Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02530g5.434ON31231215590.0
Suva_2.5405.434ON31231211351e-156
YDR368W (YPR1)5.434ON31231211151e-153
Skud_4.6375.434ON31231211071e-152
Smik_15.2985.434ON31231210981e-151
NDAI0C016005.434ON31331210961e-150
Skud_15.2835.434ON31231210901e-150
Suva_8.1735.434ON31231210901e-150
YOR120W (GCY1)5.434ON31231210891e-149
Smik_4.6345.434ON31231210751e-147
KNAG0C049105.434ON31331210481e-143
TBLA0A02825singletonON31131210341e-141
CAGL0A02816g5.434ON31031010321e-141
KLLA0B14707gsingletonON31031010311e-141
CAGL0I01100g5.434ON31030710251e-140
Kwal_47.18084na 1ON30930510251e-140
Kpol_1062.295.434ON31131010151e-138
KLTH0E15532gsingletonON30930210131e-138
NCAS0H020605.434ON32230610111e-137
TBLA0A065105.434ON31231210001e-136
NCAS0F033805.434ON3133139891e-134
KLTH0F16060g5.434ON3093089881e-134
TDEL0D00230singletonON3123059881e-134
ZYRO0F10032g5.434ON3103109881e-134
TDEL0E019105.434ON3113129851e-134
KLTH0E00220gsingletonON3063019821e-133
KLTH0A00528gsingletonON3063019821e-133
TPHA0G00210singletonON3113129761e-132
KLLA0D10109gsingletonON3093029561e-129
Kwal_55.214265.434ON3083089561e-129
KLTH0A03476gna 1ON3083039401e-127
KAFR0E03850singletonON3113139331e-126
NDAI0B056705.434ON3183129261e-125
TPHA0E017605.434ON3103109171e-123
KAFR0E038405.434ON3103148821e-118
TBLA0A02835singletonON3113128691e-116
AER401W5.434ON3133088601e-115
SAKL0C10626gsingletonON3222935499e-68
NDAI0A070003.108ON3203065281e-64
KAFR0G013503.108ON3243075054e-61
KLLA0F02728g3.108ON3303005047e-61
Kwal_56.226113.108ON3213124983e-60
KNAG0K020703.108ON3233044984e-60
NCAS0I024203.108ON3202894905e-59
Suva_4.3983.108ON3443164918e-59
ACL107C5.409ON3543224883e-58
SAKL0C09922g3.108ON3223004828e-58
YBR149W (ARA1)3.108ON3443164821e-57
KLTH0C10010g3.108ON3213214792e-57
Smik_2.2883.108ON3443194803e-57
Skud_2.2763.108ON3443164787e-57
Smik_2.289singletonON3443164725e-56
KLTH0F16610g5.409ON3293304629e-55
TDEL0D051603.108ON3253134602e-54
ZYRO0B06138g3.108ON3283104602e-54
Ecym_55085.409ON3263274402e-51
TDEL0E021505.409ON3293334323e-50
NCAS0A066605.409ON3263284323e-50
Kwal_47.18893na 2ON2892894284e-50
KNAG0B03780singletonON3263094314e-50
TPHA0E018605.409ON3263294229e-49
KLLA0F03256g7.468ON2852914171e-48
Ecym_7160na 3ON2712914152e-48
CAGL0I01122g5.409ON3263294192e-48
ZYRO0A06336g5.409ON3273294193e-48
KAFR0C05320singletonON3273324183e-48
KLLA0E21627g5.409ON3293274168e-48
NDAI0D016005.409ON3273334158e-48
Kwal_55.215365.409ON3293314159e-48
SAKL0F14278g7.468ON2862854102e-47
SAKL0F02574gna 2ON2892914102e-47
KLTH0G05786g7.468ON2862774083e-47
Kwal_47.182197.468ON2932844084e-47
KLTH0G02420gna 2ON2892984069e-47
CAGL0C04543g7.468ON2873014015e-46
TBLA0A00630singletonON3282914029e-46
TBLA0F01720singletonON3263083983e-45
YJR096W7.468ON2823033953e-45
TDEL0C033207.468ON2833003944e-45
KAFR0G009207.468ON2862803936e-45
Skud_8.1655.409ON3273053932e-44
KNAG0D013707.468ON2822773902e-44
SAKL0G01914g5.409ON3293293913e-44
YHR104W (GRE3)5.409ON3273043914e-44
ZYRO0G17600g7.468ON2832863865e-44
Smik_10.3847.468ON2823013865e-44
Kpol_1013.827.468ON2852783859e-44
ABL209Cna 3ON3102873879e-44
Skud_10.3187.468ON2823003859e-44
Suva_15.3005.409ON3273283835e-43
Smik_8.1825.409ON3273063811e-42
Suva_12.1847.468ON2822813762e-42
NCAS0H005607.468ON2842863762e-42
KLTH0F01892gna 4ON3022873755e-42
KLLA0F05775g7.285ON3092753694e-41
Kwal_33.13276na 4ON3022813642e-40
Kpol_1020.137.285ON3133243615e-40
Kwal_47.19278na 5ON3143233539e-39
ZYRO0E09614gna 5ON3083093502e-38
ZYRO0C09196g7.285ON3123073442e-37
SAKL0F00704gna 5ON3153123415e-37
KLTH0G00638gna 5ON3133173407e-37
CAGL0J09394g7.285ON3113073372e-36
Smik_4.1137.285ON3123133363e-36
YDL124W7.285ON3123093312e-35
SAKL0F09746g7.285ON3123273293e-35
NCAS0A137407.285ON3093033284e-35
TDEL0D02790singletonON3293043285e-35
Skud_4.1317.285ON3123073268e-35
NDAI0A023007.285ON3133133232e-34
KAFR0B012007.285ON3153093111e-32
Kpol_381.8singletonON3093223102e-32
KNAG0C041107.285ON3113133032e-31
TBLA0F019807.285ON3023142987e-31
Ecym_32647.285ON3112692621e-25
Kwal_33.13274singletonON108841604e-13
Suva_4.1227.285ON2061821145e-06
Suva_12.272singletonON265196960.001
NCAS0A129502.604ON32381920.005
KNAG0M023402.604ON309296910.007
TPHA0C025602.604ON340111870.021
Ecym_22962.604ON340148860.028
Kwal_26.83772.604ON33881860.030
Kpol_449.4singletonON341255850.032
Kwal_26.93223.462ON33136810.10
TPHA0H00110singletonON345307800.16
Suva_9.17singletonON308218760.46
TBLA0G01120singletonON343110760.52
ZYRO0F00858g2.604ON34678750.69
TBLA0B10110singletonON345113740.91
TBLA0G00960singletonON321122731.1
TPHA0I008801.265ON68961731.2
Kwal_33.13275singletonOFF6732651.7
YNL331C (AAD14)na 6ON376101711.8
Smik_3.208singletonON344315702.3
YFL056C (AAD6)singletonON212102692.7
YDL243C (AAD4)singletonON329101683.9
KLTH0A06908g6.347ON58763694.1
NDAI0G044402.653ON1708114685.4
NCAS0C02450singletonON343159666.7
NDAI0B009305.76ON94073677.8
TDEL0E010804.262ON61676668.6
Suva_14.10na 6ON376101659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02530g
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   605   0.0  
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   441   e-156
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   434   e-153
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   431   e-152
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   427   e-151
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   426   e-150
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   424   e-150
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   424   e-150
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   424   e-149
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   418   e-147
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   408   e-143
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     402   e-141
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   402   e-141
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   401   e-141
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   399   e-140
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   399   e-140
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   395   e-138
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   394   e-138
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     394   e-137
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   389   e-136
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     385   e-134
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   385   e-134
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   385   e-134
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   385   e-134
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   384   e-134
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   382   e-133
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   382   e-133
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 380   e-132
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   372   e-129
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   372   e-129
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   366   e-127
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     363   e-126
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   361   e-125
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   357   e-123
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   344   e-118
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     339   e-116
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   335   e-115
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   216   9e-68
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   207   1e-64
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   199   4e-61
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   198   7e-61
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   196   3e-60
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   196   4e-60
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   193   5e-59
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   193   8e-59
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   192   3e-58
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   190   8e-58
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   190   1e-57
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   189   2e-57
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   189   3e-57
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   188   7e-57
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   186   5e-56
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   182   9e-55
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   181   2e-54
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   181   2e-54
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   174   2e-51
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   171   3e-50
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             171   3e-50
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   169   4e-50
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               170   4e-50
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   167   9e-49
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   165   1e-48
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   164   2e-48
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   166   2e-48
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   166   3e-48
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   165   3e-48
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   164   8e-48
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               164   8e-48
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   164   9e-48
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   162   2e-47
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   162   2e-47
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   161   3e-47
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   161   4e-47
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   160   9e-47
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   159   5e-46
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     159   9e-46
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     157   3e-45
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   156   3e-45
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   156   4e-45
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   155   6e-45
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   155   2e-44
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   154   2e-44
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   155   3e-44
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   155   4e-44
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   153   5e-44
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   153   5e-44
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   152   9e-44
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   153   9e-44
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   152   9e-44
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   152   5e-43
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   151   1e-42
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   149   2e-42
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   149   2e-42
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   149   5e-42
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   146   4e-41
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   144   2e-40
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   143   5e-40
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   140   9e-39
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   139   2e-38
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   137   2e-37
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   135   5e-37
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   135   7e-37
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   134   2e-36
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   134   3e-36
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   132   2e-35
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   131   3e-35
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   130   4e-35
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     130   5e-35
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   130   8e-35
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     129   2e-34
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   124   1e-32
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   124   2e-32
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   121   2e-31
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   119   7e-31
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   105   1e-25
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    66   4e-13
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    49   5e-06
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    42   0.001
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    40   0.005
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    40   0.007
TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.6...    38   0.021
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    38   0.028
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    38   0.030
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    37   0.032
Kwal_26.9322 s26 complement(1163928..1164923) [996 bp, 331 aa] {...    36   0.10 
TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON}                 35   0.16 
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     34   0.46 
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    34   0.52 
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    33   0.69 
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    33   0.91 
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      33   1.1  
TPHA0I00880 Chr9 complement(193539..195608) [2070 bp, 689 aa] {O...    33   1.2  
Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig...    30   1.7  
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    32   1.8  
Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W ...    32   2.3  
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    31   2.7  
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    31   3.9  
KLTH0A06908g Chr1 complement(575902..577665) [1764 bp, 587 aa] {...    31   4.1  
NDAI0G04440 Chr7 complement(1060016..1065142) [5127 bp, 1708 aa]...    31   5.4  
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    30   6.7  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    30   7.8  
TDEL0E01080 Chr5 (220366..222216) [1851 bp, 616 aa] {ON} Anc_4.2...    30   8.6  
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    30   9.5  

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/312 (96%), Positives = 300/312 (96%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
           PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           NIKDDDYLTVPT            WNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 301 VHPDWPSFPIFE 312
           VHPDWPSFPIFE
Sbjct: 301 VHPDWPSFPIFE 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  441 bits (1135), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/312 (67%), Positives = 248/312 (79%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M   LKNSSAT+KLNTGA IP LG GTWRS D   Y+SV++A+K GYRHID+AAIY NEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VGKAI+DSGVPR E+F+TTKLWGT+QR+PE ALD SLKRLGLDYVDLYL+HWP+  KTD
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            I D D+L +PT            WNFVKTW+L+Q+LP TGK KAVGVSNFS+NN+KELL
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
            SP NKLVPA NQ+E+HPLLPQDELI F K KGIV+EAYSP GS  +PLLKE  II++AK
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K+GVEPAQ++I+W IQRGYV+L KSVNP+RV SNFK+F L ++D   I  +SK  G KR 
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 301 VHPDWPSFPIFE 312
           V+  W SFPIFE
Sbjct: 301 VNMQWNSFPIFE 312

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  434 bits (1115), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 205/312 (65%), Positives = 246/312 (78%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M   LKNSSAT+KLNTGA IP LG GTWRS D   Y+SV++A+K GYRHID+AAIY NEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VG+AI+DSGVPR E+F+TTKLWGT+QR+PE AL+ SLKRLGLDYVDLYL+HWP+  KTD
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            + D + L +PT            WNF+KTWEL+QELP TGK KAVGVSNFS+NN+KELL
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
            SP NK+VPA NQ+E+HPLLPQDELI F K KGIV+EAYSP GS  +PLLKE  II++AK
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K+GVEPAQ++I+W IQRGYV+L KSVNP+R+ SNFK+F L ++D   I  +SK  G KR 
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 301 VHPDWPSFPIFE 312
           V   W SFPIF+
Sbjct: 301 VDMKWGSFPIFQ 312

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  431 bits (1107), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 246/312 (78%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M   L+NSSAT+KLNTGA IP LG GTWRS D   Y+SV++A+K GYRHID+AAIY NEE
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VG+AI+DSG+ R E+F+TTKLWGT+QR+PE AL+ SLKRLGLDYVDLYL+HWP+  KTD
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            + D + L +PT            WNF+KTW+L+QELP TGK +AVGVSNFS+NN+KELL
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
            SP NKLVPA NQVE+HPLLPQDELI F K KGIV+EAYSP GS  +PLLKE  II++AK
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K+GVEP+Q++I+W IQRGYV+L KSVNP+RV SNFK+F L ++D   I  +SK  G KR 
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 301 VHPDWPSFPIFE 312
           V+  W SFPIFE
Sbjct: 301 VNMKWASFPIFE 312

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  427 bits (1098), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 245/312 (78%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           MS  L +S+ T+ LNTGA IPQ+GLGTW+S D +AY SVL+A+K GY+HID+AAIY NE+
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VG+AI+DSGVPR E+FVTTKLW TQ   P KALD SL+RLGLDYVDLYLIHWP    T+
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            IKD D L+VPT            WNF+KTWEL+QELP TGK KA+GVSNFS+NNLK+LL
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           ASPGNKL PA NQVE+HPLLPQ+ELI F KSK I+IEAYSPLGS  +PLLKEP I+++AK
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K  V+P  V+I+W  QRGYV+LPKSVNP R+E+N K+F LS ED + I+ ISKE+G KR 
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 301 VHPDWPSFPIFE 312
           V+P+W  F  F+
Sbjct: 301 VNPNWSPFEAFK 312

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  426 bits (1096), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 199/312 (63%), Positives = 254/312 (81%), Gaps = 1/312 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDE-EAYNSVLSAIKLGYRHIDSAAIYGNE 59
           M   LKNS+AT KLNTGA IP +GLGTW+S++E E Y +V++A+K GYRHID+AAIY NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
           + VGKAI DSG+PR E+FVTTKLWGTQ R+PE AL+ SL+RLGLDYVDLYL+HWP+AFK 
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 DNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
           D+IKD +Y T+P             WNFVKTWEL+QELP TGK +AVGVSNFS+NNLK L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVA 239
           L+SPGNKLVPA NQVE HPLLPQDEL +F K KGI++EAYSPLGS  +P+L EP IIE+A
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 240 KKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKR 299
           KK+ V+PAQV+I+W +Q+G+V+LPKSV+ +R+++NF+ F+LSK+++D ++ +SKE+G +R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 300 FVHPDWPSFPIF 311
            V P+W  F  F
Sbjct: 301 IVQPNWAPFVPF 312

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  424 bits (1090), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 246/312 (78%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M   L++S+ T+ LNTGA IPQ+GLGTW+S D +AY SVL+A+K GYRHID+AAIY NE+
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VG+AIRDSGVPR ++FVTTKLW TQ   P KALD SL+RLGLDYVDLYL+HWP+    D
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            IKD + L+VPT            WNF+KTWEL+QELP TGKAKAVGVSNFS+NNLK+LL
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           AS GNKL PA NQVE+HPLLPQ+ELI+F + KGI+IE YSPLGS  +PLLKEPVI+E+AK
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K  V+PA V+I+W  QRGYV+LPKSVNP RV++N K+F LS ED + I+ ISK +G KR 
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 301 VHPDWPSFPIFE 312
           VHP+W  F  F+
Sbjct: 301 VHPNWSPFEAFK 312

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  424 bits (1090), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 202/312 (64%), Positives = 247/312 (79%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           MS  L+ S+ T+ LNTGA IPQ+GLGTW+S D +AY SV++A+K GYRHID+AAIYGNE+
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VG+AI+DSGVPR E+FVTTKLW TQ   P KALD SLKRLGLDYVDLYL+HWP+    +
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            IKD   L++PT            WNF+KTWEL+QELP T K +AVGVSNFS+NNLK+LL
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           ASPGN+L PA NQVELHPLLPQ+ELI+F KSKGI++EAYSPLGS  +PLLKEPV++E+AK
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K  V+P  V+I+W  QRGYV+LPKSVNP R+++N KVF LS ED + I+ ISKE+G KR 
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 301 VHPDWPSFPIFE 312
           V+PDW  F  F+
Sbjct: 301 VNPDWSPFEAFK 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  424 bits (1089), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 202/312 (64%), Positives = 245/312 (78%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M   L +S+  + LNTGA IPQ+GLGTW+S + +AY +VL+A+K GYRHID+AAIY NE+
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VG+AI+DSGVPR E+FVTTKLW TQ   PE ALD SLKRLGLDYVDLYL+HWP      
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            IK++D L+VPT            WNF+KTWEL+QELP TGK KAVGVSNFS+NNLK+LL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           AS GNKL PA NQVE+HPLLPQDELI F KSKGIV+EAYSPLGS  +PLLKEPVI+E+AK
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K  V+P  V+I+W +QRGYV+LPKSVNP R+++N K+F LS ED + I+ ISKE+G KR 
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 301 VHPDWPSFPIFE 312
           VHP+W  F +F+
Sbjct: 301 VHPNWSPFEVFK 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  418 bits (1075), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 244/312 (78%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M   LKNSSA++KLNTGA IP LG GTWRS +   Y+SV++A+K GYRHID+AAIY NEE
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VG+AI+DSGVPR ++F+TTKLWGT+QR+PE AL+ SLKRLGLDYVDLYL+HWP+  KT+
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            I D + L +PT            WNF+KTW+L+QELP TGK KAVGVSNFS+NN+K LL
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
            SP NKLVPA NQ+E+HPLLPQ+ELI F K KGIV+EAYSP GS  +PLL+E  II++AK
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K+GV PAQ++I+W IQRGYV+L KSVNP+R+ SNFK+F L ++D   I  +SK  G KR 
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 301 VHPDWPSFPIFE 312
           V   W SFPIF+
Sbjct: 301 VDMKWSSFPIFK 312

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  408 bits (1048), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 242/312 (77%), Gaps = 1/312 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDE-EAYNSVLSAIKLGYRHIDSAAIYGNE 59
           MS  L  +++ +KLNTGA I  +GLGTWRS+   +AY+SV++A++ GYRHID+AAIYGNE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
             VG+AIR+SGVPR E+FVTTKLW TQ + PE ALD SLKRLGLDYVDLYL+HWP+  + 
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 DNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
           +N+ + D +  PT            WNFVKTWEL+Q+LP TGK +A+GVSNFS+NNLK+L
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVA 239
           LASPGNK+VPA NQVE+HPLLPQ EL++F   KGIVIEAYSPLGS  +P+LKEPVIIE+A
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 240 KKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKR 299
           KK GV  AQV+I+W +QRGY++LPKSVN +R+E+N   F L+ ED + ++ ISK QG KR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 300 FVHPDWPSFPIF 311
            + PDW  F  F
Sbjct: 301 IIDPDWEPFKPF 312

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 237/312 (75%), Gaps = 1/312 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           MS  LKN +ATVKLNTGA IP +GLGTWRS + + Y+SV++A K+GYRHID+AAIYGNE+
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VGKAI + GV R+ELFVTTKLWGTQQR+PE AL+ SLKRLGLDYVDLYLIHWP+AFKTD
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            IKD + LT+P             WNF+KTWEL+Q L  TGK KA+G+SNFS+NN+KELL
Sbjct: 121 TIKDGNLLTIP-KKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           A+P   + PACNQVE+HPLLPQDELI F K KGIVIEAYSPLG   +P+LK+  IIE+AK
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           +  V+  QV+ +W +QRGYV+LPKSV   R+ SN K F LS +D+ +I+ + K +G  R 
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

Query: 301 VHPDWPSFPIFE 312
                  FP+F+
Sbjct: 300 CDLGIKGFPMFQ 311

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  402 bits (1032), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 239/310 (77%)

Query: 3   IQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPV 62
           + LKNS+AT+KLNTGA IP +GLGTWRS+  + Y+SVL+A+KLGYRHID+AAIYGNE+ V
Sbjct: 1   MSLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQV 60

Query: 63  GKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           G+AI+DSGVPR E+F+TTKLWGT+ RNP KALD+SLKRLGLDYVDLYL+HWP+A K    
Sbjct: 61  GRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGS 120

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLAS 182
           ++ D L +P             W+F+KTWEL+QELP TGK KA+GVSNFS+NNLK L  S
Sbjct: 121 EEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNS 180

Query: 183 PGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKY 242
           P    VPA NQVE+HPL PQ ELIE+ KS+ I+IEAYSP GS  +P+LKEP + ++A+KY
Sbjct: 181 PKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKY 240

Query: 243 GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVH 302
            +  AQ++I+W +QRGYV+LPKSV+ +R+E+N KV  L  ED++ I  +SK +G KR V 
Sbjct: 241 NISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQ 300

Query: 303 PDWPSFPIFE 312
            DW  FP FE
Sbjct: 301 LDWSPFPTFE 310

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  401 bits (1031), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 240/310 (77%)

Query: 3   IQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPV 62
           +   N S ++KLNTGA IP +GLGTW+S +E+AYN+V+SA++ GYRHID+AAIYGNEE V
Sbjct: 1   MSTSNESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAV 60

Query: 63  GKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           GK IRDSGVPR E+FVTTKLWGTQQR+PE ALD SL+RLGLDYVDLYLIHWP+     +I
Sbjct: 61  GKGIRDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSI 120

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLAS 182
            D +YLT P             WNF+KTWE +Q LP +GK KA+GVSNFS+ N++ LLA+
Sbjct: 121 TDGNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAA 180

Query: 183 PGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKY 242
             + +VPA NQ+E+HP LPQ ELI++ KSKGI+IEAYSPLGS+ S +L +P I  +A KY
Sbjct: 181 NPDFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKY 240

Query: 243 GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVH 302
             EPA +LI+WG  RGYV+LPKSVNP+R+++N K+ DLS ED+++I+K+++  G KR+V 
Sbjct: 241 NAEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVA 300

Query: 303 PDWPSFPIFE 312
           PD+  F IFE
Sbjct: 301 PDFSPFAIFE 310

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 192/307 (62%), Positives = 233/307 (75%), Gaps = 1/307 (0%)

Query: 5   LKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGK 64
           L  +++T+KLNTGA IP +GLGTW+SS+ E YN+ L A+K GYRHID+AAIY NEE +G+
Sbjct: 4   LHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGR 63

Query: 65  AIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKD 124
           AIRDS +PRNELFVTTKLWGTQ RNP +ALD SLKRLGLDYVDLYL+HWP+A KTD IKD
Sbjct: 64  AIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKD 123

Query: 125 DDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPG 184
            + L +P             WNFVKTWEL+QELP   KA+A+GVSNFS+NNLKELL S G
Sbjct: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKG 182

Query: 185 NKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGV 244
           NK+VPA NQ+E+HPLLPQDELI F K KGIV+EAYSPLGS  +P+LKE  I E+AKK GV
Sbjct: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGV 242

Query: 245 EPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPD 304
              Q++I+W  QRGYV+LPKSV P+R+  N + F LS ED   +   +K+ G +R V P+
Sbjct: 243 NAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPN 302

Query: 305 WPSFPIF 311
           W  F  F
Sbjct: 303 WGPFKPF 309

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 237/305 (77%), Gaps = 1/305 (0%)

Query: 5   LKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGK 64
           LKN++   KLNTGA IP LG GTWRS++EE YN+VLSAIK GYRHIDSAA+YGNE  VG+
Sbjct: 4   LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGR 63

Query: 65  AIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKD 124
           AIRDSGVPR ELFVTTKLW TQQR P KALD SL+RLGLDYVDLYLIHWP+  KTD I D
Sbjct: 64  AIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRITD 123

Query: 125 DDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPG 184
            +  ++PT            W+++KTW+L+QELP+TGK +AVGVSN SV+ L++LLA  G
Sbjct: 124 GNLFSIPTKEDGKPDVDTE-WDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKG 182

Query: 185 NKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGV 244
           NK+VPA  QVE HPLLPQ++L++F     I++EAYSPLGS GSPL+ EPVI E+AKKY  
Sbjct: 183 NKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNA 242

Query: 245 EPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPD 304
           +PAQ++I+W I+RGYV+LPKSV P R++SN +  DL  ED ++I+K+  E+G KR   P+
Sbjct: 243 DPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDPE 302

Query: 305 WPSFP 309
           W +FP
Sbjct: 303 WFTFP 307

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 191/310 (61%), Positives = 234/310 (75%), Gaps = 1/310 (0%)

Query: 3   IQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPV 62
           + LKN    VKLNTGA +P +GLGTW+S + +AY +VL+A+K GYRHID AAIY NE  V
Sbjct: 1   MSLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEV 60

Query: 63  GKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           GKAIRDSGVPRNE+FVTTKLWGTQQR P+ AL+ SL+RLGLDYVDLYLIHWPI       
Sbjct: 61  GKAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQC 120

Query: 123 KDD-DYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181
           ++  +YLT P             WNFVKTWEL+QELPATGK KAVGVSNFS+NN+KELL+
Sbjct: 121 EESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLS 180

Query: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241
           SPGNKLVPA NQ+ELHPLLPQ EL+ F K KGIV+EAYSPLG  G+ +LKEP++ E+AKK
Sbjct: 181 SPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKK 240

Query: 242 YGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFV 301
           Y +  A ++++W +QRG V+LPKSV   R+ SN +   L+ EDV++I  +SKE+G KR  
Sbjct: 241 YNIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTC 300

Query: 302 HPDWPSFPIF 311
            PD+  F  F
Sbjct: 301 APDFSPFNTF 310

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  394 bits (1013), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 186/302 (61%), Positives = 232/302 (76%), Gaps = 1/302 (0%)

Query: 7   NSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI 66
           NSSA  KL TGA IP LG GTWRS++E+ YN+VL+A+K+GYRHID+AA+YGNE  VG+AI
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 67  RDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDD 126
           RDSGVPR++LFVTTKLW TQ R+P  ALD SL+RLGLDYVDLYLIHWP+  +T  I D +
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 127 YLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPGNK 186
             TVPT            W++VKTWE++Q+LP T K +AVGVSNFSV  L+ LLA+ G K
Sbjct: 126 LFTVPTKEDGKPDVDEQ-WSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 187 LVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGVEP 246
           ++PA NQVE HPLLPQD+L +F     I++EAYSPLGS GSPL++EP + E+A K+  +P
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 247 AQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPDWP 306
           AQVLI+WGI+RGYVILPKSV P R+ESNFK+ DL+ +D  +I+ I KE+G KR   PDW 
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 307 SF 308
            F
Sbjct: 305 HF 306

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  394 bits (1011), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 183/306 (59%), Positives = 240/306 (78%), Gaps = 1/306 (0%)

Query: 7   NSSATVKLNTGAIIPQLGLGTWRSSDE-EAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKA 65
           NS+ T KLNTGA I  +GLGTW+S++E E Y +V++A+K GYRHID+AAIYGNE  VGKA
Sbjct: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75

Query: 66  IRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDD 125
           I DSGVPR E+FVTTKLW TQ  +P   L+ SLKRLGLDYVDLYL+HWP+     +IKD 
Sbjct: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135

Query: 126 DYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPGN 185
           ++L++P             W++VKTWEL+QELP TGK +AVGVSNFS+NNLK++L+SPGN
Sbjct: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195

Query: 186 KLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGVE 245
           K+VPA NQVE+HPLLPQ+EL+E+  SKGI++EAYSPLGS  +P+L EPV+I +AKK+GV+
Sbjct: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255

Query: 246 PAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPDW 305
            AQ++I+W +QRGY++LPKSV+ +R+++NFK   LS E++  I+ ISKE+G +R V P W
Sbjct: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315

Query: 306 PSFPIF 311
             F  F
Sbjct: 316 EPFVPF 321

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 186/312 (59%), Positives = 236/312 (75%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M  QLKNS   V LN G  IP +GLGTW+S + + YNSV+ A+K GYRHID+AAIY NE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VG+AI+DSGVPR+++F+TTKLW T+ +NP++AL++SLKRLGLDYVDLYL+HWP+     
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            IKDDDYL VP             W+++KTWELVQELPATG  ++VGVSNFS+NNL+++L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           +SPGNKL PA NQVELHPLLPQ EL ++  SK I +EAYSP GS+ +P LK+  I+++A 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K GV PAQV+ +W +QR  V+LPKSV+ +RV SNFKVFDLSKED+  I  ++K  G KR 
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 301 VHPDWPSFPIFE 312
             PDW  FP+FE
Sbjct: 301 NKPDWDPFPVFE 312

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  385 bits (989), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 244/313 (77%), Gaps = 1/313 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRS-SDEEAYNSVLSAIKLGYRHIDSAAIYGNE 59
           M++ LK S+AT+KLNTGA IP++ LGTWRS    + Y+SV++A+K GYRHID+AAIYGNE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
           + VGKAIRDSG+PR E+FVT+KLW TQQ NP  AL  +L RLGLDY+DLYL+HWP+ F T
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 DNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
            N+K  D++ +P             WNFVKTWEL+QELPATG  KAVGVSNFS+NNLKEL
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVA 239
           L SPGNKL PA NQ+E+HPLLP+ +LI+F + KGI+IEAYSPLGS  +P+LKEP IIE++
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 240 KKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKR 299
           KK  V PAQ++I+W +QRGYV+L KS + +R+ +N KVF LSKED + I  ++KE+G  R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 300 FVHPDWPSFPIFE 312
            V PDW  FP+F+
Sbjct: 301 VVDPDWSPFPLFK 313

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 236/308 (76%), Gaps = 1/308 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M+  LK  +AT KLNTGA IP LGLGTWRS+ E  YN+ L+AIK GYRHID AA+  NE+
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VG+AIRDSGVPR ELFVTTKLW TQ R+P+ AL  SLKRLGLDYVDLY++HWP+AF+++
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            +K  +Y+ +P             W++VKTWEL+QELPATGK  A+GV+NFSV+ LK+L+
Sbjct: 121 QVKHTNYMLIP-KRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
            SPGNK+VPA +Q+E HP LPQ++++ F K   I++EAYSPLGS G+PLL EPV+ E++K
Sbjct: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K  VEPAQ+L++WG+QRG+ +L KS  P R+E+N   FD+ + D+ RI+++++E+G KR 
Sbjct: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299

Query: 301 VHPDWPSF 308
            +P W SF
Sbjct: 300 HNPTWFSF 307

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 183/305 (60%), Positives = 231/305 (75%), Gaps = 1/305 (0%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD 68
           + + KLNTGA++P +GLGTW+SS+E+AY +VLSA+K GY+HID+AAIY NE  VGKAIRD
Sbjct: 8   TPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAVGKAIRD 67

Query: 69  SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDYL 128
           SG+PR+ELF+TTKLW TQ R+P+ ALD SL+RLGLDYVDLYLIH+P+AFKTD I+D +  
Sbjct: 68  SGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRIEDGNPF 127

Query: 129 TVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPGNKLV 188
             P             W+FVKTW LVQ LP +GK KAVGVSNFS+NNLK LL S     V
Sbjct: 128 CFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDEKFAV 187

Query: 189 PACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK-YGVEPA 247
           PA NQVE+HP LPQ ELI+F KSK IV+EAYSPLGS GS +L +  + ++A+K    +PA
Sbjct: 188 PAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXDAQPA 247

Query: 248 QVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPDWPS 307
           Q+LINWGI RGY +LPKSV PKR+E+N ++ D+ KED+ ++  +    G KR++ PDW  
Sbjct: 248 QILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEPDWSP 307

Query: 308 FPIFE 312
           FPIFE
Sbjct: 308 FPIFE 312

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 231/310 (74%), Gaps = 1/310 (0%)

Query: 3   IQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPV 62
           + L+NS++T+KLNTG  IPQ+GLGTWRS + E Y +V+ A+K GYRHID AA+YGNE  V
Sbjct: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61

Query: 63  GKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           GKAI+DSGVPRNE+F+TTKLW TQQRNP++ALD SL+RLGLDYVDLYLIHWP+  +T+NI
Sbjct: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLAS 182
           KD +                  WNF+KTWEL+Q+L  +GK KA+GVSNFSVNNLK+LLA+
Sbjct: 122 KDGNLFQF-AEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180

Query: 183 PGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKY 242
           P  K+ PA NQVELHPLLPQ++LI+F K  GIVIEAYSPLG   +P+L +P + E+AK  
Sbjct: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240

Query: 243 GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVH 302
           GVE   V+I+W +Q+G V LPKSV P R+  N KV  LS  DV ++  + K +G +R  +
Sbjct: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300

Query: 303 PDWPSFPIFE 312
            D+  FPIF+
Sbjct: 301 QDFSPFPIFQ 310

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  384 bits (985), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 183/312 (58%), Positives = 233/312 (74%), Gaps = 1/312 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           MS  L N+++TVKLNTG  IPQ+GLGTWRS + + Y +V +A+K GYRHID AAIY NEE
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VGKAIRDSG+PR ELF+TTKLW TQQRNP++AL+ SL+RLGL+YVDLYL+HWP+  KT 
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            I D + L+ P             W+FVKTWEL+QELP T KA++VGVSNFS+NNLKELL
Sbjct: 121 RITDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           ASPGNKLVPA  QVE+HPLLPQ  L +F K   I +EAYSPLG +G+P+L +P+I ++A 
Sbjct: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           ++  +   V+++WG+QRG V LPKS  P+RV SN + F LS E++  I+ +SK +G KR 
Sbjct: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299

Query: 301 VHPDWPSFPIFE 312
             PD   FP+FE
Sbjct: 300 NAPDMSPFPLFE 311

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  382 bits (982), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/301 (58%), Positives = 236/301 (78%)

Query: 12  VKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRDSGV 71
           +++NTG  IP LGLGTW+++D + Y +VL+A++ GYRHID+AAIY NE  VG+AIRDSGV
Sbjct: 6   LQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSGV 65

Query: 72  PRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDYLTVP 131
           PR ++FVTTKLW TQQR+P+ AL+ASL+RLGLDYVDLYL+H+P+A KTD IKD + L++P
Sbjct: 66  PREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSIP 125

Query: 132 TXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPGNKLVPAC 191
                        W+FVKTW+L+Q+LP +GK KA+GVSNFS+ N++E+L       VPA 
Sbjct: 126 VRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPAA 185

Query: 192 NQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGVEPAQVLI 251
           NQ+E+HP LPQDELIE+ KSKGI++EAYSPLGS+ S +L +P +I++A+K+ VEPAQ+LI
Sbjct: 186 NQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQILI 245

Query: 252 NWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPDWPSFPIF 311
           +WG+ RGY ILPKSVN KRV+SN K+  LS  DV +I KI ++ G KR+V P W  FP++
Sbjct: 246 SWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPFPMY 305

Query: 312 E 312
           E
Sbjct: 306 E 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  382 bits (982), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/301 (58%), Positives = 236/301 (78%)

Query: 12  VKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRDSGV 71
           +++NTG  IP LGLGTW+++D + Y +VL+A++ GYRHID+AAIY NE  VG+AIRDSGV
Sbjct: 6   LQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSGV 65

Query: 72  PRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDYLTVP 131
           PR ++FVTTKLW TQQR+P+ AL+ASL+RLGLDYVDLYL+H+P+A KTD IKD + L++P
Sbjct: 66  PREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSIP 125

Query: 132 TXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPGNKLVPAC 191
                        W+FVKTW+L+Q+LP +GK KA+GVSNFS+ N++E+L       VPA 
Sbjct: 126 VRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPAA 185

Query: 192 NQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGVEPAQVLI 251
           NQ+E+HP LPQDELIE+ KSKGI++EAYSPLGS+ S +L +P +I++A+K+ VEPAQ+LI
Sbjct: 186 NQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQILI 245

Query: 252 NWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPDWPSFPIF 311
           +WG+ RGY ILPKSVN KRV+SN K+  LS  DV +I KI ++ G KR+V P W  FP++
Sbjct: 246 SWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPFPMY 305

Query: 312 E 312
           E
Sbjct: 306 E 306

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  380 bits (976), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 231/312 (74%), Gaps = 1/312 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           MS+  KN   T  +     IP + LGTW+++  E Y +VL A+K GYRHID AAIY NEE
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VGKAIRDSG+PR ++FVTTKLWGT+QRNP +ALD+SLKRLGLDYVDLYL+HWP+A K D
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           +I D+D LT+P             WNF+KTWEL+QELP T KAKA+GVSNFS+NNL ELL
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELL 179

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           A+P  K +PA NQ E+HPLLPQ+ELI++ + K I++EAY PLG +  PL+  PVI E+A 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K GV   Q+LI+WGIQRGYV+LPKSV  +R+ +NF+   +  E+ ++++ ++KE GV+R 
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 301 VHPDWPSFPIFE 312
           V+ D+  FP ++
Sbjct: 300 VNIDFSPFPTYQ 311

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 181/302 (59%), Positives = 224/302 (74%), Gaps = 2/302 (0%)

Query: 11  TVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRDSG 70
           ++KLNTGA IPQLG GTW SS  +AY +V++A+K GYRHID+AA+YGNE  VGK IRDSG
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSG 69

Query: 71  VPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDYLTV 130
           +PR E+FVTTKLW TQQR+P  ALD SL+RLGLDYVDL+LIHWP+  K      ++ L  
Sbjct: 70  IPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVG-GPENLLKY 128

Query: 131 PTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPGNKLVPA 190
           PT            W+F+KTWEL+Q LP TGK +AVGVSNFS+ NL++LL S  + LVPA
Sbjct: 129 PTPGIKPQIDTED-WSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPA 187

Query: 191 CNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGVEPAQVL 250
            NQ E+HP LPQ ELI + KSKGIV+EAY PLGS+ S +L +P I E+A KY V+PA VL
Sbjct: 188 VNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVL 247

Query: 251 INWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPDWPSFPI 310
           INWGI RGY +LPKS  P R+ SN     LS+ED +RI K+S+  GVKR+VHPD+  +P+
Sbjct: 248 INWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPL 307

Query: 311 FE 312
           FE
Sbjct: 308 FE 309

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 231/308 (75%), Gaps = 2/308 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M+  LK  +AT  LNTGA IP LGLGTWR + E  Y ++L+A+K GYRHIDSAA+  NE+
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            +GKAIRDSGV R+ELFVTTKLW TQ R+P  ALD SLKRLGL+YVDLY++HWP+AF+ D
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            IK  +++ +P             W++VKTWEL+Q+LP T K +A+GV+NFSV  L  LL
Sbjct: 121 QIKAKNFMLIP-RNSEGKPYVDTDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
            SP NK++PA +Q+E HP LP DE++ F + KGI++EAYSPLG +G PL+ EPVI E++K
Sbjct: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
           K  VEPAQ+LI+WG++RG  +LPKS    R+ESN +VFDLS ED +RIH+I++E+G KR 
Sbjct: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298

Query: 301 VHPDWPSF 308
            +P W SF
Sbjct: 299 HNPPWFSF 306

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  366 bits (940), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 229/303 (75%), Gaps = 2/303 (0%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKA 65
           K S++  KLNTGA IP +GLGT+ S DE  Y +VL AIK+GYRHID AA+Y NE+ VG+A
Sbjct: 5   KPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRA 64

Query: 66  IRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDD 125
           IRDSGVPR ELFVTTK+W TQ R P KAL+ SL RLGLDYVDL+L+HWP A +T+ I D 
Sbjct: 65  IRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDG 124

Query: 126 DYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPGN 185
           + +TVP             WN++KTW L+Q+LPA+GK KAVGVSNFSV  L++LLA PG+
Sbjct: 125 NMITVP-KREDEKPDVDTEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGS 183

Query: 186 KLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGVE 245
           K+VPACNQVE+HPLLPQ  L +F K K I++ AYSPLGS  +PLL +PVI+E+A K+  +
Sbjct: 184 KVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKAD 243

Query: 246 PAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPDW 305
           PAQ++I W ++RGYV LPKSV P R+ESN ++ +L+  ++++I++I K +G KR V P+W
Sbjct: 244 PAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPEW 302

Query: 306 PSF 308
             F
Sbjct: 303 FDF 305

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  363 bits (933), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 236/313 (75%), Gaps = 3/313 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSD-EEAYNSVLSAIKLGYRHIDSAAIYGNE 59
           M+  L+N++ T+KLNTGA +P LGLGTWR++D +E YN+V SA++ GYRHID+AAIY NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
           E VG+AIR+SG+PR+E+FVTTKLWGTQ R+P  ALD SL+RLGLDYVDLYL+HWP+  + 
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 DNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
              K    L  P             W+F+KTWEL+QELP T K +A+GVSNFS+NN+ +L
Sbjct: 121 KYSKSSSLLEFP-YRPDGSLAVESDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDL 178

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVA 239
           L SPGNK+VPA NQVELHPLLPQ EL+ F + KGIV+EAYSP GS  +PLL E  IIEVA
Sbjct: 179 LKSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVA 238

Query: 240 KKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKR 299
           KK+ V  AQV+++W I+RG  +LPKSV+ +RV SNFK F L ++D   I+ +SKE+G KR
Sbjct: 239 KKHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKR 298

Query: 300 FVHPDWPSFPIFE 312
            V+ DW  F IFE
Sbjct: 299 VVNFDWSPFKIFE 311

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  361 bits (926), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 175/312 (56%), Positives = 231/312 (74%), Gaps = 7/312 (2%)

Query: 8   SSATVKLNTGAIIPQLGLGTWRS-SDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI 66
           S   +KL+TGA IPQ+GLGTWRS    +AY+SV++A+K GYRHID+AAIYGNE  VGKAI
Sbjct: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66

Query: 67  RDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDD 126
           RDSGVPRNE+FVT+KLW  Q  +P+ AL+ +LKRLGLDY+DLYL+HWP+ F   +IKD+D
Sbjct: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126

Query: 127 -----YLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181
                ++T+PT            WNF+KTWEL+Q LP +GK KAVGVSNFS+NNL +LLA
Sbjct: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186

Query: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241
           +   K+VPA NQ+ELHPLL Q+EL+++ K K I++EAYSP GS  +P+LK+  I  +AKK
Sbjct: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246

Query: 242 YGVEPAQVLINWGIQR-GYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
             ++  QV+++W IQR GYV+LPKSV+ +R+ +N KV  L  ED   I+ + KE+G  R 
Sbjct: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306

Query: 301 VHPDWPSFPIFE 312
           V PDW  FP+F+
Sbjct: 307 VDPDWSPFPLFK 318

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 227/310 (73%), Gaps = 2/310 (0%)

Query: 3   IQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPV 62
           + L NS+A V LN G  +P +GLGTW+S + +AY +V++A+K GYRHID+AAIYGNEE V
Sbjct: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60

Query: 63  GKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           G+AI+DSGV R+E+FVTTKLWGTQ R+P+ AL+ SL+RLGLDYVDLYL+HWP+       
Sbjct: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120

Query: 123 K-DDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181
           K D++YL +P             W+F+KTWEL+Q LP + K K++GVSNFS+NN+K+LLA
Sbjct: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179

Query: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241
           SPGNK VP  NQVELHPLLPQ EL+EF KSK IV+EAYSPLGS G+P+L+   I EV+KK
Sbjct: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239

Query: 242 YGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFV 301
             + PA V+ +W IQR  V+LPKSV   R+ SN +  +L  E+  +++ IS E G KR V
Sbjct: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299

Query: 302 HPDWPSFPIF 311
            P+W  F  F
Sbjct: 300 KPNWTPFIPF 309

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  344 bits (882), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 169/314 (53%), Positives = 227/314 (72%), Gaps = 8/314 (2%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDE-EAYNSVLSAIKLGYRHIDSAAIYGNE 59
           MS  LKNS+ T+KLN G+ IP +GLGTW+++DE +AYN+V +A+  GYRHID+AAIY NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
             VG+AIRDSGVPR E+FVTTKLW  Q   PE ALD SL+RLGLDYVDLYL+HWP++   
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 DNIKDD--DYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLK 177
             +K+   + +  P             W F+ TWEL+Q+LP   K +++GVSNFSVNNLK
Sbjct: 121 SYMKESPLELMKRPDGTRPVETD----WTFINTWELMQKLPK-NKVRSIGVSNFSVNNLK 175

Query: 178 ELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIE 237
           +LL +P   +VP  NQVELHPLLPQ EL+++ +   I +EAYSPLGS  +PLL EP++I+
Sbjct: 176 DLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVID 235

Query: 238 VAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGV 297
           VAKK GV+PA V+++W +QR  ++LPKSV+ +RV +N K F L +ED D I KIS+++G 
Sbjct: 236 VAKKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGE 295

Query: 298 KRFVHPDWPSFPIF 311
           +R  +P++  F  F
Sbjct: 296 RRINNPNFEPFKTF 309

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  339 bits (869), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 223/312 (71%), Gaps = 1/312 (0%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           M++ LKN + T+ LN G  IP +GLGT+ S   E Y +V++A K GYRH+D+AA Y NEE
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120
            VGKA++D GVPR+E++VTTK+W T+ R+PE ALD SLKRLGL+Y+DLYL+HWP+  KTD
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 NIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            IKD + + +P             W FV+ WE +Q+L  +GK K++GVSNFS+NN+KELL
Sbjct: 121 TIKDGELMCIP-RLPDGNADVDKDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELL 179

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240
           A+P   +VP  NQVE+ PLLP DELIEF +SK I+ +AY P G + +PL+K+  ++E+AK
Sbjct: 180 AAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAK 239

Query: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300
             GV+  QV+ +W +QRGYV+LPKSV   R+ SN K F LS  D+ +++ ISK QG KR 
Sbjct: 240 GNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRL 299

Query: 301 VHPDWPSFPIFE 312
            + ++  FPIFE
Sbjct: 300 NNVNFSPFPIFE 311

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  335 bits (860), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 169/308 (54%), Positives = 226/308 (73%), Gaps = 1/308 (0%)

Query: 5   LKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGK 64
           LK S+ TV LNTGA IP  GLGTW+S+D++A ++V +A+K GY+HID+A+ Y NEE VGK
Sbjct: 7   LKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELVGK 66

Query: 65  AIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKD 124
           A+++SG+PR ELF+TTK+W  QQR+P  ALD SLK+LG +YVDL L+HWP+ FK      
Sbjct: 67  AVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPENST 126

Query: 125 DDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPG 184
            D   VP             W+FVKTW L+Q+L  TGK KA+GVSNFS+NNL+ELL + G
Sbjct: 127 LDAYKVP-RGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNAEG 185

Query: 185 NKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGV 244
             +VPA NQVELH  LPQ EL+E+ + KGIV+EAYSPLGS+ +PLLK+  + +VA+KYGV
Sbjct: 186 TTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKYGV 245

Query: 245 EPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPD 304
            PA VL+N+   RG V+LPKSV   R+ SNF+ F + +ED+  ++ I K++GV+RFV PD
Sbjct: 246 TPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVDPD 305

Query: 305 WPSFPIFE 312
           +  FP+F+
Sbjct: 306 FSPFPLFQ 313

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  216 bits (549), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 185/293 (63%), Gaps = 10/293 (3%)

Query: 14  LNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD--- 68
           LNTGA IP LGLGT    ++  +  ++V  A+K GYR ID+A +YG+E  +G+A+++   
Sbjct: 13  LNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQELFE 72

Query: 69  -SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDY 127
              V R +LF+TTK+W       E++L  SLK+L LDYVDL L HWP+ F     +    
Sbjct: 73  EGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHGKL 132

Query: 128 LTVPTXXXXXXXXXXXXWNFVKTWELVQEL--PATGKAKAVGVSNFSVNNLKELLASPGN 185
            + P              +++ TW+ ++++    +G+ + +GVSN+ V  L+ LL     
Sbjct: 133 KSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE--T 190

Query: 186 KLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGVE 245
           ++VP  NQVELHPLLPQ+EL E+  S GI++E++SPLGS+G+P L+ P++ E++KKY  E
Sbjct: 191 EVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYDCE 250

Query: 246 PAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVK 298
           P  VL+N+ +++G V++P+S+N  R+  N     LS+ED+D++  + +E+ V+
Sbjct: 251 PGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREKPVR 303

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  207 bits (528), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 176/306 (57%), Gaps = 13/306 (4%)

Query: 14  LNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD--- 68
           LN G  IP +GLGT    D   E   +V +AI+ GYRHID+A  Y  E  +G+A+++   
Sbjct: 13  LNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQALKELFE 72

Query: 69  -SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDY 127
            + + R ELF+TTK+W T   NP  ++D SLK LG+DYVDL L HWP+ F+       + 
Sbjct: 73  SAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENSQGNI 132

Query: 128 LTVPTXXX-XXXXXXXXXWNFV-KTWELVQELPATGKAKAVGVSNFSVNNLKELLASPGN 185
           + +P              W F  K  E +   P   + +A+GVSN+ +  L+ L      
Sbjct: 133 IGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLFKE--C 190

Query: 186 KLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGVE 245
           K+ PA NQVE+HP LPQ EL +F     I++ AYSPLGS+G+P LK   + ++AKKY VE
Sbjct: 191 KVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKKYKVE 250

Query: 246 PAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQG---VKRFVH 302
           PA +L ++ I +G V+LP+S+NPKR+ +N     L+ +D+ ++ ++  ++    +  F  
Sbjct: 251 PADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVGIDEPNRFIDEFFT 310

Query: 303 PDWPSF 308
            + P F
Sbjct: 311 SEIPGF 316

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  199 bits (505), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 116/307 (37%), Positives = 183/307 (59%), Gaps = 14/307 (4%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTW--RSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K++    KLN G  IP LG GT+  R    E   +V +AIK GYRHID+A +Y +E  VG
Sbjct: 5   KSTEIYFKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVG 64

Query: 64  KAIRD----SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
           +AI++      V R++LFVTTK+W     N EK+L+ SL+ LGLDYVDL L HWP+ F  
Sbjct: 65  EAIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPR 124

Query: 120 --DNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVN 174
             D     + L                 +F++T+  ++++   P   + +A+GVSN+++ 
Sbjct: 125 VEDEKNGVNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIE 184

Query: 175 NLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPV 234
            L+ L      K+ P  NQVE+HP LPQ EL +F  + GI++ AYSPLGS+G+P LK P+
Sbjct: 185 YLEALFKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPL 242

Query: 235 IIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKE 294
           + ++A+KY +    +LI++ I++G  ++P+S+NP R+ S  +    ++E++ ++  +  E
Sbjct: 243 VHQLAEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVGIE 302

Query: 295 QGVKRFV 301
           +   RFV
Sbjct: 303 EPA-RFV 308

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  198 bits (504), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 110/300 (36%), Positives = 179/300 (59%), Gaps = 17/300 (5%)

Query: 14  LNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD--- 68
            N G  +P  GLGT    +   E   +V +AIK GYRHID+A  YG EE VG+A+++   
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 69  -SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDD-- 125
              V R +L +T+K+W T   + +K+L+ SL RL +DYVDL+L HWP+   T  + D   
Sbjct: 73  ERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLC--TQKVPDPHG 130

Query: 126 -DYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVNNLKELLA 181
            D +                 ++++T++ ++++       + +A+GVSNF +  LK +L 
Sbjct: 131 VDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVLK 190

Query: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241
               + VPACNQVELHP LPQ EL EF     I++ AYSPLG NG+PLL+ P++  + +K
Sbjct: 191 E--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCEK 248

Query: 242 YGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFV 301
           Y   P  +L ++ +++G +++P+S+N  R+ SN +   LS+EDV+++++   ++  KR++
Sbjct: 249 YNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFG-QKNKKRYI 307

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  196 bits (498), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 116/312 (37%), Positives = 185/312 (59%), Gaps = 18/312 (5%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           KN+     LN G  +P LGLGT    ++  +   +V +AIK GYRHID+A  Y  E+ +G
Sbjct: 5   KNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIG 64

Query: 64  KAIRD----SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
           +A+++      + R ++F+TTK+W T     ++++  SL+ LG+DYVDL L HWP+ F  
Sbjct: 65  EALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCF-- 122

Query: 120 DNIKD----DDYLTVPTXXXXXXXXXXXXWNFVKTWELVQE--LPATGKAKAVGVSNFSV 173
           + ++D    D     PT             ++++T++ +++  L    + +++GVSN+ V
Sbjct: 123 NRLQDPEGIDGICRNPTHEDGSPHYNEKG-DYLQTFKSLEKMYLSKDPRFRSIGVSNYPV 181

Query: 174 NNLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEP 233
             L+ LL     K+VPA NQVE+HP LPQ EL +F     I +EA+SP G+ GSP++K  
Sbjct: 182 EYLERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNE 239

Query: 234 VIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISK 293
           ++ +VA+KY   P  VLI + +++G V +P+SVNPK + SN +   LSKED+D ++K   
Sbjct: 240 LVQKVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFGV 299

Query: 294 EQGVKRFVHPDW 305
           E   KR V  ++
Sbjct: 300 ENP-KRLVDEEF 310

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  196 bits (498), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 181/304 (59%), Gaps = 13/304 (4%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTW--RSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K++    KLN G  +P LGLGT   R    E   +V +AIK GYRHID+A  YG E  +G
Sbjct: 5   KSTEIYFKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIG 64

Query: 64  KAIRD----SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAF-K 118
            A+++      V R++LF+T+K+W     + + +L+ SLK LGLDYVDLYL HWP+ F K
Sbjct: 65  DALKELLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQK 124

Query: 119 TDNIKDD-DYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVN 174
            ++ KD  + L                 +++ T++ ++++   P   + +A+GVSN+ V 
Sbjct: 125 IEDSKDGVNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVE 184

Query: 175 NLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPV 234
            L  LL     K  PA NQVE+HP LPQ EL EF +   I + AYSPLGS+G+PLLK P+
Sbjct: 185 YLDRLLKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPL 242

Query: 235 IIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKE 294
           + E+++KY V    VLI++ I++G  ++P+S+NP R+        L++ ++D++  I ++
Sbjct: 243 VKELSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGRK 302

Query: 295 QGVK 298
             ++
Sbjct: 303 DSIR 306

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  193 bits (490), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 171/289 (59%), Gaps = 12/289 (4%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTW--RSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           +N+     LN G  IP +GLGT   +    E   +V +AI+ GYR ID+A  Y  E  +G
Sbjct: 5   RNTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIG 64

Query: 64  KAI----RDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
           +A+    RD  + R +LF+TTK+W     +P  +++ SLK LG+DYVD+ L HWP+ +K 
Sbjct: 65  EALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKK 124

Query: 120 DNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVNNL 176
              ++   +  P              +++ T++L++++   P   + +A+GVSN+ +  L
Sbjct: 125 TYDENGTIIGKPLDKDGKVIFAEGA-DWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYL 183

Query: 177 KELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVII 236
           + ++     K+ P  NQVELHP LPQ EL +F    GI++ AYSPLGS G+P  K P++ 
Sbjct: 184 ERVIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQ 241

Query: 237 EVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDV 285
           E AKK+ V PA +L ++ +++G V++P+S+NP+RV SN     L+K ++
Sbjct: 242 EYAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEM 290

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  193 bits (491), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 182/316 (57%), Gaps = 12/316 (3%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K +     LN G  +P LGLGT    ++  E   +V +AIK GYRHID+A  Y  E  VG
Sbjct: 19  KTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  KAIRD----SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAF-K 118
           +AI++      + R +LF+TTK+W       E++L  SLK +GLDYVDL+L HWP+ F K
Sbjct: 79  EAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEK 138

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVNN 175
             + K    L                 ++++T++ ++++   P   + +A+GVSNFS+  
Sbjct: 139 VKDPKGISGLVKTPVHKSGEAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEY 198

Query: 176 LKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVI 235
           L+ L+     ++ P  NQVE HP LPQ EL +F     I++ AYSPLGSNG+P LK P++
Sbjct: 199 LERLVKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLV 256

Query: 236 IEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQ 295
            ++ +KY V    VLI++ I++G +++P+S+NP R+ S+ +   L+K+++  ++   ++ 
Sbjct: 257 KKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDFGEKY 316

Query: 296 GVKRFVHPDWPSFPIF 311
            V+    P   S P F
Sbjct: 317 PVRFIDEPFAASLPEF 332

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  192 bits (488), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 177/322 (54%), Gaps = 25/322 (7%)

Query: 11  TVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIR--- 67
           T+KLN GA +P +GLG W+  +E A   V  AIKLGYR +D A  Y NE  VG+ IR   
Sbjct: 32  TIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAI 91

Query: 68  DSG-VPRNELFVTTKLWGTQQRNPE---KALDASLKRLGLDYVDLYLIHWPIAFKTDNIK 123
           D G V R ELFV +KLW    R PE   KAL  +L  LGLDY+DL+ IH+P+AFK   ++
Sbjct: 92  DEGLVRREELFVVSKLWNNYHR-PEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVPLE 150

Query: 124 DD--DYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181
           +     L                   ++T+  +++L   G+ +A+G+SNF    +++LL 
Sbjct: 151 ERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDLLR 210

Query: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG------------SNGSPL 229
             G ++ PA  Q+E HP L Q+ L++++KS+G+ +  YS LG             N +PL
Sbjct: 211 --GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAAPL 268

Query: 230 LKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIH 289
           L+  V+  +A+++   PA+VL+ W  QR   ++PKS   +R+ +N +V +      D + 
Sbjct: 269 LQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDELR 328

Query: 290 KISKEQGVKRFVHP-DWPSFPI 310
           ++S      RF  P DW + P+
Sbjct: 329 ELSSLNCGLRFNDPWDWSAQPL 350

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  190 bits (482), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 173/300 (57%), Gaps = 12/300 (4%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K +     LN G  IP +GLGT    D+  +   +V +A+K G+R ID+A  YG EE +G
Sbjct: 5   KATEIYFNLNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIG 64

Query: 64  KAIRD----SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAF-K 118
           +A+++      V R +LF+TTK+W       EK+L+ SLKRL LDYVDL L HWP  F K
Sbjct: 65  EALQELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVK 124

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVNN 175
             + +    L                 ++++T++ ++ +       + +A+GVSN+ +  
Sbjct: 125 KQDPEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEY 184

Query: 176 LKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVI 235
           L+ L      K VPA NQVELHP LPQ EL ++    GI++ +YSPLGSNG+P L+ P++
Sbjct: 185 LERLFKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLV 242

Query: 236 IEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQ 295
            E+A KY      VL+++ I++G +++P+S+N +R+        L+KE++D++++   E 
Sbjct: 243 QELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVEH 302

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  190 bits (482), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/316 (35%), Positives = 182/316 (57%), Gaps = 12/316 (3%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K +     LN G  IP LGLGT    ++  E   +V +AIK GYRHID+A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  KAIR----DSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAF-K 118
           +AI+    D  + R +LF+TTK+W       +++L+ SLK LGL+YVDL L HWP+ F K
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEK 138

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVNN 175
             + K    L                 ++++T++ ++++   P   + +A+GVSNFS+  
Sbjct: 139 IKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEY 198

Query: 176 LKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVI 235
           L+ L+     ++ P  NQVE HP LPQ EL +F     I++ AYSPLGS+G+P LK P++
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLV 256

Query: 236 IEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQ 295
            ++A+KY V    +LI++ I++G +++P+S+NP R+ S+ +   L+K+++  ++   ++ 
Sbjct: 257 KKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDFGEKY 316

Query: 296 GVKRFVHPDWPSFPIF 311
            V+    P     P F
Sbjct: 317 PVRFIDEPFAAILPEF 332

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  189 bits (479), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 114/321 (35%), Positives = 179/321 (55%), Gaps = 23/321 (7%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           KN+     LN G  +P +GLGT    ++  +   +V +AIK GYRHID+A  Y  E+ VG
Sbjct: 5   KNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVG 64

Query: 64  KAIRD----SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFK- 118
           +A+++      V R ++FVTTK+W T     ++++  SL+ LGLD+VDL L HWP+ F  
Sbjct: 65  EALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNR 124

Query: 119 ------TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL--PATGKAKAVGVSN 170
                  D ++ + Y                  ++++T++ +++L      + +A+GVSN
Sbjct: 125 LEDPDGIDGVRRNPY------HEDGSPHYNEKGDYLETFKTLEKLYLAKDPRFRAIGVSN 178

Query: 171 FSVNNLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLL 230
           + V  L+ LL     ++VPA NQVE HP LPQ EL +F     I +EAYSPLG+  +PL+
Sbjct: 179 YPVEYLERLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLI 236

Query: 231 KEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHK 290
              ++ ++A KY      VLI + +++G V +P+SVNPK + SN +   LSKED+D ++K
Sbjct: 237 DNELVKKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNK 296

Query: 291 ISKEQGVKRFVHPDWPSFPIF 311
              E   +    P   + P F
Sbjct: 297 FGVENTKRIVDEPFAAAIPGF 317

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  189 bits (480), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 118/319 (36%), Positives = 187/319 (58%), Gaps = 21/319 (6%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K +     LN G  IP LGLGT    ++  E   +V +AIK GYRHID+A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  KAIRD----SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
           +AI++      + R +LF+TTK+W       +++L+ SLK LGLDYVDL L HWPI F  
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICF-- 136

Query: 120 DNIKDDD----YLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFS 172
             +KD +    Y+ +P              ++++T++ ++++       + +A+GVSNFS
Sbjct: 137 GKVKDPEGISGYMKLPVDDSGKTVYASNG-DWLETYKQLEKIYLDSNDHRVRAIGVSNFS 195

Query: 173 VNNLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKE 232
           +  L+ L+     K+ P  NQVE HP LPQ EL +F     I++ AYSPLGS G+P LK 
Sbjct: 196 IEYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKI 253

Query: 233 PVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKIS 292
           P++ ++ +KY V    +LI++ I++G +++P+S+NP R+ SN +   L+K+++  +++  
Sbjct: 254 PLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFG 313

Query: 293 KEQGVKRFVHPDWPSFPIF 311
           ++  V RF+  D PS  I 
Sbjct: 314 EKYPV-RFM--DVPSVAIL 329

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  188 bits (478), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 181/316 (57%), Gaps = 12/316 (3%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K +     LN G  IP LGLGT    ++  E   +V +AIK GYRHID+A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  KAIR----DSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAF-K 118
           +AI+    D  + R +LF+TTK+W       +++L+ SLK LGLDYVDL+L HWP+ F K
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEK 138

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVNN 175
             + K    L                 ++++T++ ++++   P   + +A+GVSNFS+  
Sbjct: 139 VKDPKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEY 198

Query: 176 LKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVI 235
           L+ L+     ++ P  NQVE HP LPQ  + +F     I++ AYSPLGSNG+P LK P++
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLV 256

Query: 236 IEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQ 295
            ++ +KY +    VLI++ I++G +++P+S+NP R+ S+ +   L+K+++  ++   ++ 
Sbjct: 257 KKLTEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDFGEKY 316

Query: 296 GVKRFVHPDWPSFPIF 311
            V+    P     P F
Sbjct: 317 PVRFIDEPFAAILPEF 332

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  186 bits (472), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 113/316 (35%), Positives = 180/316 (56%), Gaps = 12/316 (3%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K +     LN G  IP LGLGT    ++  E   +V +AIK GYRHID+A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVG 78

Query: 64  KAIRD----SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAF-K 118
           +AI++      + R +LF+TTK+W       +++L+ SLK LGLDYVDL L HWP+ F K
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEK 138

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVNN 175
             + K    L                 ++++T++ ++++       + +A+GVSNFS+  
Sbjct: 139 VKDPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEY 198

Query: 176 LKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVI 235
           L+ L+     K+ P  NQVE HP LPQ EL +F     I++ AYSPLGS G+P LK P++
Sbjct: 199 LERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLV 256

Query: 236 IEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQ 295
            ++ +KY V    +LI++ I++G +++P+S+NP R+ SN +   L+K+++  +++  ++ 
Sbjct: 257 KKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGEKY 316

Query: 296 GVKRFVHPDWPSFPIF 311
            V+    P     P F
Sbjct: 317 PVRFIDEPFAAVLPEF 332

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  182 bits (462), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 122/330 (36%), Positives = 180/330 (54%), Gaps = 33/330 (10%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIR- 67
           S TVKLN G  +P +GLG W+  +E   + V  AIKLGYR  D A  YGNE+ VG+ IR 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSG-VPRNELFVTTKLWGTQQ--RNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
             D G V R +LFV +KLW +    +N +KAL  +L+ LGL+Y+DL+ IH+P+AFK    
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPF 124

Query: 123 KDDDY---LTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
            ++ Y                       + T+  +++    G  KA+GVSNF    L +L
Sbjct: 125 -EERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHDL 183

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG-----------SNGSP 228
           LA  G K+ PAC Q+E HP L Q++L+E+ K +GI + AYS  G           +  +P
Sbjct: 184 LA--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKSTP 241

Query: 229 -LLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSKED 284
            L +  V+ +VA  +GV  ++VL+ W  QR   I+PKS   +R+ +N ++     LS E+
Sbjct: 242 TLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDEE 301

Query: 285 VDRIHKISKEQGVKRFVHP-DW--PSFPIF 311
           +  I  ++K+    RF  P +W    FP+F
Sbjct: 302 LQEISSLNKD---IRFNDPFNWLDMKFPVF 328

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  181 bits (460), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 112/313 (35%), Positives = 180/313 (57%), Gaps = 19/313 (6%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K++  +  LN G  +P +GLGT    ++  E   +V +A+K GYR+ID+A  YG+E  VG
Sbjct: 5   KSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVG 64

Query: 64  KAIRD----SGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119
           +AI++      + R +LF+T+K+W     + E++L  SLK LG+DY+DL+L HWP+ +  
Sbjct: 65  EAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCY-- 122

Query: 120 DNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTW-------ELVQELPATGKAKAVGVSNFS 172
            N ++D +                 +N    W       E +   P   + +A+GVSNF 
Sbjct: 123 -NRREDPHGINGLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGVSNFP 181

Query: 173 VNNLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKE 232
           V  LK +L     K  P  NQVE+HP LPQ EL EF     I + AYSPLGS+G+P++K 
Sbjct: 182 VEYLKRVLKECPVK--PVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKH 239

Query: 233 PVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKIS 292
           P+I E+++KY      +L ++ I++G  ++P+S+N  R+ SN +   LSK+D+D++  + 
Sbjct: 240 PLIKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLSKDDLDKLKDLG 299

Query: 293 KEQGVKRFVHPDW 305
           + +  KRF++  W
Sbjct: 300 RTEP-KRFINEKW 311

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  181 bits (460), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 186/310 (60%), Gaps = 13/310 (4%)

Query: 6   KNSSATVKLNTGAIIPQLGLGTWRSSDE--EAYNSVLSAIKLGYRHIDSAAIYGNEEPVG 63
           K +  +  LN G  +P LGLGT     E      +V +A+K GYRHID+A  YG+E  VG
Sbjct: 8   KGTEISFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVG 67

Query: 64  KAIRD---SGVPRNE-LFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAF-K 118
           +AI++    GV R E +F+T+K+W     + E++L+ SL+ LG+DY+DL+L HWP+ + K
Sbjct: 68  EAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVK 127

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQEL---PATGKAKAVGVSNFSVNN 175
            ++    + L                 ++++T+  ++++   P+  + +++GVSNF V  
Sbjct: 128 QEDTHGINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQY 187

Query: 176 LKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVI 235
           L+  L     K  PA NQVE+HP LPQ EL +F ++  I++EAYSPLGS+ +P +   ++
Sbjct: 188 LERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLV 245

Query: 236 IEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQ 295
            ++A+KY + P+ +L ++ I++G  ++ +SVN  R+ SN +   L++E++D + ++   +
Sbjct: 246 QDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGITK 305

Query: 296 GVKRFVHPDW 305
             KRFV+  W
Sbjct: 306 P-KRFVNEKW 314

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  174 bits (440), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 111/327 (33%), Positives = 172/327 (52%), Gaps = 29/327 (8%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----K 64
           + T  LN G  +P +GLG W+ S + A   V  AIKLGYR  D A  YGNE+ +G    +
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 65  AIRDSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           AI +  V R +LF+ +KLW       + + AL  +L  LGLDYVDLY IH+P+  K   +
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPL 123

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWN--FVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           ++     + T                 + T+  +++L   G  K++G+SNF    +++LL
Sbjct: 124 EEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDLL 183

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG------------SNGSP 228
              G ++ P   QVELHP L Q+ L+ +++SK I + AYS  G             + +P
Sbjct: 184 R--GARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVTP 241

Query: 229 LLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNF---KVFDLSKEDV 285
           LL+  +++ +AKK+ V P+QV++ W  QRG  ++PKS   +R+ +N    K   LS  ++
Sbjct: 242 LLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDSEM 301

Query: 286 DRIHKISKEQGVKRFVHP-DWPSFPIF 311
             I  ++K     RF+ P DW   P F
Sbjct: 302 SDIFSLNKNL---RFLDPWDWARLPGF 325

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  171 bits (432), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 118/333 (35%), Positives = 174/333 (52%), Gaps = 34/333 (10%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIR- 67
           S  V LN G  +P +GLG W+  +E   + V  AIK+GYR  D A  YGNE+ VG+ IR 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPRNELFVTTKLWGTQQ--RNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
             D G V R ELFV +KLW +    +N + AL  +L  + LDY+DL+ IH+PIA K    
Sbjct: 62  AIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWN--FVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           K+     + T             N   + T+  +++L   G  K++G+SNFS + + +LL
Sbjct: 122 KEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDLL 181

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSN-----GS-------P 228
              G ++ P   Q+E HP L Q+ L+ + K +G+ + AYS  G       GS       P
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTPP 239

Query: 229 LLKEPVIIEVAKKYGVE--PAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD---LSKE 283
           L + P IIE+AK +G E  P+QVL+ W  Q    ++PKS   +R+  N  + D   L+ +
Sbjct: 240 LFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTDQ 299

Query: 284 DVDRIHKISKEQGVKRFVHP----DWPSFPIFE 312
           ++  I  ++K     RF  P    D   FPIF+
Sbjct: 300 ELKEISALNKN---IRFNDPYTWNDKNPFPIFD 329

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  171 bits (432), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 170/328 (51%), Gaps = 33/328 (10%)

Query: 12  VKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGK----AIR 67
           + LN G  +PQ+GLG W+  ++   + V  AIK GYR  D A  Y NE  VGK    A+ 
Sbjct: 5   LTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMD 64

Query: 68  DSGVPRNELFVTTKLWGTQQRNPEKA---LDASLKRLGLDYVDLYLIHWPIAFKTDNIKD 124
           D  V R +LFV +KLW     +P+     L  +LK LGLDY+DLY IH+PIAFK   +++
Sbjct: 65  DGIVKRQDLFVVSKLWNNFH-HPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEE 123

Query: 125 DDYLTVPTXXXXXXXXXXXXWN--FVKTWELVQELPATGKAKAVGVSNFSVNNLKELLAS 182
                + T             N   + T+  ++E    G  K++G+SNF+   + ++L  
Sbjct: 124 RYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADILR- 182

Query: 183 PGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG------------SNGSPLL 230
            G  + P   Q+E HP L Q++L+E+ K   + +  YS  G             N  PL 
Sbjct: 183 -GCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPLF 241

Query: 231 KEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD---LSKEDVDR 287
             PVI ++A+K+ V  A+VL+ W  QRG  I+PKS + KR+ SN  + D   L++ED+  
Sbjct: 242 DHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLKS 301

Query: 288 IHKISKEQGVKRFVHP-DW--PSFPIFE 312
           I  +++     RF  P DW    FPIF 
Sbjct: 302 ISGLNQNL---RFNDPWDWNNSKFPIFH 326

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  169 bits (428), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 150/289 (51%), Gaps = 40/289 (13%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI-- 66
           S T  L  G  IP L LG + +  EE  ++V +A+K GYRH+D A +YGNE  VG  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 67  ---RDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLG----LDYVDLYLIHWPIAFKT 119
                  V R+E+F TTK+ G      EKA  + +K L     ++Y+DL LIH PIA   
Sbjct: 66  FLKETPNVSRSEIFYTTKVSG-DNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATE 124

Query: 120 DNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
           + +                           TW+ +QE  A GK +A+GVSN+S+ +L+EL
Sbjct: 125 ERLG--------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVA 239
               G K+ P  NQ EL+P L + EL E+ + KG+V+EA+SPL         +P + E+ 
Sbjct: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQK--FSDPQLQELI 216

Query: 240 KKY--GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVD 286
           K       PAQ+LI W +Q G++ LPKS N KR  SN +  D    D D
Sbjct: 217 KTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKD 265

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  170 bits (431), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 164/309 (53%), Gaps = 27/309 (8%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIR- 67
           S TV LN G  +P +GLG W+ S +     V  AIKLGYR  D A  YGNE+ VG  IR 
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 68  --DSG-VPRNELFVTTKLWGTQQ--RNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
             D G V R +LFV +KLW T    ++ + AL  +L  + L+Y+DLY IH+P+AFK    
Sbjct: 62  AIDEGIVKREDLFVVSKLWNTYHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVPF 121

Query: 123 KDDDY---LTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
            ++ Y                       + T+  ++EL   G  K++G+SN++   +++ 
Sbjct: 122 -EERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDT 180

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG------------SNGS 227
           L   G ++ P C Q+E HP L Q++L+E+ K  GI + AYS  G             +  
Sbjct: 181 LR--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTP 238

Query: 228 PLLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSKED 284
           PL   PVI ++A+++ V  +QV++ W  QRG  ++PKS +  R+  N ++     L+ +D
Sbjct: 239 PLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKD 298

Query: 285 VDRIHKISK 293
           ++ I  ++K
Sbjct: 299 LEEISSLNK 307

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  167 bits (422), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 115/329 (34%), Positives = 169/329 (51%), Gaps = 31/329 (9%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----K 64
           S  + LN G  +P +GLG W+  ++     V  AIKLGYR  D A  YGNE+ VG    +
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 65  AIRDSGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           AI +  V R ELFV +KLW +    ++ + AL  +L  + LDY+DLY IH+PIAFK    
Sbjct: 62  AISEGIVKREELFVISKLWNSYHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVPF 121

Query: 123 KDDDYLTVPTXXXXXXX--XXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           ++       T                 + T+  +++L   G  K++G+SNF+   +++LL
Sbjct: 122 EEKYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDLL 181

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGS------------NGSP 228
            S   K+ P C Q+E HP L Q  LIE+ K   I + AYS  G             +   
Sbjct: 182 RSC--KIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAKV 239

Query: 229 LLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSKEDV 285
           L +  VI  +A  + VEP+QVL+ W  QRG  I+PKS   +R+  N  +     LS++++
Sbjct: 240 LFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSEQEL 299

Query: 286 DRIHKISKEQGVKRFVHP-DWPS--FPIF 311
             I  ++   G+ RF  P DW +  FPIF
Sbjct: 300 STISDLNI--GL-RFNDPWDWNNMKFPIF 325

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  165 bits (417), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 161/291 (55%), Gaps = 39/291 (13%)

Query: 11  TVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD-- 68
           + KL++G  IP +GLGT+     +    V  A+++GYRH D+A +YGNE  VG+ I+   
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWL 67

Query: 69  ----SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDN 121
               +   R ++F TTKLW +Q      +KA+D  L+ +  L Y+DL LIH P+  K   
Sbjct: 68  NENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLGGKKLR 127

Query: 122 IKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181
           ++                          T+E +QE    GK +++GVSN+   +++ELL 
Sbjct: 128 LE--------------------------TYEAMQEAVDAGKVRSIGVSNYGFQHIEELLN 161

Query: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241
               K  P  NQ+E+ P   + EL +F K KGI++EAY+PL ++G+  LK+P +++VA +
Sbjct: 162 WEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL-THGTK-LKDPDLVKVANE 219

Query: 242 YGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDL--SKEDVDRIHK 290
            G +  Q LI W +Q+GY+ LPK+ +  R+ SN  VF    + + +D++ K
Sbjct: 220 VGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSFEWTTDQMDQLDK 270

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  164 bits (415), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 148/291 (50%), Gaps = 39/291 (13%)

Query: 11  TVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD-- 68
           T  L  G ++P LGLG +          V  A+K GYRH D+A  YGNE  VG+ I    
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 69  ----SGVPRNELFVTTKLWGTQQRNPE--KALDASLKRLG-LDYVDLYLIHWPIAFKTDN 121
               S   R ++F  TKLW +Q    E   A+   L+++  L Y+DL LIH P       
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKR 124

Query: 122 IKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181
           +                           T+E +QE    G  K++GVSN+  ++L+EL A
Sbjct: 125 L--------------------------ATYEAMQESVDAGIVKSIGVSNYERHHLQELYA 158

Query: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241
            P  K  P  NQ+E+ P LP+++L+++ KS G+ I+AYSPLG      + +P I  +A +
Sbjct: 159 MPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLATQ 216

Query: 242 YGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD--LSKEDVDRIHK 290
               PAQ+LI W + +GY  LPK+ N +R++SN   ++  L+ E++  I K
Sbjct: 217 KNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVSLTAEELTNIEK 267

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  166 bits (419), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 169/329 (51%), Gaps = 31/329 (9%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIR- 67
           S+ V LN G  +P +GLG W+  ++     V  AIK+GYR  D A  YGNE+ VG+ IR 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
             D G V R ++FV +KLW +     + + AL  +L  +GLDY+DL+ IH+PIAFK    
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWN--FVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           ++       T             +   + T+  +++    G  K++G+SNFS + +++LL
Sbjct: 122 EEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL 181

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYS------------PLGSNGSP 228
                K+ P   QVE HP L Q+ L+E+ K  GI + AYS            PL  N   
Sbjct: 182 RQC--KIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPN 239

Query: 229 LLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSKEDV 285
           L     I ++A  + V  +QVL+ W  QRG  I+PKS   +R++ N  +     L+ +++
Sbjct: 240 LFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTHKEL 299

Query: 286 DRIHKISKEQGVKRFVHP-DW--PSFPIF 311
           + I K++K     R   P DW    FPIF
Sbjct: 300 EAISKLNKNL---RLNDPWDWLDGKFPIF 325

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  166 bits (419), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 114/329 (34%), Positives = 169/329 (51%), Gaps = 28/329 (8%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----K 64
           ++ V LN G  +P +GLG W+  +E     +  AI +GYR  D A  YGNE+ VG    +
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 65  AIRDSGVPRNELFVTTKLWGT--QQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           AI+D  V R ELFV +KLW +    +N + AL  +L  +GLDY+DL+ IH+PIA K  + 
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 123 KDDDY---LTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
            ++ Y   L                   + T+  ++E    G  K++GVSNFS + + +L
Sbjct: 122 -EEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLDL 180

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSN-----GS------- 227
           L   G ++ PA  Q+ELHP L Q+  +++ +SKGI + AYS  G       GS       
Sbjct: 181 LR--GARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKATP 238

Query: 228 PLLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDR 287
           PL +  V+ ++A K+ V  +QVL+ W  Q+   ++PKS   +R+  N  V        D 
Sbjct: 239 PLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGDE 298

Query: 288 IHKISKEQGVKRFVHP-DWPS---FPIFE 312
           I +IS      RF  P  W     FPIF+
Sbjct: 299 IKEISGLNKNLRFNDPFTWSEKTPFPIFD 327

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  165 bits (418), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 116/332 (34%), Positives = 176/332 (53%), Gaps = 36/332 (10%)

Query: 10  ATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----KA 65
           + V LN G  +P +GLG W+ S++     V  AIKLGYR  D A  YGNE  VG    KA
Sbjct: 3   SLVTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKA 62

Query: 66  IRDSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIK 123
           I +  V R++LFV +KLW +     + + AL  +L+ LGLDY+DLY IH+PIAFK    +
Sbjct: 63  IDEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFE 122

Query: 124 DDD----YLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
           +      Y  V                 + T+  ++E    G  K++G+SNF+   +++L
Sbjct: 123 EKYPPGFYTGVDDAREGILSEAKVP--ILDTYRALEECVDNGLIKSIGISNFNGVLVQDL 180

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG-----------SNGSP 228
           L   G ++ P   Q+E HP L Q++L+E+ K KGI + AYS  G           +  +P
Sbjct: 181 LN--GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTP 238

Query: 229 -LLKEPVIIEVAKKY-GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD---LSKE 283
            LL+ P+I ++A  +    P++VL+ W  QRG  ++PKS   +R+  N  V D   L++E
Sbjct: 239 SLLEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEE 298

Query: 284 DVDRIHKISKEQGVKRFVHP-DW--PSFPIFE 312
           +++ I  ++K     RF  P +W    FP F 
Sbjct: 299 ELNEISSLNKN---IRFNDPWEWLNSKFPTFH 327

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  164 bits (416), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 110/327 (33%), Positives = 164/327 (50%), Gaps = 27/327 (8%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----K 64
           + TV LN G  +P +GLG W+  ++   + +  AIK+GYR  D A  Y NE+ VG    +
Sbjct: 5   AETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNR 64

Query: 65  AIRDSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           AI++  V R +L V +KLW +     N  +AL+ +L  L LDYVD++ IH+P+AFK    
Sbjct: 65  AIKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPF 124

Query: 123 KDDDY---LTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
            D+ Y                       + TW  +++L   GK K++G+SNFS   +++L
Sbjct: 125 -DEKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDL 183

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGS------------NGS 227
           L   G ++ P   Q+E HP L Q+ LI++ K+ GI + AYS  G             N  
Sbjct: 184 LR--GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTP 241

Query: 228 PLLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDR 287
            L +   I  +A K+ V P QVL+ W  Q G  I+PKS   +R+  N ++ D      D 
Sbjct: 242 TLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDE 301

Query: 288 IHKISKEQGVKRFVHP-DW--PSFPIF 311
           + +IS      RF  P +W    FP F
Sbjct: 302 LKQISGLNQNIRFNDPWEWLDNEFPTF 328

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  164 bits (415), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 115/333 (34%), Positives = 169/333 (50%), Gaps = 36/333 (10%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIR- 67
           SA V LN G  +P +GLG W+         +  AIK+GYR  D A  YGNE+ VG+ I+ 
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 68  --DSG-VPRNELFVTTKLWGTQQRNPEKA---LDASLKRLGLDYVDLYLIHWPIAFKTDN 121
             D G V R +LF+ +KLW     +P+     L  +LK LGLDYVDLY IH+PIAFK  +
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFH-HPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVS 120

Query: 122 IKDDDY---LTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKE 178
             D+ Y   +                   + T+  +++L   G  K++G+SN++   + +
Sbjct: 121 -PDERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVAD 179

Query: 179 LLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG------------SNG 226
            L   G ++ P   Q+E HP L Q++L+E+ K   + + AYS  G             N 
Sbjct: 180 TLR--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNT 237

Query: 227 SPLLKEPVIIEVAKKY-GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSK 282
            PL   P I ++A KY  V  +QVL+ W  QRG  I+PKS   +R+  N  +     L++
Sbjct: 238 PPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAE 297

Query: 283 EDVDRIHKISKEQGVKRFVHP-DW--PSFPIFE 312
           ED+  I  +++     RF  P DW    FPIF+
Sbjct: 298 EDLREISALNQNL---RFNDPWDWNNSKFPIFQ 327

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  164 bits (415), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 112/331 (33%), Positives = 172/331 (51%), Gaps = 33/331 (9%)

Query: 8   SSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG---- 63
           +S TVKLN G  +P +GLG W+  +E   + V  AIKLGYR  D A  YGNE+ VG    
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIH 63

Query: 64  KAIRDSGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDN 121
           KAI +  V R +LFV +KLW +    +N +KAL  +L+ + L+Y+DL+ IH+P+AFK   
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYVP 123

Query: 122 IKDDDY---LTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKE 178
             ++ Y                       + T+  ++E    G  K++G+SNF    + +
Sbjct: 124 F-EEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILIHD 182

Query: 179 LLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG-----------SNGS 227
           LLA  G  + P C Q+E HP L Q++LIE+   + I + AYS  G           +  +
Sbjct: 183 LLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKST 240

Query: 228 P-LLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSKE 283
           P L +   I ++A  +GV  +QVL+ W  QR   I+PKS   +R+  N ++     L++ 
Sbjct: 241 PTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLTLTEA 300

Query: 284 DVDRIHKISKEQGVKRFVHP-DW--PSFPIF 311
           ++  I  ++K+    RF  P  W    FP+F
Sbjct: 301 ELQEISALNKD---IRFNDPFTWLGMKFPVF 328

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  162 bits (410), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 157/285 (55%), Gaps = 39/285 (13%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI------ 66
           KL++G  +P +GLGT+          V  A+K GYRH+D+A +YGNE  VG+ I      
Sbjct: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70

Query: 67  RDSGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIK 123
             S   R ++F  TKLW +Q    N ++A+    +++ GL Y+DL LIH P++     ++
Sbjct: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRLE 130

Query: 124 DDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183
                                     T++ +QE    G  +++GVSN+ V+++ ELL   
Sbjct: 131 --------------------------TYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWN 164

Query: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243
             K  P  NQ+E+ P L + EL ++ KS+G+++EAY+PL ++G   +  P ++ VAK+ G
Sbjct: 165 ELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL-THGYK-INHPNVLRVAKEAG 222

Query: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVF--DLSKEDVD 286
               QVLI W +Q GYV LPK+ + KR+ SN  V+  +L++E +D
Sbjct: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMD 267

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  162 bits (410), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 104/291 (35%), Positives = 162/291 (55%), Gaps = 40/291 (13%)

Query: 10  ATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEP----VGKA 65
            T  L  G  +P LGLG +++  EE  N V +A+KLGYR +DSA +YGNE      + K 
Sbjct: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66

Query: 66  IRDS-GVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLG-LDYVDLYLIHWPIAFKTDN 121
           + +S  V R+++F TTK+    Q   + +K+++ SL R+  LDY+DL+LIH P+  K   
Sbjct: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126

Query: 122 IKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181
           +                           TW+  QE   TGK KA+GVSN+ + +L+E+  
Sbjct: 127 L--------------------------GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160

Query: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241
             G K+ P  NQ EL+P L + EL  +   KG+VI+AYSPL    +  L++P ++++ + 
Sbjct: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVED 218

Query: 242 YGVE--PAQVLINWGIQRGYVILPKSVNPKRVESNFKV--FDLSKEDVDRI 288
              E   AQ+L+NW +Q G+V L K+V+  R++ N K   F+LS  D+ ++
Sbjct: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  161 bits (408), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 155/277 (55%), Gaps = 37/277 (13%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD---- 68
           KL++G ++P LGLGT+     E    V  A+K GYRH+D+A +YGNE  VG+ +      
Sbjct: 11  KLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKE 70

Query: 69  --SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLG-LDYVDLYLIHWPIAFKTDNIK 123
                 R+++F TTKLW +Q    N ++A+   L ++  L Y+D+ LIH P++     ++
Sbjct: 71  DPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRRLE 130

Query: 124 DDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183
                                     T++ +QE    G  +++GVSN+  +++ ELLA  
Sbjct: 131 --------------------------TYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWE 164

Query: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243
             K  P  NQ+E+ P + + +L ++ KSKG+V+EA+SPL ++G   +K P ++ VA++ G
Sbjct: 165 ELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL-THGYK-IKHPNVVRVAEEVG 222

Query: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDL 280
               QVLI W +Q GYV LPKS + +R++ N +V+D 
Sbjct: 223 RNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVYDF 259

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  161 bits (408), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 159/284 (55%), Gaps = 39/284 (13%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD---- 68
           KL++G I+P +GLGT+     E    V  A+K GYRH+D+A +YGNE  VG+ I+     
Sbjct: 18  KLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEE 77

Query: 69  --SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLG-LDYVDLYLIHWPIAFKTDNIK 123
                 R ++F TTKLW +Q    N ++A+   ++++  L Y+DL LIH P++     ++
Sbjct: 78  DPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRLE 137

Query: 124 DDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183
                                     T++ +QE    G  +++GVSN+  +++ ELL   
Sbjct: 138 --------------------------TYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWK 171

Query: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243
             K  P  NQ+E+ P + + +L ++ KSKG+V+EA+SPL ++G   LK P ++ VAK+ G
Sbjct: 172 ELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL-THGYK-LKHPDVLLVAKETG 229

Query: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD--LSKEDV 285
            +  +VLI W +Q GYV LPKS + +R++ N K +D  LS E V
Sbjct: 230 TDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  160 bits (406), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 164/298 (55%), Gaps = 45/298 (15%)

Query: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60
           MSI    +S T  L  G  IP LG GT+ +  E+A + V +A K GYRH+D+A +Y NE 
Sbjct: 1   MSI---TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENER 57

Query: 61  ----PVGKAIRDS-GVPRNELFVTTKLWGTQQRNPEKALDASLKRLG----LDYVDLYLI 111
                V K +++S  V R+++F TTK+ G      EKA  + ++ L     L+YVDL+LI
Sbjct: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAG-DNHGYEKAKKSIIESLEMAKELEYVDLFLI 116

Query: 112 HWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNF 171
           H P A     +                           T++ +QE    GK KA+GVS++
Sbjct: 117 HNPCAETEKRLG--------------------------TYKALQEFYKAGKIKAIGVSSY 150

Query: 172 SVNNLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLK 231
           S+ +L+EL +  G ++ P  NQ EL+P L + +L+++ K + +VIEA+SP+    S    
Sbjct: 151 SIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFS 208

Query: 232 EPVIIEVAKKY--GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV--FDLSKEDV 285
           +PV+ ++ K+   G  PAQ+LI W +Q G+V LPKSV+  R ESN     F++S ED+
Sbjct: 209 DPVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDM 266

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  159 bits (401), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/301 (31%), Positives = 159/301 (52%), Gaps = 47/301 (15%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD---- 68
           +L  G  IP L LGT+   +      V  A+K GYRH D+A +YGNE  VG+ I +    
Sbjct: 12  ELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINE 71

Query: 69  --SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIK 123
             +   R ++F TTKLW +Q      ++A+   ++++ GL Y+D+ LIH P++ +   + 
Sbjct: 72  DKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRRL- 130

Query: 124 DDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183
                                    +TW+ +QE    G  K++GVSN+  ++++ELL   
Sbjct: 131 -------------------------ETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWD 165

Query: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243
             K  P  NQ+E+ P + + EL ++ KS  +V+EAY+P+       + +P + E++K+ G
Sbjct: 166 ELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAHGYK--MNDPGLREISKETG 223

Query: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHP 303
           + P Q+LI W +Q GY+ LPK+    R+ SN  V++         HK++ +Q VKR  HP
Sbjct: 224 MNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVYN---------HKLTLDQ-VKRMDHP 273

Query: 304 D 304
           +
Sbjct: 274 E 274

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  159 bits (402), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 155/291 (53%), Gaps = 24/291 (8%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----K 64
           +A + LN G  +P +GLG W+  ++   + V  AIKLGYR  D AA YGNE+ VG    K
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIRDSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           A+ +  V R++LF+ +KLW T     + + AL  +L  LGLDY+DLY IH+P+AFK    
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWN--FVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           ++       T             N  ++ T+  +++L   G  K++GVSN   + L+++L
Sbjct: 122 EEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVL 181

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG------------SNGSP 228
              G ++ PA  Q+E HP L Q+ L++F K++ I + +YS  G             +   
Sbjct: 182 M--GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPA 239

Query: 229 LLKEPVIIEVAKKYG--VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV 277
           L   PVI ++A  +G  V  ++VL+ W  QR   I+PKS   +R+  N  V
Sbjct: 240 LFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNV 290

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  157 bits (398), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/308 (33%), Positives = 156/308 (50%), Gaps = 25/308 (8%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIR- 67
           S+   LN G  +P +GLG W+  +      V  AIKLGYR  D A  YGNE+ VG+ IR 
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 68  ---DSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
              +  V R++LF+ +KLW T     + + A+  +L  LGLDY+DLY IH+P+AFK   I
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWN--FVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           ++       T                ++ T+  ++ L   G  K++GVSN     L+++L
Sbjct: 122 EEKYPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVL 181

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSN-----GSP------- 228
              G K+ P   Q+E HP L Q  L+++ K + I++ AYS  G       GS        
Sbjct: 182 M--GCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPN 239

Query: 229 LLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSKEDV 285
           L   PVI  +A KY V  ++VL+ W  Q G  ++PKS   +R+  N  +     LS E++
Sbjct: 240 LFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEEL 299

Query: 286 DRIHKISK 293
             I  I++
Sbjct: 300 VEISNINR 307

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  156 bits (395), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 151/303 (49%), Gaps = 51/303 (16%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI-----R 67
           KL+ G  IP + LGT+     +    V   +K GYRH D+A +YGNE+ VG  I      
Sbjct: 7   KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 68  DSG-VPRNELFVTTKLWGTQQRNPEKALDASLKRL-----GLDYVDLYLIHWPIAFKTDN 121
           D G   R E+F TTKLW +Q  N  K   A++++      GL Y+DL LIH P+      
Sbjct: 67  DPGNHKREEIFYTTKLWNSQ--NGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGSKLR 124

Query: 122 IKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181
           ++                          TW  +QE    G  K++GVSN+   ++ ELL 
Sbjct: 125 LE--------------------------TWRAMQEAVDEGLVKSIGVSNYGKKHIDELLN 158

Query: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241
            P  K  P  NQ+E+ P + + EL ++ KSKG+V+EA++PL       +  P +++V K+
Sbjct: 159 WPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPLCHGYK--MTNPDLLKVCKE 216

Query: 242 YGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFV 301
               P QVLI W +Q GY+ LPK+   KR+E N   ++          ++S EQ +K   
Sbjct: 217 VDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNF---------ELSDEQ-MKFLD 266

Query: 302 HPD 304
           HPD
Sbjct: 267 HPD 269

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  156 bits (394), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 101/300 (33%), Positives = 159/300 (53%), Gaps = 47/300 (15%)

Query: 14  LNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD----- 68
           L+ G  IP L LGT+        N V  A+K GYRH D+A +Y NE  VG+ I       
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQED 68

Query: 69  -SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIKD 124
                R ++F TTKLW +Q   +  ++A+   L+++  L Y+DL LIH P++     ++ 
Sbjct: 69  PKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRLE- 127

Query: 125 DDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPG 184
                                    T++ +QE    G  K++GVSN+  ++L+ELL+  G
Sbjct: 128 -------------------------TYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEG 162

Query: 185 NKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGV 244
            K  P  NQ+E+ P   + EL ++ +S+GIV+E Y+PL ++G   LK+P +++VA++ G 
Sbjct: 163 LKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL-THGYK-LKDPQLVKVAEEVGK 220

Query: 245 EPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPD 304
              QVLI W +Q GY+ LPK+ N  R+  N  V+D          K+++ Q +K F HP+
Sbjct: 221 NTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDF---------KLTESQ-IKAFEHPE 270

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  155 bits (393), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 149/280 (53%), Gaps = 38/280 (13%)

Query: 11  TVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI---- 66
           T KL++   IP + LGT+     E    V +A+ +GYRH D+A +Y NEE V + I    
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWL 67

Query: 67  -RDSGVPRNELFVTTKLWGTQ--QRNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNI 122
            R     R+E+F TTKLW +Q   +N ++A+   + ++  L Y+DL L+H PI      I
Sbjct: 68  IRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPIG--GPQI 125

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLAS 182
           +++                        TW  +QE    G  K++GVSNF + +LKEL   
Sbjct: 126 REE------------------------TWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQW 161

Query: 183 PGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKY 242
            G K  P  NQ+E+ P L + EL +F K +G+V+EAY+PL ++G   +  P +I+++ + 
Sbjct: 162 DGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL-THGYK-INHPDLIKISNEL 219

Query: 243 G--VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDL 280
                  Q+LI W +Q GYV LPK+    R+ESN  V+D 
Sbjct: 220 NNTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVYDF 259

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  155 bits (393), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 156/305 (51%), Gaps = 28/305 (9%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----K 64
           S+ V LN G  +P +GLG W+       N +  AIKLGYR  D A  YGNE+ VG    K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           AI +  V R ++FV +KLW       + + AL  +L  +GLDY+DLY IH+PIAFK    
Sbjct: 62  AIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPF 121

Query: 123 KDDDY---LTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
            ++ Y       T               + T+  +++    G  K++G+SNF  + +++L
Sbjct: 122 -EEKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQDL 180

Query: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNG------------S 227
           L   G ++ P   Q+E HP L Q+ L+EF K   I + AYS  G                
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKATQ 238

Query: 228 PLLKEPVIIEVAKKY-GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSKE 283
            L +  VI +V++ + G   +QVL+ W  QRG  ++PKS   +R+  N ++   F L+++
Sbjct: 239 TLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTEQ 298

Query: 284 DVDRI 288
           ++ +I
Sbjct: 299 ELKKI 303

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  154 bits (390), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 150/277 (54%), Gaps = 36/277 (12%)

Query: 11  TVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI---- 66
           + KL +G  IP +GLGT+          V +A+++GYRH+D+A +YGNE  V +      
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFL 65

Query: 67  -RDSGVPRNELFVTTKLWGTQ--QRNPEKALDASLKRLG-LDYVDLYLIHWPIAFKTDNI 122
            R   V R ++F TTKLW +Q      ++A+   ++ +G L Y+DL L+H PI  K    
Sbjct: 66  GRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIGGKQVR- 124

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLAS 182
                                      TW+ +QE    G  +++GVS++   +L++L   
Sbjct: 125 -------------------------RGTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEW 159

Query: 183 PGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKY 242
              K  PA NQ+E+ P + + +L ++ KSKGIV+EAYSPL ++G   L +P +++VA++ 
Sbjct: 160 SELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL-THGYK-LDDPDLLKVAEET 217

Query: 243 GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD 279
           G  P QVL+ W +Q GYV LPK+    R++ N  VFD
Sbjct: 218 GKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVFD 254

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  155 bits (391), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 108/329 (32%), Positives = 170/329 (51%), Gaps = 31/329 (9%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----K 64
           S TV LN G  +P +GLG W+  ++   + V  AIKLGYR  D A  YGNE+ VG    K
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 65  AIRDSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           AI +  V R +LFV +KLW +     N + AL  +L  +GLDY+DL+ IH+P+AFK    
Sbjct: 65  AIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFKFVPF 124

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWN--FVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           ++       T             +   + T+  +++    G  K++G+SNF+ + +++LL
Sbjct: 125 EEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQDLL 184

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG-----------SNGSP- 228
              G ++ P   Q+E HP L Q+ L+++ K+ GI + AYS  G           +  +P 
Sbjct: 185 R--GARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKTTPT 242

Query: 229 LLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD---LSKEDV 285
           L +   +  +A  + V  +QVL+ W  QRG  ++PKS   +R+  N  + D   LS +++
Sbjct: 243 LFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSDKEL 302

Query: 286 DRIHKISKEQGVKRFVHP-DW--PSFPIF 311
             I  ++K+    RF  P  W    FP F
Sbjct: 303 KAISALNKDI---RFNDPWTWLNSEFPTF 328

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  155 bits (391), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 159/304 (52%), Gaps = 26/304 (8%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----K 64
           S+ V LN G  +P +GLG W+   +   N +  AIKLGYR  D A  YGNE+ VG    K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           AI +  V R ++FV +KLW       + + AL  +L  +GLDY+DLY IH+PIAFK    
Sbjct: 62  AISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWN--FVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           ++       T             +   + T+  ++E    G  K++GVSNF  + +++LL
Sbjct: 122 EEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLL 181

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG-----------SNGSP- 228
              G ++ P   Q+E HP L Q+ L+EF K   I + AYS  G           +  +P 
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPT 239

Query: 229 LLKEPVIIEVAKKY-GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSKED 284
           L +  VI +V++ + G   +QVL+ W  QRG  ++PKS   +R+  N ++   F L++++
Sbjct: 240 LFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 285 VDRI 288
           +  I
Sbjct: 300 LKDI 303

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  153 bits (386), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 151/286 (52%), Gaps = 45/286 (15%)

Query: 17  GAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD------SG 70
           G  IP L LG +     +  N V  A+K GYRH D+A +YGNE+ VG+ I        + 
Sbjct: 12  GIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPAN 71

Query: 71  VPRNELFVTTKLWGTQ------QRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKD 124
             R ++F TTKLW +Q      +R   + ++  +K LG  Y+DL LIH P++     ++ 
Sbjct: 72  NKREDVFYTTKLWNSQNGYSPAKRGISECMN-KVKELG--YIDLLLIHSPLSGPRRRLE- 127

Query: 125 DDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPG 184
                                    T++ +QE    G  K++GVSN+   +++EL     
Sbjct: 128 -------------------------TYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDK 162

Query: 185 NKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGV 244
            K  P  NQ+E+ P   +++L  + +SKG+++EA+SPL       LKEP ++ +AKK G 
Sbjct: 163 LKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPLTHGYK--LKEPGLVSLAKKLGR 220

Query: 245 EPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD--LSKEDVDRI 288
           +  QVLI W +QRG + LPK+ NP R+ SN +V+D  L+ EDV  +
Sbjct: 221 DTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKEL 266

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  153 bits (386), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 98/301 (32%), Positives = 146/301 (48%), Gaps = 47/301 (15%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD---- 68
           KL+ G  IP + LGT+     +    V   IK GYRH D+A +YGNE+ VG  I      
Sbjct: 7   KLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNE 66

Query: 69  --SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIK 123
                 R ++F TTKLW +Q   R  + A+   L  + GL+Y+DL LIH P+      ++
Sbjct: 67  DPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPLEGSKLRLE 126

Query: 124 DDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183
                                     TW  +QE    G  K++GVSN+   ++ ELL   
Sbjct: 127 --------------------------TWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWS 160

Query: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243
             +  P  NQ+E+ P + + EL ++ KSKG+++EA++PL       +  P ++ V K+  
Sbjct: 161 ELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPLCHGYK--MTNPDLLIVCKEVD 218

Query: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHP 303
             P QVLI W +Q GY+ LPK+   KR+E N   +           ++S EQ +K   HP
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSF---------ELSDEQ-MKTLDHP 268

Query: 304 D 304
           D
Sbjct: 269 D 269

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  152 bits (385), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 96/278 (34%), Positives = 143/278 (51%), Gaps = 37/278 (13%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD---- 68
           KL+ G  IP +GLGT+   +    N V  A+K GYRH D+A +YGNEE VG+ I      
Sbjct: 10  KLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLE 69

Query: 69  --SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIK 123
                 R  +F TTKLW +Q       KA+   L ++  L+Y+DL LIH P+      ++
Sbjct: 70  DPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPLGGTKLRLE 129

Query: 124 DDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183
                                     TW+ +QE    G  K++GVSN+ ++++ ELL   
Sbjct: 130 --------------------------TWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQ 163

Query: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243
             K  P  NQ+E+ P L + EL ++ KS  I +E YSPL ++G   L +  + +VA + G
Sbjct: 164 YLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL-THGYK-LNDQDLKKVANETG 221

Query: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLS 281
               QVLI W +Q GY+ LPK+    R+++N  V+D +
Sbjct: 222 KNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFN 259

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  153 bits (387), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 154/287 (53%), Gaps = 40/287 (13%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI-----R 67
           +L+ G  IP +GLG ++ S++   + V  A+++GYR  DSA  Y NE+ V + I      
Sbjct: 14  RLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKH 73

Query: 68  DSGVPRNELFVTTKLWGTQQRNPE---KALDASLKRLG-LDYVDLYLIHWPIAFKTDNIK 123
             G  R +++ TTK+  TQ    E   K+L+ SL   G L Y+DL L+H P++ +T  + 
Sbjct: 74  APGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLG 132

Query: 124 DDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183
                                     TW+ ++E    G+ +++GVSN+   +L ELL   
Sbjct: 133 --------------------------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWE 166

Query: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243
           G K+ P  NQVE++P L + EL+++ +   I ++A+SPL       L +P++ +VA +Y 
Sbjct: 167 GLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPLMRGKR--LDDPILQKVAHQYD 224

Query: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV--FDLSKEDVDRI 288
              AQ+L+ W IQ G+++LPK+   +R+  NF +  F+LS E +  +
Sbjct: 225 KGVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAETMSEL 271

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  152 bits (385), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 146/300 (48%), Gaps = 47/300 (15%)

Query: 14  LNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI------R 67
           L+ G  IP + LGT+     +    V   IK GYRH D+A +YGNE+ VG  I       
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNEN 67

Query: 68  DSGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIKD 124
                R ++F TTKLW +Q   +  + A+   L  + GL Y+DL LIH P+      ++ 
Sbjct: 68  PESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRLE- 126

Query: 125 DDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPG 184
                                    TW+ +QE    G  K++GVSN+   ++ ELL  P 
Sbjct: 127 -------------------------TWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPD 161

Query: 185 NKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGV 244
               P  NQ+E+ P + + EL ++ KSKG+++EA++PL       +  P +++V K+   
Sbjct: 162 LTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPLCHGYK--MTNPDLLKVCKEVDR 219

Query: 245 EPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPD 304
            P QVLI W +Q GY+ LPK+   KR+E N   +D   E +D+  KI          HPD
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYDF--ELLDKQMKI--------LDHPD 269

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  152 bits (383), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 106/328 (32%), Positives = 164/328 (50%), Gaps = 28/328 (8%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVG----K 64
           S+ V LN G  +P +GLG W+  ++   N +  AIKLGYR  D A  YGNE+ VG    K
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           AI +  V R ++FVT+KLW       + + AL  +L  +GLDY+DLY IH+PIAFK    
Sbjct: 62  AISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 KDDDYLTVPTXXXXXXXXXXXXWN--FVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
           ++       T             +   + T+  ++     G  K++G+SNF  + +++LL
Sbjct: 122 EEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLL 181

Query: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG-----------SNGSP- 228
              G ++ P   Q+E HP L Q+ L+++ K   I + AYS  G           +  +P 
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPT 239

Query: 229 LLKEPVIIEVAKKY-GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDR 287
           L +  V+ +V++ + G   +QVL+ W  QRG  ++PKS   +R+  N ++          
Sbjct: 240 LFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQE 299

Query: 288 IHKISKEQGVKRFVHPDWP----SFPIF 311
           + +IS      RF  P W      FPIF
Sbjct: 300 LKEISSLNANIRFNDP-WTWLDGKFPIF 326

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  151 bits (381), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/306 (32%), Positives = 158/306 (51%), Gaps = 30/306 (9%)

Query: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIR- 67
           S+ V LN G  +P +GLG W+   +   N +  AIKLGYR  D A  YGNE+ VG+ IR 
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 68  ---DSGVPRNELFVTTKLWGTQQR--NPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
              +  V R ++FV +KLW       + + AL  +L  +GLDY+DLY IH+PIAFK    
Sbjct: 62  AISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 KDDD----YLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKE 178
           ++      Y  V                 + T+  ++E    G  K++G+SNF  + +++
Sbjct: 122 EEKYPPGFYTGVDDEKKGHITEAHVP--ILDTYRALEECVDEGLIKSIGISNFQGSLVQD 179

Query: 179 LLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLG-----------SNGS 227
           LL   G ++ P   Q+E HP L Q+ L+EF +   I + AYS  G           +  +
Sbjct: 180 LLR--GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTT 237

Query: 228 P-LLKEPVIIEVAKKY-GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV---FDLSK 282
           P L +  VI +++  + G   +QVL+ W  QRG  ++PKS   +R+  N ++   F L++
Sbjct: 238 PTLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTE 297

Query: 283 EDVDRI 288
           +++  I
Sbjct: 298 QELKEI 303

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  149 bits (376), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 139/281 (49%), Gaps = 37/281 (13%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD---- 68
           K + G  +P + LGT+     +    V   IK GYRH D+A +YGNE+ VG  I      
Sbjct: 7   KFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHE 66

Query: 69  --SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIK 123
                 R ++F TTKLW +Q   +  + A+   L  + GL Y+DL LIH P+      ++
Sbjct: 67  DPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRLE 126

Query: 124 DDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183
                                     TW+ +QE    G  K++GVSN+   ++ ELL   
Sbjct: 127 --------------------------TWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWS 160

Query: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243
             K  P  NQ+E+ P + + EL ++ KSK +V+EA++PL       + +P +++V K+  
Sbjct: 161 QLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPLCHGYK--MTDPDLLKVCKEVD 218

Query: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKED 284
             P QVLI W +Q GY+ LPK+   KR+ESN   ++    D
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSD 259

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  149 bits (376), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 146/286 (51%), Gaps = 39/286 (13%)

Query: 14  LNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD----- 68
            N G  IP + LGT+          V  A+K GYRH D+A +YGNE  VG+ I       
Sbjct: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69

Query: 69  -SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIKD 124
                R+++F TTKLW +Q      + A+   L ++ GL Y+D+ LIH P+  +T  ++ 
Sbjct: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRLE- 128

Query: 125 DDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPG 184
                                    TW  +QE   +G  K +GVSN+   +++ELL    
Sbjct: 129 -------------------------TWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163

Query: 185 NKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGV 244
             + P  NQ+E+ P + + EL ++ KS G+V+EA++PL ++G   L +  ++ V+K+ G 
Sbjct: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYK-LHDADLVRVSKEVGR 221

Query: 245 EPAQVLINWGIQRGYVILPKSVNPKRVESNFKV--FDLSKEDVDRI 288
              QVLI W +Q GY+ LPK+   KR+E N +   F L+ E +  I
Sbjct: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  149 bits (375), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 148/287 (51%), Gaps = 47/287 (16%)

Query: 7   NSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI 66
           N     KLN G  +P +G G +    EE    V +A++ GYRHID+A +Y N++   + +
Sbjct: 8   NRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGV 67

Query: 67  R----DSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLD------YVDLYLIHWPIA 116
                ++G PR E++ TTKLW TQQ     A   +L+ +  D      YVDL L+H P+ 
Sbjct: 68  HRFLEETGTPREEVWFTTKLWNTQQ--GRDATPRALEEIAADVKEFIGYVDLLLLHSPL- 124

Query: 117 FKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQ---ELPATG--KAKAVGVSNF 171
             TD  +                        ++TW +++   + PA+   + +A+GVSNF
Sbjct: 125 --TDAQRR-----------------------LETWAVLERAVQEPASSALEIRAIGVSNF 159

Query: 172 SVNNLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLK 231
            V +L+ELL     K  P  +Q+ELHP LP+ EL  F +  GI+ EAYSPL       L+
Sbjct: 160 GVRHLQELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPLTQGVR--LQ 215

Query: 232 EPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVF 278
           +P ++ +  K G+   ++L+ W   +G+ +L KS NP+R+  N  V 
Sbjct: 216 DPELLALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVL 262

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  146 bits (369), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 147/275 (53%), Gaps = 46/275 (16%)

Query: 46  GYRHIDSAAIYGNEEPVGKAIRDSGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLGL 103
           G  HID+A IY     +G A++D+  PR+E+F+T K    +Q   NP+ AL+ SLK+LG+
Sbjct: 54  GVVHIDAAEIYRTYPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGV 113

Query: 104 DYVDLYLIHWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKA 163
           DYVDLYL+H PI      IK+                     +    W+ ++EL  +GKA
Sbjct: 114 DYVDLYLLHSPI------IKES------------------KLDVEANWKYLEELYKSGKA 149

Query: 164 KAVGVSNFSVNNLKELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSP 221
           K +GVSNF+V +L++LLA    K  P  NQ+E  P L      ++EFS+  GI++EAYSP
Sbjct: 150 KNIGVSNFAVKDLEKLLAVAEVK--PQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSP 207

Query: 222 LGSNGSPLLKEP----------VIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRV 271
           LG    PL + P           I E++KKY    AQ+L++W  +RG + +  S   +R+
Sbjct: 208 LG----PLQRRPEDADKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERI 263

Query: 272 ESNFKV--FDLSKEDVDRIHKISKEQGVKRFVHPD 304
           +    +  F L+ E+V +I ++  +    R    D
Sbjct: 264 QQAQDIFSFSLANEEVQKITQLGLQHPALRLYWTD 298

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  144 bits (364), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 148/281 (52%), Gaps = 35/281 (12%)

Query: 7   NSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI 66
           N     KLN G  IP +G G +    E+  + V SA+K GYRHID+A +Y N++   + +
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGV 67

Query: 67  R----DSGVPRNELFVTTKLWGTQ--QRNPEKALD--ASLKRLGLDYVDLYLIHWPIAFK 118
           R    ++G  R  ++ TTKLW +Q  +   EKAL   A+  +  + YVDL L+H P    
Sbjct: 68  RKYLDETGEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSPRGGA 127

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATG-KAKAVGVSNFSVNNLK 177
              ++                     W  ++  + VQE  +   + K++GVSNF V++L+
Sbjct: 128 KRRLE--------------------TWAILE--QAVQEPGSKALEIKSIGVSNFGVDHLE 165

Query: 178 ELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIE 237
           ELL     K+ P  +Q+ELHP LP+ EL ++ K K I  EAYSPL       L++P ++ 
Sbjct: 166 ELLKVA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPLTQGYR--LQDPELLA 221

Query: 238 VAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVF 278
           +  K G+  A +L+ W   +G+V+L KS NP+R+  N  V 
Sbjct: 222 LEAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNLAVL 262

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  143 bits (361), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 108/324 (33%), Positives = 160/324 (49%), Gaps = 60/324 (18%)

Query: 14  LNTGAIIPQLGL-----------GTWRSSDEEAYNSVLSAIKL-GYRHIDSAAIYGNEEP 61
           LN G  IP + +           G+  +  +E    +  A+ L G  HID+A  YG    
Sbjct: 10  LNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTYPE 69

Query: 62  VGKAIRDSGVPRNELFVTTKLWGTQQR---NPEKALDASLKRLGLDYVDLYLIHWPIAFK 118
           + KA+++S  PR+E+F+T K + TQ +   +P + L+  LK LGLDYVDLYLIH P    
Sbjct: 70  LAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSPFF-- 126

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKE 178
                D ++    T                K W+ ++ L   GKAK++GVSNFSV N++E
Sbjct: 127 -----DPEFKGSLTLE--------------KVWKDMETLYKEGKAKSIGVSNFSVKNIEE 167

Query: 179 LLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLKEP--- 233
           +L   G K  P  NQ+E +  L      ++ + +   I +EAYSPLG    PL K P   
Sbjct: 168 ILKIAGIK--PQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQKRPENS 221

Query: 234 -------VIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRV--ESNFKVFDLSKED 284
                   I E+A KYG   +Q+L+NW   RG + +  S   +R+    N   F+L+K++
Sbjct: 222 NELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDE 281

Query: 285 VDRIHKISKEQGVKRFVHPDWPSF 308
           VD + K+  EQ   R     W +F
Sbjct: 282 VDTLTKLGLEQPALRIY---WTNF 302

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  140 bits (353), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 104/323 (32%), Positives = 164/323 (50%), Gaps = 49/323 (15%)

Query: 11  TVKL-NTGAIIPQLGLGT---WR---SSDE-------EAYNSVLSAIKLGYRHIDSAAIY 56
           T++L  +G  IP +G G+   WR   +S E       E  + V SAI  G+ HID+A  Y
Sbjct: 7   TLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAY 66

Query: 57  GNEEPVGKAIRDSGVPRNELFVTTKL--WGTQQR---NPEKALDASLKRLGLDYVDLYLI 111
                VG+ +++SGVPR++L++T K   W    R    P ++L  SL+++ + YVDLYL+
Sbjct: 67  KTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLL 126

Query: 112 HWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNF 171
           H P            ++TV T             +  + W  ++E+   G AK +GVSNF
Sbjct: 127 HVP------------FITVQTAGI----------DLKEAWRQMEEIYDRGLAKNIGVSNF 164

Query: 172 SVNNLKELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLG--SNGS 227
            V +L E +   G K +P  NQ+E +  L Q    +I + K   IV+E YSPL   + G 
Sbjct: 165 DVESL-EYITKIG-KYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGR 222

Query: 228 PLLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD--LSKEDV 285
           P   + ++  +A+KY     Q+L+ W  Q G V++  S    RV+ +  +FD  L+ ED 
Sbjct: 223 PGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDF 282

Query: 286 DRIHKISKEQGVKRFVHPDWPSF 308
           D I KI +E+  + F+   +  +
Sbjct: 283 DSITKIGREKIFRGFMGEQYSKY 305

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  139 bits (350), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/309 (31%), Positives = 155/309 (50%), Gaps = 56/309 (18%)

Query: 15  NTGAIIPQLGLGT---WRSSDEEA----------YNSVLSAIKLGYRHIDSAAIYGNEEP 61
            T   IP LG GT   WR +  E            + +++A+ LG+ HID+A  Y   E 
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 62  VGKAIRDSGVPRNELFVTTKL----W-GTQQRNPEKALDASLKRLGLDYVDLYLIHWPIA 116
           VG+A+R S +PR++LF+T K     W G     P +A    L+ LG+ Y DLY++H P  
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRP-- 130

Query: 117 FKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNL 176
              D  K++  +                 +  + W  V+EL   G AKA+GVSNF +  L
Sbjct: 131 ---DITKENAGI-----------------DLQEAWRQVEELYEAGIAKAIGVSNFPLETL 170

Query: 177 KELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLK--- 231
           K++ +    + +P  +QVE HP L      ++E+ ++K IV+EAYSPL    +PL +   
Sbjct: 171 KQMESY--CRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----APLFRARP 224

Query: 232 ---EPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV--FDLSKEDVD 286
              + ++  + KKYG    Q+++ W I RG V L  S   +R+        F+L K DV+
Sbjct: 225 GPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVE 284

Query: 287 RIHKISKEQ 295
            I+++  ++
Sbjct: 285 LINEVGSKK 293

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  137 bits (344), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 151/307 (49%), Gaps = 58/307 (18%)

Query: 14  LNTGAIIPQ---LGLGT-WRSSDEEAYNSVLSAIKL--------GYRHIDSAAIYGNEEP 61
           LN G  IP    +G GT W   +E   N   + +K         G  H+D A +Y     
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 62  VGKAIRDSGVPRNELFVTTKLWGTQQR---NPEKALDASLKRLGLDYVDLYLIHWPIAFK 118
             +A++++  PRNE+FVT K +  Q++   +P + LD  LKR GL+YVDLYL+H P A K
Sbjct: 70  FSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFASK 128

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKE 178
             N                       +   + W  ++EL   GKAK +GVSNF V +L++
Sbjct: 129 EKN----------------------GFTIEEAWAQLEELYHEGKAKNIGVSNFRVEDLEK 166

Query: 179 LLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLKE---- 232
           +L     K+ P  NQ+E    L      +++FS+   I +EAY+PLG    PL K     
Sbjct: 167 ILKVA--KVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLG----PLSKRDESE 220

Query: 233 ------PVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVE--SNFKVFDLSKED 284
                   I ++ +KY    AQ+L+ W  +RG + +  S  PKR+E   N   FDL+K++
Sbjct: 221 QAKPFYDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDE 280

Query: 285 VDRIHKI 291
           VD I K+
Sbjct: 281 VDEITKL 287

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  135 bits (341), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 93/312 (29%), Positives = 154/312 (49%), Gaps = 50/312 (16%)

Query: 16  TGAIIPQLGLGT---WRSSDEEA----------YNSVLSAIKLGYRHIDSAAIYGNEEPV 62
           +G ++P +G G+   WR +               + V +AI+ G+ HID+A  Y   + V
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 63  GKAIRDSGVPRNELFVTTKL--WGTQQR---NPEKALDASLKRLGLDYVDLYLIHWP-IA 116
           G  I ++ VPR  L++T K   W  + R    P ++L  SLK + LDYVDLY+IH P I 
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIHVPNIT 133

Query: 117 FKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNL 176
            KT  I                       +  + W  ++E+     A+ +GVSNF V +L
Sbjct: 134 TKTAGI-----------------------DLKEAWLQMEEIYTRKMARNIGVSNFDVESL 170

Query: 177 KELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLG--SNGSPLLKE 232
           + + +    K  P  NQ+E    + Q    ++++ +   IV+E YSPL   + G P   +
Sbjct: 171 EYIKSFA--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPGPLD 228

Query: 233 PVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD--LSKEDVDRIHK 290
            ++  +A KYG    QVL+ W  Q G V++  +   +R+  +  +FD  LSKED D+I  
Sbjct: 229 EILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQITN 288

Query: 291 ISKEQGVKRFVH 302
           + +E+ ++ ++H
Sbjct: 289 VGREKILRNYMH 300

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  135 bits (340), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 102/317 (32%), Positives = 158/317 (49%), Gaps = 51/317 (16%)

Query: 11  TVKL-NTGAIIPQLGLGT---WRSSD----------EEAYNSVLSAIKLGYRHIDSAAIY 56
           TV+L  +G  +P +G G+   WR +           +E  + V +AIK G+ HID+A  Y
Sbjct: 7   TVELKGSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAY 66

Query: 57  GNEEPVGKAIRDSGVPRNELFVTTKL--WG---TQQRNPEKALDASLKRLGLDYVDLYLI 111
                VG  I +SGVPR +L+VT K   W     + + P ++L+ SL ++ + YVDLYL+
Sbjct: 67  KTHPEVGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLV 126

Query: 112 HWP-IAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSN 170
           H P I  +T  I                       +  + W  ++E+   G AK +GVSN
Sbjct: 127 HVPFINPETAGI-----------------------DLKEAWRQMEEIYDRGWAKNIGVSN 163

Query: 171 FSVNNLKELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLG--SNG 226
           F V +L E + + G K  P  NQ+E    + Q    +I + K  GI IE YSPL   + G
Sbjct: 164 FDVESL-EYIRTIG-KYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKG 221

Query: 227 SPLLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD--LSKED 284
            P   + ++  +AKKYG    Q+L+ W +Q G + +  S   KR++ +  +FD  LS ED
Sbjct: 222 KPGPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSED 281

Query: 285 VDRIHKISKEQGVKRFV 301
              I ++ K +  + F+
Sbjct: 282 FTSITEVGKTKIFRNFM 298

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  134 bits (337), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 97/307 (31%), Positives = 151/307 (49%), Gaps = 55/307 (17%)

Query: 13  KLNTGAIIPQL---GLGT-WR---SSDEEAYNSVLSAIKL-----GYRHIDSAAIYGNEE 60
           KLN G  +P +   G GT W     +DE    +++  +K      G  H+D+A  Y    
Sbjct: 8   KLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTYR 67

Query: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLGLDYVDLYLIHWPIAFK 118
            VG+A+ ++  PR+E+F+T K W   +   NP   L+  LKRLGL+YVDLYL+H P   K
Sbjct: 68  EVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPFISK 127

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKE 178
             N                       ++  + W +++EL  +GKAK +GVSNF+  +L+ 
Sbjct: 128 ETN----------------------GFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLER 165

Query: 179 LLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLKEPV-- 234
           +L     K+ P  NQ+E +  L      +  F K   I + AYSPLG    PL K+P   
Sbjct: 166 VLKVC--KVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPADG 219

Query: 235 --------IIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVD 286
                   I ++A+ Y   P QVL+ W  +RG V +  S   +R++   ++F+   +D D
Sbjct: 220 NSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKD-D 278

Query: 287 RIHKISK 293
            + +I+K
Sbjct: 279 EVTEITK 285

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  134 bits (336), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/313 (31%), Positives = 155/313 (49%), Gaps = 58/313 (18%)

Query: 12  VKLNTGAIIPQL---GLGTWRSSDEEA--------YNSVLSAIKL-GYRHIDSAAIYGNE 59
           + LN G  IP +   G GT    +EE            ++ A+KL G  HID+A IY   
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQ---QRNPEKALDASLKRLGLDYVDLYLIHWPIA 116
             VGKA+  +  PRNE+F+T K + TQ     +P   LD +LK++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPFV 126

Query: 117 FKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNL 176
            K  N                       +   + W+ +++L  +GKAK +GVSNF++ +L
Sbjct: 127 SKETN----------------------GFTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDL 164

Query: 177 KELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLKEPV 234
           + +L     ++ P  NQ+E  P L      + +F +   I++EAYSPLG    PL K   
Sbjct: 165 ERILKVA--EIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLG----PLQKRTT 218

Query: 235 ----------IIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVE--SNFKVFDLSK 282
                     + E+++KY    AQ+ + W  +RG + +  S  P+R+    N   FDL+ 
Sbjct: 219 KDESLPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTD 278

Query: 283 EDVDRIHKISKEQ 295
           E+V++I ++  E 
Sbjct: 279 EEVNQITELGLEH 291

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  132 bits (331), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 153/309 (49%), Gaps = 54/309 (17%)

Query: 14  LNTGAIIPQL---GLGTWRSSDEEA--------YNSVLSAIKL-GYRHIDSAAIYGNEEP 61
           LN G  IP +   G GT    +EE            ++ A+KL G  HID+A IY     
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPE 69

Query: 62  VGKAIRDSGVPRNELFVTTKLWGTQQR---NPEKALDASLKRLGLDYVDLYLIHWPIAFK 118
           VGKA+  +  PRN +F+T K +  Q +   +P   LD +LK++G DYVDLYL+H P   K
Sbjct: 70  VGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPFVSK 128

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKE 178
             N                        +  + W+ +++L  +GKAK +GVSNF+V +L+ 
Sbjct: 129 EVN----------------------GLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQR 166

Query: 179 LLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLG--------SNGSP 228
           +L     K  P  NQ+E  P L      + +F +   I++EAYSPLG         +  P
Sbjct: 167 ILKVAEVK--PQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQP 224

Query: 229 LLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVE--SNFKVFDLSKEDVD 286
             +   + E+++KY    AQ+++ W  +RG + +  S  P+R+    N   FDL+ E+VD
Sbjct: 225 FFE--YVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVD 282

Query: 287 RIHKISKEQ 295
           +I ++  E 
Sbjct: 283 KITELGLEH 291

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  131 bits (329), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 162/327 (49%), Gaps = 59/327 (18%)

Query: 14  LNTGAIIPQ---LGLGT-WRSSDEEA-------YNSVLSAIKL-GYRHIDSAAIYGNEEP 61
           LN G  IP    +G GT W  ++E A        + V  A+ L G  HID+A IY     
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 62  VGKAIRDSGVPRNELFVTTKLWGTQQR---NPEKALDASLKRLGLDYVDLYLIHWPIAFK 118
           +GKA+R++  PRNE+++T K + T  +   NP    +  LK LG+DY+DLYL+H P   +
Sbjct: 70  LGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSPFITE 128

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKE 178
             N                       +   + W+ ++EL  +GKAK +GVSNF+  +L+ 
Sbjct: 129 GRN----------------------GFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLER 166

Query: 179 LLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLKEP--- 233
           +L     ++ P  NQ+E    L      +  F+K   I++EAYSPLG    PL + P   
Sbjct: 167 ILKIA--EIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLG----PLQRRPEEA 220

Query: 234 -------VIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVE--SNFKVFDLSKED 284
                   I E+A+KYG   AQVL+ W  +RG + +  S  P RV    +   FDL+  +
Sbjct: 221 DSLPFYKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTE 280

Query: 285 VDRIHKIS-KEQGVKRFVHPDWPSFPI 310
           V++I ++  K + ++ +   ++  F +
Sbjct: 281 VEKITELGLKHEALRLYWVDEYSKFNV 307

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  130 bits (328), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 154/303 (50%), Gaps = 53/303 (17%)

Query: 14  LNTGAIIPQL---GLGT-WRSSDE-------EAYNSVLSAIKL-GYRHIDSAAIYGNEEP 61
           LN G  IP +   G GT W  ++E       +  + +  A+ L G  HID+A IY     
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 62  VGKAIRDSGVPRNELFVTTKLWGTQQR---NPEKALDASLKRLGLDYVDLYLIHWPIAFK 118
           V  A+R+S  PR+E+F+T K + TQ +   +P   L+ SLK LGLDYVDLYL+H P    
Sbjct: 70  VAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPF--- 125

Query: 119 TDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKE 178
              IK+   L                    + W+ +++L  +GKAK +GVSNF V +L++
Sbjct: 126 ---IKNGSTLE-------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDLEK 163

Query: 179 LLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGS----NGSPLLK- 231
           +L     K  P  NQ+E +  L      +++F K   I +EAY+PLG       +P  K 
Sbjct: 164 ILKIATIK--PQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKP 221

Query: 232 -EPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVE--SNFKVFDLSKEDVDRI 288
               I E++KKY    AQ+L+ W  +RG + +  S  P+R+    N   FDL   +VD+I
Sbjct: 222 FYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDKI 281

Query: 289 HKI 291
            ++
Sbjct: 282 TEL 284

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  130 bits (328), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 156/304 (51%), Gaps = 54/304 (17%)

Query: 14  LNTGAIIPQL---GLGT-WRSSDEEAYN---SVLSAIKL-----GYRHIDSAAIYGNEEP 61
           LN G  IP +   G GT W  ++E   N    ++  IK      G  H+D+A  Y   + 
Sbjct: 29  LNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQE 88

Query: 62  VGKAIRDSGVPRNELFVTTKLWGTQQRNPE--KALDASLKRLGLDYVDLYLIHWPIAFKT 119
           +G+A+R+S  PR+E+F+T K   T + +    +  ++ +K++G+DYVDLYLIH P+  K 
Sbjct: 89  LGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPLIEKE 148

Query: 120 DNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179
            N                           + W+ +++L   GKAK +GVSNF V +L+ +
Sbjct: 149 KN----------------------GVTLEEVWKDLEKLYEAGKAKNIGVSNFRVEDLQRI 186

Query: 180 LASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLKEP---- 233
           L     K+ P  NQ+E H  L      +++FS+   I +EAY+PLG    PL ++     
Sbjct: 187 LKVA--KVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLG----PLQRKQSDAG 240

Query: 234 ----VIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVES--NFKVFDLSKEDVDR 287
                + E+AKKYG   AQVL+ W  +R  + +  S  P+R+++  +   FDL+ E+V +
Sbjct: 241 DFYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKK 300

Query: 288 IHKI 291
           I ++
Sbjct: 301 ITEL 304

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  130 bits (326), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 155/307 (50%), Gaps = 54/307 (17%)

Query: 12  VKLNTGAIIPQL---GLGT-WR---SSDEEAYNS----VLSAIKL-GYRHIDSAAIYGNE 59
           + LN G  IP +   G GT W     +D    NS    ++ A++L G  HID+A IY   
Sbjct: 8   IVLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTY 67

Query: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQQR---NPEKALDASLKRLGLDYVDLYLIHWPIA 116
             VGKA+  +  PR+E+F+T K + TQ +   +P   L+ SLK++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSPFV 126

Query: 117 FKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNL 176
            K  N                       +   + W+ +++L   GKAK +GVSNF+V +L
Sbjct: 127 SKEAN----------------------GFTLEEAWKDMEQLYKAGKAKNIGVSNFAVKDL 164

Query: 177 KELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLG--------SNG 226
           +++L     K  P  NQ+E  P L      + +F +   I++EAYSPL          + 
Sbjct: 165 EKILKIAEVK--PQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDS 222

Query: 227 SPLLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVE--SNFKVFDLSKED 284
            P  +   + E+++KY    AQ+++ W  +RG + +  S  P+R+    N   FDL+ E+
Sbjct: 223 KPFFE--YVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEE 280

Query: 285 VDRIHKI 291
           VD I ++
Sbjct: 281 VDEITEL 287

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  129 bits (323), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/313 (31%), Positives = 151/313 (48%), Gaps = 57/313 (18%)

Query: 8   SSATVKLNTGAIIPQL---GLGT-WRSS-------DEEAYNSVLSAIKL-GYRHIDSAAI 55
           S     LN G  IP +   G GT W           +E  + +  A+ L G  HID+A +
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEM 63

Query: 56  YGNEEPVGKAIRDSGVPRNELFVTTKLWGTQQR---NPEKALDASLKRLGLDYVDLYLIH 112
           Y     V KA++ +   R+E+F+T K +    +   NP   L  SLK L LDYVDLYL+H
Sbjct: 64  YNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYLLH 123

Query: 113 WPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFS 172
            P   K                          +   + W+ +++L   GKAK +GVSNFS
Sbjct: 124 SPFITK----------------------ESCGYTMEEAWKQMEKLYKDGKAKNIGVSNFS 161

Query: 173 VNNLKELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLL 230
           V++LK +L     ++ P  NQ+E +  L      +++F +   I++EAYSPLG    PL 
Sbjct: 162 VDDLKRILKI--CEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLG----PLR 215

Query: 231 KEPV----------IIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVE--SNFKVF 278
           K+P           I E+AKKYG    QVL+ W  +R  + +  S   +R++   +   F
Sbjct: 216 KKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSF 275

Query: 279 DLSKEDVDRIHKI 291
           DL+ E+V++I K+
Sbjct: 276 DLTSEEVEKITKL 288

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  124 bits (311), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 152/309 (49%), Gaps = 60/309 (19%)

Query: 14  LNTGAIIPQL---GLGT-WRSSDE-------EAYNSVLSAIKL-GYRHIDSAAIYGNEEP 61
           LN G  +P +   G GT W  ++E       E  + +  A+ L G  HID+A +Y     
Sbjct: 11  LNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYPE 70

Query: 62  VGKAIRDSG--VPRNELFVTTKLWGTQQR---NPEKALDASLKRLGLDYVDLYLIHWPIA 116
           VGKA+R+S    PR+E+F+T K + TQ +   NP   L   LK+LGLDYVDLYL+H P  
Sbjct: 71  VGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSPFI 129

Query: 117 FKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNL 176
            K  N                       +   + W+ +++L   GK K +GVSNFS+ +L
Sbjct: 130 SKEKN----------------------GFTMEEAWKYMEDLYKAGKVKNIGVSNFSMADL 167

Query: 177 KELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLKEP- 233
           + +L S   K  P  NQ+E +  L      ++ F +   I + AY+PLG    PL ++  
Sbjct: 168 QRILKSCEVK--PQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPLG----PLQRKSK 221

Query: 234 ---------VIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESN--FKVFDLSK 282
                     + ++A+KY    AQ+L+ W  +RG + +  S   KR++       FDL+ 
Sbjct: 222 NFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTD 281

Query: 283 EDVDRIHKI 291
            +V++I ++
Sbjct: 282 SEVEKITQL 290

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  124 bits (310), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/322 (31%), Positives = 158/322 (49%), Gaps = 64/322 (19%)

Query: 13  KLNTGAIIPQLGLGTWRSSDEEAY---NSVLSAIKL-----GYRHIDSAAIYGNEEPVGK 64
           K+   AII   G GT   ++ +A+   N ++   K      G  H+D+A  Y     + K
Sbjct: 15  KIRAVAII---GTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYPELNK 71

Query: 65  AIRDSGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122
           A+++S  PRNE+F+T K     +   NP +AL+ +L  LGLDYVDLY++H+P        
Sbjct: 72  ALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVLHFPEF------ 125

Query: 123 KDDDY--LTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180
            D +Y  L++ T                  W  ++ L   GKAK +GVSNFS+ +L+ ++
Sbjct: 126 -DPEYKDLSIET-----------------AW--MELLYKEGKAKNIGVSNFSIEHLERVM 165

Query: 181 ASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLKEP----- 233
                K  P  NQ+E +  L      ++++ +  G  +EAYSPL    +PL ++P     
Sbjct: 166 KIADVK--PQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPL----APLQRKPKNFNE 219

Query: 234 -----VIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRV--ESNFKVFDLSKEDVD 286
                 I EV+ KYG   +++L+ W  +RG V +  S   +R+    N   FDL+ E+VD
Sbjct: 220 LPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTDEEVD 279

Query: 287 RIHKISKEQGVKRFVHPDWPSF 308
           +I K+  EQ   R     W  F
Sbjct: 280 KITKLGLEQPALRLY---WNEF 298

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  121 bits (303), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 96/313 (30%), Positives = 148/313 (47%), Gaps = 52/313 (16%)

Query: 5   LKNSSATVKLNTGAIIPQ---LGLGT-WRSSDE-------EAYNSVLSAIKL-GYRHIDS 52
           + ++ A V LN G  +P    +G GT W    E       E    +  A+ L G  HID+
Sbjct: 1   MSHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDA 60

Query: 53  AAIYGNEEPVGKAIRDSGVPRNELFVTTK--LWGTQQRNPEKALDASLKRLGLDYVDLYL 110
           A +YG    +  A+R +  PR+E+F+T K  L     ++P   L+ SLK   LDYVDLYL
Sbjct: 61  AEMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYL 120

Query: 111 IHWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSN 170
           +H P        K+   LT+                    W  +++L   GKAK +GVSN
Sbjct: 121 LHSPFV-----AKEKPGLTLEG-----------------AWRQMEQLYKDGKAKNIGVSN 158

Query: 171 FSVNNLKELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPLG----- 223
           FSV +LK +L+    ++ P  NQ+E HP L      +++F + + I +EA++PLG     
Sbjct: 159 FSVEDLKRVLSVA--EIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVK 216

Query: 224 ---SNGSPLLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRV--ESNFKVF 278
                     K   I  ++ KY    AQ+++ W  +RG + +  S    R+    N   F
Sbjct: 217 TQEDENDEFFK--YISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEF 274

Query: 279 DLSKEDVDRIHKI 291
           DL  E+V +I ++
Sbjct: 275 DLEDEEVTKITRL 287

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  119 bits (298), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 90/314 (28%), Positives = 160/314 (50%), Gaps = 48/314 (15%)

Query: 8   SSATVKLNTGAIIPQL---GLGT--WRSSDEEAYNSVL-----SAIKL-GYRHIDSAAIY 56
            ++ + LN G  IP +   G GT  ++ + E+ Y+  L     +A++L G  HID A +Y
Sbjct: 4   QTSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMY 63

Query: 57  GNEEPVGKAIRDSGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLGLDYVDLYLIHWP 114
                VG+A+R+S  PR+E+F+T K    ++   NP++ L  +L+++GL+YVDLYL+H+P
Sbjct: 64  QTHAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFP 123

Query: 115 IAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVN 174
           I                             +   + W+++++L   G AK +GVSNF V 
Sbjct: 124 II----------------------DPKLYDFTLEEAWKMMEDLYNEGLAKNIGVSNFRVE 161

Query: 175 NLKELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYSPL----GSNGSP 228
           +L++L  S    + P  NQ+E +  L      + ++     I +EA+ PL      N   
Sbjct: 162 DLEQL--SKSWVIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKD 219

Query: 229 LLKEPVII-EVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKV--FDLSKEDV 285
           LL  P+ + ++A+KY     Q+++ W  QR  + +  S  P+RV   + +  F+L++++V
Sbjct: 220 LL--PLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDEV 277

Query: 286 DRIHKISKEQGVKR 299
           + I K+  +    R
Sbjct: 278 EFITKLGSQHDTIR 291

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  105 bits (262), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 134/269 (49%), Gaps = 43/269 (15%)

Query: 46  GYRHIDSAAIYGNEEPVGKAIRDSGVPRNELFVTTKLWGTQQR---NPEKALDASLKRLG 102
           G+ HI +A  Y N   +  A++ S  PR+E+++T K + +Q +   +P +AL+ SL RLG
Sbjct: 54  GFLHIMTAEFYPNNGLLSAALKASQKPRHEIWITDK-YCSQCKLSSSPIEALERSLDRLG 112

Query: 103 LDYVDLYLIHWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGK 162
            DYVDLYLIH P    + N                        +  K W+ ++ L  TGK
Sbjct: 113 FDYVDLYLIHNPCLDSSPN----------------------GISLEKAWKQMELLYKTGK 150

Query: 163 AKAVGVSNFSVNNLKELLASPGNKLVPACNQVELHPLLPQD--ELIEFSKSKGIVIEAYS 220
            K +GVSNF + +L+ L  +   ++ P  N++E H  L      + E++K+  +++  YS
Sbjct: 151 VKNIGVSNFRIEDLERLKDA---EIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYS 207

Query: 221 ---PLGSNGSPLLKEPV---IIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPK----R 270
              PL +     +  P    II +A+KY    AQ+L++W    G  +LP   N K    +
Sbjct: 208 PLFPLETKTEDFMDFPFYRYIIGLAEKYNKTEAQILLHWMNCLG--VLPVITNTKVKWYK 265

Query: 271 VESNFKVFDLSKEDVDRIHKISKEQGVKR 299
             S+   F+L+ E++D I ++ K+    R
Sbjct: 266 EASDIISFELTSEELDMITELGKKHKPHR 294

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 66.2 bits (160), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 4/84 (4%)

Query: 7  NSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI 66
          N     KLN G  IP +G G +    E+  + V SA+K GYRHID+A +Y N++   + +
Sbjct: 8  NRETRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGV 67

Query: 67 R----DSGVPRNELFVTTKLWGTQ 86
          R    ++G  R  ++ TTKLW +Q
Sbjct: 68 RKYLDETGEARENIWFTTKLWDSQ 91

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 79/182 (43%), Gaps = 30/182 (16%)

Query: 46  GYRHIDSAAIYGNEEP-VGKAIRDSGVPRNELFVTTKLWGTQQRNPEKAL--DASLKRLG 102
           G   I ++ IY    P VG+A+  +  P+ E+F+T K     + +   A+  D +LK++ 
Sbjct: 5   GVIDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKIS 64

Query: 103 LDYVDLYLIHWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGK 162
           ++YVD++ +H P  FK  N+ +                       +K       L  + K
Sbjct: 65  VEYVDMHFLHSPFVFKQANVLN-----------------------LKDAMHTDHLRRSNK 101

Query: 163 AKAVGVSNFSVNNLKELLASPGNKLVPACNQVELHPLLPQDE--LIEFSKSKGIVIEAYS 220
           A   G S+ +V  L+ +L +   +  P  NQ++L   L      + +  +   I++  YS
Sbjct: 102 ANNRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYS 159

Query: 221 PL 222
            L
Sbjct: 160 TL 161

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 86/196 (43%), Gaps = 40/196 (20%)

Query: 37  NSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRDSGVPRNELFVTTKLWG-----TQQRNPE 91
           N +++ +K G + ID+A IY + E   KAI +  +P +   + TK  G       + N  
Sbjct: 19  NEIVTVLKAGVKDIDTARIYPDNE---KAIGELQLP-DRFTIHTKASGFSGGCLTRDNIN 74

Query: 92  KALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTW 151
           K+++ SL  LG+  V+ +L+H P         D +   +P                 +T 
Sbjct: 75  KSIEESLSLLGVPSVETFLLHSP---------DPE---IPLE---------------ETL 107

Query: 152 ELVQELPATGKAKAVGVSNFSVNNLKEL--LASPGNKLVPACNQVELHPLLPQ--DELIE 207
           + +  L   GK +  G+SNFS  ++K +   A   + ++P   Q   + L     ++L  
Sbjct: 108 DAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNALSRAIVNDLFP 167

Query: 208 FSKSKGIVIEAYSPLG 223
             K   I + AYSP+ 
Sbjct: 168 LLKELHISLYAYSPIA 183

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 42  AIKLGYRHIDSAAIYGNEEP-VGKAIRDSG--VPRNELFVTTKL-------WGTQQRNPE 91
           A + G   ID++  YGN E  +GKA+ + G   PR+   + TK+       +     N  
Sbjct: 33  AFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNVR 92

Query: 92  KALDASLKRLGLDYVDLYLIH 112
           +++  S KRL  DY+DL  +H
Sbjct: 93  RSVVRSCKRLNSDYLDLVYLH 113

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 62/296 (20%), Positives = 127/296 (42%), Gaps = 63/296 (21%)

Query: 47  YRHIDSAAIYGNEEP-VGKAIRDSGVPRNELFVTTKL-------WGTQQRNPEKALDASL 98
           +  +D++  YG+ E  VG+A+R+  +PR E++V TK+       +   + N   ++  S+
Sbjct: 41  FNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSEFDYSRENVRMSVMRSV 100

Query: 99  KRLGLD--YVDLYLIHWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQE 156
           +RL  +  Y+D+  +H  + F+                             +   + +Q+
Sbjct: 101 ERLVGEGGYLDVVYLH-DVEFQPQEA------------------------CLAALDELQK 135

Query: 157 LPATGKAKAVGVSNFSVNNLKELLA------SPGNKLVPACNQVELHPLLPQDELIEFSK 210
           L   G  + VGVS + ++ L  L++      +P + ++  C+ + L  ++ ++   +F K
Sbjct: 136 LKRAGIVRNVGVSGYPLSKLYSLVSLCYDAGTPLDCVLSYCH-MNLQNVMLEEYYAKF-K 193

Query: 211 SKGI--VIEA----YSPLGSN-------GSPLLKEPV--IIEVAKKYGVEPAQVLINWGI 255
           SKG+  V+ A     S L S        GSP LK        +    GVE A +   + +
Sbjct: 194 SKGVQHVVNASVLSMSLLRSQKTLEFHPGSPELKRRAQQAATLCSSQGVELADLATQFAL 253

Query: 256 Q----RGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPDWPS 307
           +    RG  ++  S   +   +   + + + E  D +H + +   +    + +WPS
Sbjct: 254 EQWSDRGPTVIGFSTPEEVTRAASNLAETTAEHTDLVHSV-QHSVLGDLFNTEWPS 308

>TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.604
           YMR041C
          Length = 340

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 18/111 (16%)

Query: 20  IPQLGLG--TWRSSDEEAYNSV--LSAIKLGYRH----IDSAAIYGNEEPV-GKAIRDSG 70
           +P L LG  T  S   +  NS+     I+  +R+    ID++  YG+ E + GKA++   
Sbjct: 20  LPNLILGGATLSSQYNDDPNSIPIADMIRFAFRNGITAIDTSPYYGDSEIIYGKALKSIK 79

Query: 71  V--PRNELFVTTKL-------WGTQQRNPEKALDASLKRLGLDYVDLYLIH 112
           +  PR+  F+ TK+       +     N  K++  S KRL  +Y+D+  +H
Sbjct: 80  IEFPRDTYFICTKVGRIGSNEFDYSANNVRKSILRSCKRLNTNYLDVVYLH 130

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 63/148 (42%), Gaps = 41/148 (27%)

Query: 42  AIKLGYRHIDSAAIYGNEEPV-GKAIRD--SGVPRNELFVTTKL-------WGTQQRNPE 91
           A+  G   ID++  YG  E + GKA+++     PR E F+ TK+       +   + N  
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 92  KALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTW 151
            ++  S +RL  DY+DL  +H           D +Y+                  + K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH-----------DIEYV-----------------EYDKIW 141

Query: 152 ELVQELPA---TGKAKAVGVSNFSVNNL 176
           E ++EL      G  + +G+S + V+ L
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL 169

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 42  AIKLGYRHIDSAAIYGNEEPV-GKAIRD--SGVPRNELFVTTKL-------WGTQQRNPE 91
           A++ G R ID++  YG+ E + GKA+      +PR   F+ TK+       +   + +  
Sbjct: 52  AVQHGIRAIDTSPYYGDSEKLFGKALESLKDEIPRENYFICTKVGRIRLDEFDYSREHVR 111

Query: 92  KALDASLKRLGLDYVDLYLIH 112
            ++  S +RL  DY+D+  +H
Sbjct: 112 SSVLRSCERLRTDYLDVVFLH 132

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 92/255 (36%), Gaps = 68/255 (26%)

Query: 23  LGLGTW----RSSDEEAYNSVLSAIKLGYRHIDSAAIYGN---EEPVGKAIRDSGVPRNE 75
            G  TW    +   EEA+  +  A   G R  D+A +Y N   E  +G+ +R   +PR  
Sbjct: 26  FGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEIILGEFLRKYNIPRET 85

Query: 76  LFVTTKLWGTQQRN---------PEKALD-----------------ASLKRLGLDYVDLY 109
           + + TKL      N         PE  L+                 AS+KRLG  Y+D+ 
Sbjct: 86  VVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSSRASVKRLG-TYIDIL 144

Query: 110 LIHWPIAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVS 169
            IH           D D    P               F +T   + ++   G  + VG S
Sbjct: 145 QIHRG---------DPD---TP---------------FEETMGALNDVVIEGLTRYVGAS 177

Query: 170 NFSVNNLKEL--LASPGNKLVPACNQVELHPLLPQD--ELIEFSKSKGIVIEAYSPLGSN 225
                   E+  +A          +Q   H +  +D  ELI F+K   I +  +SPL   
Sbjct: 178 LMLATEFAEMQFVAEKHGWFKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPLNRG 237

Query: 226 GSPLLKEPVIIEVAK 240
              LL  P+  E  +
Sbjct: 238 ---LLCRPLGTETTR 249

>Kwal_26.9322 s26 complement(1163928..1164923) [996 bp, 331 aa] {ON}
           YPR127W - Hypothetical ORF [contig 72] FULL
          Length = 331

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 259 YVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKE 294
           ++ +P   + KRVE NFKVF+LS E++ +++   KE
Sbjct: 285 FIPIPGGSSAKRVEQNFKVFELSPEELTKVNDFLKE 320

>TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON} 
          Length = 345

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 65/307 (21%), Positives = 111/307 (36%), Gaps = 90/307 (29%)

Query: 28  WRSSD-EEAYNSVLSAIKLGYRHIDSAAIYGN---EEPVGKAIRDSGVPRNELFVTTKLW 83
           W  SD EE +  +      G R  D+A  Y N   E+ +G+ ++   + R  + + +KL+
Sbjct: 34  WIVSDKEEVFRLLKYCYDKGLRTYDTANTYSNGVSEQLLGEFLKRYNIRRETVVIMSKLF 93

Query: 84  -----------------------------GTQQRNPEKALDASLKRLGLDYVDLYLIHWP 114
                                        G  +RN  ++   S++RLG  Y+D+  IH  
Sbjct: 94  FPADDSLPDFQLTNGFKDEEEKLHLINQFGLNRRNVIESAKQSVERLGT-YMDVLQIH-- 150

Query: 115 IAFKTDNIKDDDYLTVPTXXXXXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVN 174
              + D          P               F +T   + ++   G  K +G S     
Sbjct: 151 ---RCDR-------ETP---------------FEETMRALNDVVNAGYTKYIGASLMRAT 185

Query: 175 NLKEL-LASPGNKLVPACNQVELHPLLPQD---ELIEFSKSKGIVIEAYSPLGSNGSPLL 230
              E+   +  +      N   LH L+ ++   ELI F+K  GI +  YSPL        
Sbjct: 186 EFAEMQFIAEKHDWHKFVNVQSLHNLIYREDERELIPFTKKHGIALTPYSPLQKG----- 240

Query: 231 KEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHK 290
                  +AK YG +  +   +  + R  +             N +  D  KE + R+ K
Sbjct: 241 ------YLAKPYGTKTVRNTTDKHMLRIKI------------DNMR--DSDKEIISRVEK 280

Query: 291 ISKEQGV 297
           +SK++ V
Sbjct: 281 VSKDKKV 287

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 88/218 (40%), Gaps = 44/218 (20%)

Query: 25  LGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRDSGVPRNELFVTTKLWG 84
           L   + SD +  +++L   K G + ID+A IY + E   K I +  +P N   + TK  G
Sbjct: 14  LNLLQRSDIDEISAILE--KAGVKDIDTARIYPDSE---KIIGELQLP-NRFTIHTKASG 67

Query: 85  -----TQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDYLTVPTXXXXXXX 139
                  + N  K+++ SL  LG+  V+ + +H P         D +    P        
Sbjct: 68  FSGGCLTKDNINKSIEESLSLLGVPSVETFFLHSP---------DPE---TPIE------ 109

Query: 140 XXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL--LASPGNKLVPACNQVELH 197
                    +T   +  L   GK K  G+SNF+  ++K +   A   N ++P   Q   +
Sbjct: 110 ---------ETLGAINSLYEQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYN 160

Query: 198 PL--LPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEP 233
                 +++L    +       AYSP+   G  L K P
Sbjct: 161 AFSRAIENDLFPLLRELHFSFYAYSPIA--GGFLAKTP 196

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 32/110 (29%)

Query: 34  EAYNSVLSAIKLGYRHIDSAAIYGNEEP---VGKAIRDSGVPRNELFVTTKLW------- 83
           E +  + +A   G R  D+A  Y N +    +G+ +++  +PR  + + TK+W       
Sbjct: 41  EVFKILKTAYDSGLRTFDTADGYSNGQSEILLGEFLKEYEIPRETVIIMTKVWAPVDSSL 100

Query: 84  -GTQQRNPE--------------------KALDASLKRLGLDYVDLYLIH 112
            G Q+  P                     +A   S++RLG  Y+D+Y IH
Sbjct: 101 EGFQRTGPMNEDQKVHFANQQGLSRKHIIEACKNSVRRLG-TYIDVYQIH 149

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 12/78 (15%)

Query: 46  GYRHIDSAAIYGNEEPV-GKA---IRDSGVPRNELFVTTKLWGTQ-------QRNPEKAL 94
           G R ID++  YG  E + G+A   IRD   PRN  ++ TK+   Q       + +   ++
Sbjct: 53  GIRAIDTSPYYGPSEILYGQALEHIRDE-FPRNSYYICTKVGRIQLDEFDYSREHVRFSV 111

Query: 95  DASLKRLGLDYVDLYLIH 112
             S +RL  DY+DL  +H
Sbjct: 112 LRSCQRLKTDYLDLVYLH 129

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 46/113 (40%), Gaps = 34/113 (30%)

Query: 33  EEAYNSVLSAIKLGYRHIDSAAIYGN---EEPVGKAIRDSGVPRNELFVTTKLW------ 83
           E+AY  +  A   G R  D+A  Y N   E  +G  ++   +PR  + + TK++      
Sbjct: 40  EDAYKILKYAYDRGIRTFDTADAYANGLSETILGSFLKHYNIPRETVVIMTKVFYRVDDT 99

Query: 84  ------------------------GTQQRNPEKALDASLKRLGLDYVDLYLIH 112
                                   G  +++  +A   S++RLG  Y+D+Y IH
Sbjct: 100 IELNPTDLLFGNNEELNLRLVNQKGLSRKHILEAAKNSVRRLG-TYIDVYQIH 151

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 34/122 (27%)

Query: 24  GLGTWRSSDEE-AYNSVLSAIKLGYRHIDSAAIYGNEEP----VGKAIRDSGVPRNELFV 78
           G   W   D++ +Y  +  A  LG R  D+A +Y N +     +G+ +++  + R  + +
Sbjct: 7   GWHKWVIDDKQKSYKILKRAYDLGLRTYDTADLYSNGQSEIIILGEFLKEYNISRETVVI 66

Query: 79  TTKLW----------------------------GTQQRNPEKALDASLKRLGLDYVDLYL 110
            TKL+                            G  +++  +A   SL+RLG  Y+D+Y 
Sbjct: 67  MTKLFAPVDDTLPDYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLGT-YIDVYQ 125

Query: 111 IH 112
           +H
Sbjct: 126 VH 127

>TPHA0I00880 Chr9 complement(193539..195608) [2070 bp, 689 aa] {ON}
           Anc_1.265 YJL101C
          Length = 689

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 15  NTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRDSGVPRN 74
           +T +++PQ  +G   +  ++ YN V S  K  Y H+D     G  +   +   D+ VP N
Sbjct: 342 DTESVLPQYNIGGLGNIAKDKYNKVQSLPKARYSHVD--LFLGGNKFFKRTFNDTNVPLN 399

Query: 75  E 75
           E
Sbjct: 400 E 400

>Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig
           119] FULL
          Length = 67

 Score = 29.6 bits (65), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 253 WGIQRGYVILPKSVNPKRVESNFKVFDLSKED 284
           W   +G+V+L KS NP+R+  N  V   SK+D
Sbjct: 2   WSFLQGFVVLVKSSNPERIRQNLAVLP-SKDD 32

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 47/101 (46%), Gaps = 21/101 (20%)

Query: 33  EEAYNSVLSAIKLGYRHIDSAAIYGNEEP---VGKAIRDSGVPRNELFVTTKL------- 82
           E+A+  + +  + G   ID+A  Y NEE    +G+ +    + R+++ + TK        
Sbjct: 53  EQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL-RDQIVIATKFTGDYKKY 111

Query: 83  ----------WGTQQRNPEKALDASLKRLGLDYVDLYLIHW 113
                      G  +R+   ++  SL++L  D++D+  IHW
Sbjct: 112 EVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 62/315 (19%), Positives = 116/315 (36%), Gaps = 98/315 (31%)

Query: 46  GYRHIDSAAIYGN---EEPVGKAIRDSGVPRNELFVTTKLW------------------- 83
           G R  D+A +Y N   E  +G+ ++   + R  + + TK++                   
Sbjct: 55  GMRTFDTADVYSNGLSERILGEFLKHYKIKRETVVILTKVYYPVDESLKLTHSAKISESD 114

Query: 84  --------GTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDYLTVPTXXX 135
                   G  +++  +A   S++RLG  Y+D+  IH     + D+         P    
Sbjct: 115 MLGLVNQTGLSRKHILEAAKNSVERLG-TYIDVLQIH-----RLDH-------DTPME-- 159

Query: 136 XXXXXXXXXWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL--LASPGNKLVPACNQ 193
                        +  + + ++   G  + +G S+       EL  +A   +     C+Q
Sbjct: 160 -------------EIMKALNDVVGLGYTRYIGASSMLATEFAELQFIAEKHDWTKFICSQ 206

Query: 194 VELHPLLPQDE--LIEFSKSKGIVIEAYSPLGSNGSPLLKEPV----------------- 234
                L  +DE  LI F+K  GI +  +SP   N   +L  P+                 
Sbjct: 207 SCYSLLYREDERELIPFAKKHGIGLIPWSP---NARGVLTRPLNQETDRKISDPTLKRLK 263

Query: 235 --------------IIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD- 279
                         + EVAKK G+  A V I W + +G   +    + +RV+   +  D 
Sbjct: 264 FDCLESHEKRIVNRVEEVAKKKGISMAMVSIAWVLSKGACPIVGLNSIERVDEAIRAVDV 323

Query: 280 -LSKEDVDRIHKISK 293
            L++E++  + ++ K
Sbjct: 324 QLTEEEIQYLEELYK 338

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 19/102 (18%)

Query: 31  SDEEAYNSVLSAIKLGYRHIDSAAIYGNEEP--------VGKAIRDSGVPRNELFVTTKL 82
           S E A+  + +  + G   ID+A  Y NE+         V + +RD  V   +     K 
Sbjct: 51  SKERAFELLDAFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKLRDQIVIATKFTTDYKK 110

Query: 83  W-----------GTQQRNPEKALDASLKRLGLDYVDLYLIHW 113
           +           G  +R+   ++  SL++L  D++D+  +HW
Sbjct: 111 YDVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 49/101 (48%), Gaps = 21/101 (20%)

Query: 33  EEAYNSVLSAIKLGYRHIDSAAIYGNEEP---VGKAIRDSGVPRNELFVTTKLWGTQQR- 88
           E+A+  + +  + G   ID+A  Y NEE    +G+ ++   + R+++ + TK  G  ++ 
Sbjct: 7   EQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKKY 65

Query: 89  ------------NPEKALDAS----LKRLGLDYVDLYLIHW 113
                       N + +L  S    L++L  D++D+  +HW
Sbjct: 66  EVGGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>KLTH0A06908g Chr1 complement(575902..577665) [1764 bp, 587 aa] {ON}
           conserved hypothetical protein
          Length = 587

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 222 LGSNGSPLLKEPVIIEVAKKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLS 281
            G+N   +  +P+II  +  Y +    +L++ G+    ++LPK++   R + N    DLS
Sbjct: 187 FGTNRGIVDLKPLIISFSHLYSLSYTLILLSMGL----ILLPKALLTNRTDENKLFVDLS 242

Query: 282 KED 284
           K +
Sbjct: 243 KSN 245

>NDAI0G04440 Chr7 complement(1060016..1065142) [5127 bp, 1708 aa]
           {ON} Anc_2.653 YKL014C
          Length = 1708

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 17/114 (14%)

Query: 28  WRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRDS--GVPRNE--------LF 77
           W+  DE    ++   IK  Y+++D +  Y +  P   A+ +    VPRN         +F
Sbjct: 655 WKLLDE----TIARCIKTPYKYVDISNEYDSISPFITALLEQWKFVPRNTSTDDIVKFIF 710

Query: 78  VTTK---LWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDDYL 128
           +  +   + G      ++A  A LK +  +Y DLYL       K + +  D YL
Sbjct: 711 IFLRNMSIIGESHDGIKRAATALLKDVDNNYFDLYLDFHNTEKKIEELNKDSYL 764

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 31/159 (19%), Positives = 62/159 (38%), Gaps = 32/159 (20%)

Query: 154 VQELPATGKAKAVGVSNFSVNNLKEL-LASPGNKLVPACNQVELHPLL---PQDELIEFS 209
           + ++  +G+ + +G S+       EL   +  N      N    + +L    ++ELI F 
Sbjct: 164 LNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVLNREDENELIPFC 223

Query: 210 KSKGIVIEAYSP---------LGSNGSPLLKEPVIIE-------------------VAKK 241
           K  G+ +  +SP             G+ +L +P  I+                   +AKK
Sbjct: 224 KKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDKEIIGVVEAIAKK 283

Query: 242 YGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDL 280
            G+  A V + W + +G   +    + +RV+   +  D+
Sbjct: 284 KGISMAMVSMAWILNKGANAIAGLNSIERVDEAIRAIDV 322

>NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.76
           YGR250C
          Length = 940

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 15/73 (20%)

Query: 151 WELVQELPATGKAKAVGVSNFSVNNLKELLASPGNKLVPACNQV---------------E 195
           W  ++E    GK K + + NF +NN+K+      NK     N+                E
Sbjct: 291 WNQLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEFNYRITPEIIIEKIKSE 350

Query: 196 LHPLLPQDELIEF 208
           L PL+P  E++ +
Sbjct: 351 LLPLIPDFEILSY 363

>TDEL0E01080 Chr5 (220366..222216) [1851 bp, 616 aa] {ON} Anc_4.262
           YLR399C
          Length = 616

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 11/76 (14%)

Query: 162 KAKAVGVSNFSVNNLKELLASPGN-----KLVPACNQVELHPLLPQDELIEFSKSKGIVI 216
           +A  +   N   N ++  L+ P N     +   A +Q E      Q+  IE  K+K  ++
Sbjct: 523 QAHDMNGQNGHTNGIEHSLSPPTNGSTKKRRSKALSQEE------QNRQIEKIKNKLALL 576

Query: 217 EAYSPLGSNGSPLLKE 232
           +  SP+ SNGSPL+++
Sbjct: 577 DGASPISSNGSPLMQQ 592

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 47/101 (46%), Gaps = 21/101 (20%)

Query: 33  EEAYNSVLSAIKLGYRHIDSAAIYGNEEP---VGKAIRDSGVPRNELFVTTKL-----W- 83
           E A+  + +  + G   ID+A  Y NE+    +G+ + +S   R+++ + TK      W 
Sbjct: 53  ERAFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWM-ESRKLRDQIVIATKFSTDYKWY 111

Query: 84  -----------GTQQRNPEKALDASLKRLGLDYVDLYLIHW 113
                      G  + +   ++  SL++L  D++D+  IHW
Sbjct: 112 DVGKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,057,616
Number of extensions: 1437298
Number of successful extensions: 3258
Number of sequences better than 10.0: 149
Number of HSP's gapped: 3010
Number of HSP's successfully gapped: 182
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)