Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02508g5.433ON22822811331e-159
CAGL0A02794g5.433ON2162236152e-80
YDR367W (KEI1)5.433ON2212256083e-79
Suva_2.5395.433ON2272256083e-79
Smik_4.6335.433ON2212256022e-78
KAFR0E039305.433ON2112205986e-78
Skud_4.6365.433ON2342215754e-74
NCAS0F033705.433ON2112255725e-74
TDEL0E019205.433ON2202275719e-74
Kwal_55.214325.433ON2072085594e-72
KNAG0C049205.433ON2172205552e-71
KLLA0E21099g5.433ON2242285406e-69
AER256C5.433ON2392265303e-67
Ecym_47625.433ON2212225153e-65
TPHA0E017705.433ON2172205111e-64
Kpol_1062.305.433ON2142264936e-62
ZYRO0F10010g5.433ON2082224832e-60
KLTH0F16082g5.433ON2062084726e-59
TBLA0A065205.433ON2062204213e-51
NDAI0B056605.433ON1611564087e-50
TBLA0G020105.433ON2132093953e-47
NDAI0G004901.451ON60659711.2
KNAG0F027205.267ON1872108711.4
NDAI0A028907.309ON90868692.8
NCAS0A138807.309ON79872674.3
Suva_4.1067.309ON76872665.4
CAGL0I03872g7.309ON76272665.6
Skud_13.2422.476ON97256657.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02508g
         (228 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   441   e-159
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   241   2e-80
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   238   3e-79
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   238   3e-79
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   236   2e-78
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   234   6e-78
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   226   4e-74
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   224   5e-74
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   224   9e-74
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   219   4e-72
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   218   2e-71
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   212   6e-69
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   208   3e-67
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   202   3e-65
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   201   1e-64
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   194   6e-62
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   190   2e-60
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   186   6e-59
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   166   3e-51
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   161   7e-50
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   156   3e-47
NDAI0G00490 Chr7 complement(102674..104494) [1821 bp, 606 aa] {O...    32   1.2  
KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {...    32   1.4  
NDAI0A02890 Chr1 (648510..651236) [2727 bp, 908 aa] {ON}               31   2.8  
NCAS0A13880 Chr1 complement(2723605..2726001) [2397 bp, 798 aa] ...    30   4.3  
Suva_4.106 Chr4 (201617..203923) [2307 bp, 768 aa] {ON} YDL138W ...    30   5.4  
CAGL0I03872g Chr9 (337985..340273) [2289 bp, 762 aa] {ON} some s...    30   5.6  
Skud_13.242 Chr13 (413093..416011) [2919 bp, 972 aa] {ON} YMR086...    30   7.3  

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  441 bits (1133), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 213/228 (93%)

Query: 1   MTKAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXX 60
           MTKAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCF   
Sbjct: 1   MTKAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSL 60

Query: 61  XXXXXXXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGA 120
                       WQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGA
Sbjct: 61  SVLTLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGA 120

Query: 121 VGTSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAA 180
           VGTSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAA
Sbjct: 121 VGTSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAA 180

Query: 181 FVQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           FVQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA
Sbjct: 181 FVQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  241 bits (615), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 122/223 (54%), Positives = 150/223 (67%), Gaps = 15/223 (6%)

Query: 7   VHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXX 66
           +  PKSF GFLPLY+GVE+ LGI+I NK SG YGILALFTGHPLD+MQW           
Sbjct: 6   ISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLI 65

Query: 67  XXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWF--SIEENDDNKGAVGTS 124
                 + I KP  + +S +LV FT DT+L CFFT+WFSAQWF  + EE  +    VG S
Sbjct: 66  VFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVS 125

Query: 125 KLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQ 184
                        +  RR+  LASQ AS+ YEYT+TMLFT++TL  R YFNFILA+FVQ+
Sbjct: 126 -------------QNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQE 172

Query: 185 MLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227
           +LRHPKY+VD+DDVEQDLKNKS  +R  IKS+K+CY  C+  L
Sbjct: 173 LLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  238 bits (608), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 156/225 (69%), Gaps = 6/225 (2%)

Query: 3   KAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXX 62
           ++ ++ LPKSFLGF+PLY+ VE+ LGISI NK SG YGILALFTGHPLDFMQW       
Sbjct: 2   RSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSV 61

Query: 63  XXXXXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVG 122
                     + I KPN L +S + V++TIDT+  CFFT+WF+ QWF++E   D     G
Sbjct: 62  FTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLE---DTANIDG 118

Query: 123 TSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFV 182
            + LQS   + G   +L  R   ++ QSA++ YEYTMT+L T+++L  RFYFNFILA+FV
Sbjct: 119 NNALQSNPISTG---KLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFV 175

Query: 183 QQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227
           Q++L HPKY+VD+DDVEQ+LKNK +++RL  KS+K CY  C+  L
Sbjct: 176 QELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  238 bits (608), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 112/225 (49%), Positives = 152/225 (67%)

Query: 3   KAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXX 62
           ++ +V LPKSFLGF+PLY+ VE+ LGISI NK SG YGILALFTGHPLDFMQW       
Sbjct: 2   RSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSV 61

Query: 63  XXXXXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVG 122
                     + I KPN L +S + V++T+DT+  CFFT+WF+ QWF++E N        
Sbjct: 62  FTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADAS 121

Query: 123 TSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFV 182
           ++  Q+         +L  R+   + Q AS+ YEY++T+L T+++L  RFYFNFILA+FV
Sbjct: 122 STATQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASFV 181

Query: 183 QQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227
           Q++L HPKY+VD+DDVEQDLKNK +++RL  KS+K CY  C+  L
Sbjct: 182 QELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  236 bits (602), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 154/225 (68%), Gaps = 6/225 (2%)

Query: 3   KAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXX 62
           ++ ++ LPKSFLGF+PLY+ VE+ LGISI NK SG YGILALFTGHPLDFMQW       
Sbjct: 2   RSFLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSV 61

Query: 63  XXXXXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVG 122
                     + I KPN L +S +  ++T+DTL  CFFT+WF+ QWF++E   D  G V 
Sbjct: 62  FTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLE---DTAGGVA 118

Query: 123 TSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFV 182
           +   QS    L   + L  RN  ++ QSA++ YEY++T+L T+++L  RFYFN ILA+FV
Sbjct: 119 S---QSNNSNLISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFV 175

Query: 183 QQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227
           Q++L HPKY+VD+DDVEQ+LKNK +++RL  KS+K CY  C+  L
Sbjct: 176 QELLHHPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLL 220

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  234 bits (598), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 150/220 (68%), Gaps = 16/220 (7%)

Query: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXXXX 68
           LPKSFLG LPLY+ VE+ LGI+ FNK SG +GILALFTGHPL FMQW F           
Sbjct: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67

Query: 69  XXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128
               ++I KPN LT+S + V ++IDTL NCFFT+WF+  WF++E   +   AVG++    
Sbjct: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTE--AAVGST---- 121

Query: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188
                     + +R   ++SQ ASQGYEY+MT+  T+ +L  RFYFNFILA+FVQ++LRH
Sbjct: 122 ----------ITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRH 171

Query: 189 PKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           PKY+ D+DD+EQDLKNKS+++R  +K +K CY  C+  LA
Sbjct: 172 PKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  226 bits (575), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 150/221 (67%), Gaps = 5/221 (2%)

Query: 11  KSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXXXXXX 70
           KSFLGF+PLY+ VE+ LGISI NK SG YGILALFTGHPLDFMQW               
Sbjct: 14  KSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQ 73

Query: 71  XXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAG 130
             + I KPN L +S + +++T+DT+  CFFT+WF+ QWF++E N  + G++  S   +A 
Sbjct: 74  GLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLE-NPTDFGSIANSTADTAL 132

Query: 131 R--ALGP--AKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQML 186
           R   L P  A +L  R+   + QSA++ YEY++T+  T+ +L  RFYFN IL +FVQ++L
Sbjct: 133 RTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELL 192

Query: 187 RHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227
            HPKY+VD+DDVEQDLKNK +++RL  KS+K CY  C+  L
Sbjct: 193 HHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  224 bits (572), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 144/225 (64%), Gaps = 22/225 (9%)

Query: 7   VHLPK---SFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXX 63
           + LPK   SF G +PLY+GVE+ LGI+IFNK SG YGILALFTGHPLDF+QW F      
Sbjct: 6   ITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIF 65

Query: 64  XXXXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGT 123
                    ++I KP  LT+S +LV +++DT+  C FT+WF++QWF  E           
Sbjct: 66  TLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPT--------- 116

Query: 124 SKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQ 183
                     G  + L RRN SL SQ A++ YEY MT+  T++TL  R YFN +LAAFVQ
Sbjct: 117 ----------GTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQ 166

Query: 184 QMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           ++L HPKY+VD+DDVEQDLKNK +++R  IK++KW Y  C   LA
Sbjct: 167 ELLHHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA 211

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  224 bits (571), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 111/227 (48%), Positives = 152/227 (66%), Gaps = 10/227 (4%)

Query: 2   TKAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXX 61
           T+++ + LPKSFLGF+PLYIGVE+ LGISI NK SG YGILALFTGHPLD MQW      
Sbjct: 4   TRSKSMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWS 63

Query: 62  XXXXXXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAV 121
                      +QI KPN LT+S + + F IDTL   FFT+WF+AQW+++E N +N    
Sbjct: 64  IFTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNN---- 119

Query: 122 GTSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAF 181
              K   +  +  P       ++ +A Q AS+G+EY +TM  T+L+LA + YF FI+A+F
Sbjct: 120 --VKDTKSSYSDAPVD----YSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASF 173

Query: 182 VQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           VQ++L HP+Y++D+DDVEQDLK++S ++R  IKS+K CY   +  LA
Sbjct: 174 VQELLLHPRYMLDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLLA 220

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  219 bits (559), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 138/208 (66%), Gaps = 1/208 (0%)

Query: 21  IGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXXXXXXXXWQIRKPNP 80
           +GVE+GLGI++ NK SGFYGIL L TGH LDFMQW                   I KP+ 
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 81  LTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAGRALGPAKELN 140
           L+YSL+L+ FT DTL+ CFFT+WFS QWFS  +N +      T+   SAG        ++
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFS-AKNSELTDPNSTTLQSSAGNNSPSGNLIS 119

Query: 141 RRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQ 200
           +R ++L+SQSASQG EY  T+L T+  LA RFYFNFI+ AFVQ++LRHPKY+VD+DDVEQ
Sbjct: 120 KRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQ 179

Query: 201 DLKNKSLFRRLCIKSEKWCYNACQRALA 228
           DLK++   RR  I++E   Y  C+R LA
Sbjct: 180 DLKHRGFLRRWWIRAETHSYKICRRYLA 207

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  218 bits (555), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 142/220 (64%), Gaps = 10/220 (4%)

Query: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXXXX 68
           LPK+F G  PLYIGVE+ LG+++ NK SG +GILALFTGHPLD MQW             
Sbjct: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67

Query: 69  XXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128
               +QI KP  LT+S ++VVF+IDT+L C FT+WF+  WF+ E N D   A+GT     
Sbjct: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTD--AAMGT----- 120

Query: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188
              A      L +R   + +Q A++ YEY  T++ T+++L  R YFNF+LA+FVQ++LRH
Sbjct: 121 ---AASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRH 177

Query: 189 PKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           P+Y+VD+DD+EQDLKNK   RR  + S+K  Y+ C+  L 
Sbjct: 178 PQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVLV 217

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  212 bits (540), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 148/228 (64%), Gaps = 10/228 (4%)

Query: 3   KAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXX 62
           ++ MVHLP++FL + PLYIGVE+ LG+  FNKFSG YG+LALFTGHPLDF+QW F     
Sbjct: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62

Query: 63  XXXXXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVG 122
                      Q+ KPN L  S V  VF++DT+++C + +WF+A WFS E      G+  
Sbjct: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQE------GSTD 116

Query: 123 TSKLQSAGRALGPAKELNRRNNSL---ASQSASQGYEYTMTMLFTVLTLAVRFYFNFILA 179
            + L+SAG ALGPA E      S     S+SAS GYE+ + +L T++ LAVRFYFNFI+ 
Sbjct: 117 VTDLKSAGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIII 176

Query: 180 AFVQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227
           AF QQ+LR  K+  D++D+E +L N+++  +   K EKWC+  C+R L
Sbjct: 177 AFQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  208 bits (530), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 140/226 (61%), Gaps = 8/226 (3%)

Query: 2   TKAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXX 61
           + + M HLPKSF G LPLYIGVEL LGI+IFNKF G +G+LALFTGHPLD +QW F    
Sbjct: 22  SHSNMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWS 80

Query: 62  XXXXXXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAV 121
                       QI +P    Y LVLVV++ DT+L C +T+WF+  WF     D + G  
Sbjct: 81  FVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFI----DGDVGVT 136

Query: 122 GTSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAF 181
            T+K   A    G    +   N  ++ QSAS+ YEY  TM FT+  L++RFY NF++A+F
Sbjct: 137 ATAKEDDADATQG---SVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASF 193

Query: 182 VQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227
           VQ+M +H K+    DDVEQDLK+KS+  R   K ++WCY  C+R L
Sbjct: 194 VQRMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  202 bits (515), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 99/222 (44%), Positives = 136/222 (61%), Gaps = 1/222 (0%)

Query: 6   MVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXX 65
           MV+LP+SF G LPLYIGVEL LG++IFNKF G YGILALFTG PLD +QW F        
Sbjct: 1   MVYLPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAAL 59

Query: 66  XXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSK 125
                   Q+ KP  +TY +VL V+++DT+L CFF + F+  WFS E+       V    
Sbjct: 60  LVFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKG 119

Query: 126 LQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQM 185
           +          +    R     +QSAS  YEY+ T+L T++  A+RFY NFI+A+FV++M
Sbjct: 120 IGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRM 179

Query: 186 LRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227
           ++  +YI + DDVE DLKN S+  R  + +++WCY  C+R L
Sbjct: 180 MKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  201 bits (511), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 105/220 (47%), Positives = 135/220 (61%), Gaps = 19/220 (8%)

Query: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXXXX 68
           LPKSF GFLPLYIGVE  LGI+IFNK SG YGILALFTGHPL  +QW             
Sbjct: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76

Query: 69  XXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128
               +Q+  PN LTY  +L+ ++ DT+  CFFTI+F + WF+ E N              
Sbjct: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESN-------------- 122

Query: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188
           AG  +  +  +++ N     Q AS+  E+  TM  T++ L  RFYFNFILA+F QQ+  H
Sbjct: 123 AGDNINSSTTVDKYN-----QGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLH 177

Query: 189 PKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           PKY++D+DDVEQDLKNKS+  +  IKS+K CY   +R LA
Sbjct: 178 PKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA 217

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  194 bits (493), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 131/226 (57%), Gaps = 22/226 (9%)

Query: 3   KAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXX 62
           K    +LP+SF GFLPLYIGVE  LGI+I NK SG YGILALFTGHPL+  QW       
Sbjct: 11  KTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSV 70

Query: 63  XXXXXXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVG 122
                     +Q+  P+ LTYS + VVF+ DT L C FT+ FS+QWF+    +   G   
Sbjct: 71  FTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFT----ETGSGMSD 126

Query: 123 TSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFV 182
            S +   G                  Q AS+ YEYT T+L TV+ L  R YFNFILAAF 
Sbjct: 127 GSGVDEYG------------------QGASETYEYTFTILITVVALVSRMYFNFILAAFN 168

Query: 183 QQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           Q++  HPKY+VD DDVEQDLKNK+   +  IKS+K CYN  +  L 
Sbjct: 169 QELFLHPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  190 bits (483), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 88/222 (39%), Positives = 137/222 (61%), Gaps = 18/222 (8%)

Query: 7   VHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXX 66
           ++LPK FLGFLPLYIGVE+ LG++I NK SG +GILALFTGHPL+F+QW           
Sbjct: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64

Query: 67  XXXXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKL 126
                 +   KP+ L +S + + F+IDT L C FT+WF+ QW+++E+N   + ++  + +
Sbjct: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIAAAAM 124

Query: 127 QSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQML 186
           Q                    +Q ASQ +E+ MT+  T+ +L  R YFNF+LA+FVQ +L
Sbjct: 125 QE------------------PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLL 166

Query: 187 RHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           +HP+Y+VD  DVEQ+L+ + +++R+  +++  C    ++ L 
Sbjct: 167 QHPRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLLT 208

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  186 bits (472), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 101/208 (48%), Positives = 135/208 (64%), Gaps = 2/208 (0%)

Query: 21  IGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXXXXXXXXWQIRKPNP 80
           +GVE+GLGI+I NK SGFYGIL L TGH LDFMQW                   + KP  
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 81  LTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAGRALGPAKELN 140
            TY+ VL+ FT DTL+ CFFT+WFS  WF+ +E++ +  +  T   Q++G     +K L 
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQ--QTSGGISSGSKLLT 118

Query: 141 RRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQ 200
            R  +L+SQSASQ  EY  T+L +++ L  RFYFNFI+ AFVQ++ RHPKY+VD+DDV+Q
Sbjct: 119 ARGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQ 178

Query: 201 DLKNKSLFRRLCIKSEKWCYNACQRALA 228
           DLK+K L++R  I++E W Y  C   LA
Sbjct: 179 DLKHKKLWQRWWIRAENWSYRVCHHYLA 206

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  166 bits (421), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 123/220 (55%), Gaps = 28/220 (12%)

Query: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXXXX 68
           LPK F G  PLY+GVEL LGI+IFNK  G YGILALF GHPL+F QW             
Sbjct: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74

Query: 69  XXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128
                ++ +P   T+S V + F++DTLL C FT++F+ +WF+                  
Sbjct: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAA----------------- 117

Query: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188
                      N      A+Q AS  YEY++++L T+ +L  R YFNFI+ +F+Q++   
Sbjct: 118 -----------NTTTRPPAAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFR 166

Query: 189 PKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           P Y +D D+VE +L++ SL RRL ++++ +CY   +R L+
Sbjct: 167 PAYTLDTDEVETELRHSSLLRRLWLQNQHYCYILSRRILS 206

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  161 bits (408), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 79/156 (50%), Positives = 110/156 (70%), Gaps = 15/156 (9%)

Query: 73  WQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAGRA 132
           +QI KP  LT+S + V FT+DTL  CFFT+WF+AQWF        +G+ G S +Q++   
Sbjct: 21  YQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWF--------QGSEGESAVQTS--- 69

Query: 133 LGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYI 192
                 + +R+ SLASQ A+ GYEY +TML T +TL  RFYFN ILA+FVQ++L +PK++
Sbjct: 70  ----TGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLSNPKFM 125

Query: 193 VDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228
           +D+DDVEQDLKNKS+ +R  IK+EK+CY  C+  L+
Sbjct: 126 IDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  156 bits (395), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 121/209 (57%), Gaps = 14/209 (6%)

Query: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFXXXXXXXXXXX 68
           LP SF    PLY+GVEL LGI I NK SGFYGILALFTGHPL  +QW             
Sbjct: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72

Query: 69  XXXXWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128
               + I+KPN   +S +  +F++DT+   F T++F+  WFS     D+      + LQ 
Sbjct: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFS----SDHSNKQSENSLQR 128

Query: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188
             + +    EL+++      Q AS  YE  + ++ T+ TL  R Y+N +LA+F+ ++  +
Sbjct: 129 TEKDI----ELSQK------QGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFIN 178

Query: 189 PKYIVDKDDVEQDLKNKSLFRRLCIKSEK 217
           PK+I+D+DDVE DLKNKS F++    S+K
Sbjct: 179 PKFIIDQDDVETDLKNKSFFKKFGGISKK 207

>NDAI0G00490 Chr7 complement(102674..104494) [1821 bp, 606 aa] {ON}
           Anc_1.451 YCR023C
          Length = 606

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%)

Query: 96  LNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAGRALGPAKELNRRNNSLASQSASQG 154
           L C   ++ S +   I+END+ +    T+   + G   GP++++    +SL S S  +G
Sbjct: 548 LFCIIALYQSYKIKPIDENDEIETEAITTNTDATGSFTGPSRQILTHRSSLGSLSNKRG 606

>KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {ON}
           Anc_5.267 YHR023W
          Length = 1872

 Score = 32.0 bits (71), Expect = 1.4,   Method: Composition-based stats.
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 18/108 (16%)

Query: 73  WQIRKPNPLTYSLVLVVFT-IDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAGR 131
           W  +  +PL  +L+ V+ +  +TL++ FF         SIE++ D +G V       +GR
Sbjct: 571 WLSKNKDPLNENLLSVMSSSTNTLVSSFF---------SIEDSSDKQGRV-------SGR 614

Query: 132 ALGPAKELNRRNN-SLASQSASQGYEYTMTMLFTVLTLAVRFYFNFIL 178
           +L  A   +R    SL +Q       +   ++   L +A RF  N IL
Sbjct: 615 SLRTASARHREQQISLLNQLGHSHPHFVRCIIPNNLKMAKRFDRNLIL 662

>NDAI0A02890 Chr1 (648510..651236) [2727 bp, 908 aa] {ON} 
          Length = 908

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%)

Query: 146 LASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQDLKNK 205
           L S + +QG           L L +++ ++FILA  +  +   P+Y V KD++++  +  
Sbjct: 258 LVSSAVAQGTHNRTDATSYRLPLGLQYVWSFILAIGMIFLPESPRYYVLKDELDKAAEAL 317

Query: 206 SLFRRLCI 213
           S  RR+ I
Sbjct: 318 SFLRRVPI 325

>NCAS0A13880 Chr1 complement(2723605..2726001) [2397 bp, 798 aa]
           {ON} Anc_7.309
          Length = 798

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 37/72 (51%)

Query: 146 LASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQDLKNK 205
           L S + SQG ++        + + +++ ++  LA  +  +   P+Y V KDD+++  K+ 
Sbjct: 260 LVSSAVSQGTQHINNPASYRIPIGLQYVWSSFLAIGMIFLPESPRYYVMKDDIDRAAKSL 319

Query: 206 SLFRRLCIKSEK 217
           S  R + I+  +
Sbjct: 320 SFLRGVPIQDPR 331

>Suva_4.106 Chr4 (201617..203923) [2307 bp, 768 aa] {ON} YDL138W
           (REAL)
          Length = 768

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%)

Query: 146 LASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQDLKNK 205
           L S + SQG           + + +++ ++ ILA  +  +   P+Y V KDD+ +  K+ 
Sbjct: 246 LVSSAVSQGTHSMSGPSSYRIPIGLQYVWSSILAVGMIFLPESPRYYVLKDDLNEAAKSL 305

Query: 206 SLFRRLCIKSEK 217
           S  R L I+  +
Sbjct: 306 SFLRGLPIEDPR 317

>CAGL0I03872g Chr9 (337985..340273) [2289 bp, 762 aa] {ON} some
           similarities with uniprot|Q12300 Saccharomyces
           cerevisiae YDL138w RGT2 or uniprot|P10870 Saccharomyces
           cerevisiae YDL194w SNF3
          Length = 762

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/72 (19%), Positives = 36/72 (50%)

Query: 146 LASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQDLKNK 205
           L S + SQG E         + + +++ ++ +L   +  +   P+Y + KD++E+  ++ 
Sbjct: 264 LVSSAVSQGTESINAPSSYRVPIGLQYVWSVVLGVGMVFLPESPRYYIMKDEIEEAARSL 323

Query: 206 SLFRRLCIKSEK 217
           S  R + ++  +
Sbjct: 324 SFLRGISLEDPR 335

>Skud_13.242 Chr13 (413093..416011) [2919 bp, 972 aa] {ON} YMR086W
           (REAL)
          Length = 972

 Score = 29.6 bits (65), Expect = 7.3,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 104 FSAQWFSIEENDDNKGAVGTSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTM 159
           FS    S++E  DN+ +      Q +     PA++ N++ +S+     S+G E T+
Sbjct: 426 FSNDSSSVKELADNRSSESADHTQMSDITCSPAQDPNKKPSSIQDNDISEGIESTI 481

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.139    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,223,166
Number of extensions: 839222
Number of successful extensions: 2923
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2929
Number of HSP's successfully gapped: 31
Length of query: 228
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 122
Effective length of database: 41,326,803
Effective search space: 5041869966
Effective search space used: 5041869966
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)