLTT 619

Query: 635 DTCLWEGRKNFKKFIKVQPRRSQRETFDSDGKNIVKNSAFLITREYVPLKKFDPNEKE 692
           +        N     ++  ++S +E++  D K +     F IT+E+V +K+ +P+ KE
Sbjct: 620 E--------NLSLTKELNKQKSHKESYKEDLKKVQSRLDF-ITKEFVKIKEANPDGKE 668

>TDEL0G04690 Chr7 (857805..858452) [648 bp, 215 aa] {ON} Anc_6.2
           YPL267W
          Length = 215

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 688 PNEKEQIDDTFFLNHSANEGPIPAQPRRIDETSNFTDDEEGP 729
           P++K Q+D T+ LN+S     +   P++  ETS FT  EE P
Sbjct: 37  PSKKSQVDLTYALNNSPVRS-VSLSPKKSAETSAFTFHEETP 77

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,219,278
Number of extensions: 4400816
Number of successful extensions: 13653
Number of sequences better than 10.0: 140
Number of HSP's gapped: 14231
Number of HSP's successfully gapped: 167
Length of query: 834
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 716
Effective length of database: 39,950,811
Effective search space: 28604780676
Effective search space used: 28604780676
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)