Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02486g5.432ON50046721810.0
KLTH0F16104g5.432ON54039016330.0
Skud_15.2825.432ON48538816100.0
AER257W5.432ON47739016040.0
YOR119C (RIO1)5.432ON48438816050.0
Kwal_55.214335.432ON47639016030.0
KLLA0E21121g5.432ON52642116060.0
KAFR0E039205.432ON49740415960.0
Suva_8.1725.432ON48638815910.0
Smik_15.2975.432ON48638815840.0
Kpol_1062.315.432ON51341815780.0
NCAS0F033605.432ON50942115670.0
CAGL0L11594g5.432ON50739015540.0
Ecym_47635.432ON53847615400.0
TBLA0A037605.432ON50440215350.0
TDEL0E019305.432ON50238615200.0
TPHA0E017805.432ON50841415160.0
KNAG0C049305.432ON49640615110.0
NDAI0B056505.432ON46236814790.0
ZYRO0F09988g5.432ON46038513350.0
CAGL0H08019g2.44ON4252301374e-08
TPHA0H009202.44ON4292291312e-07
KNAG0F010602.44ON4282311205e-06
NCAS0G015802.44ON4242281195e-06
Smik_14.1252.44ON4202281171e-05
KAFR0A077602.44ON4252281142e-05
NDAI0F036002.44ON4212281133e-05
KLTH0B07722g2.44ON4282291124e-05
ZYRO0C10340g2.44ON4162291081e-04
Skud_14.1292.44ON4252281062e-04
ABL166W2.44ON4142291053e-04
Kwal_23.45632.44ON4252291044e-04
SAKL0E13552g2.44ON4192281035e-04
YNL207W (RIO2)2.44ON4252291000.001
TDEL0A008602.44ON4192281000.001
Ecym_64492.44ON417230990.002
Kpol_400.72.44ON425228960.004
KLLA0D19008g2.44ON422228940.007
Ecym_11191.104ON791137761.1
KLLA0F15576g5.200ON51251741.8
Kpol_1029.172.199ON133460723.2
KLLA0F17006g2.391ON41572695.8
TPHA0B003404.373ON159198699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02486g
         (500 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   844   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   633   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   624   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   622   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   622   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   622   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   623   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   619   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   617   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   614   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   612   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   608   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   603   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   597   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   595   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   590   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   588   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   586   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   574   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   518   0.0  
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    57   4e-08
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    55   2e-07
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    51   5e-06
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      50   5e-06
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    50   1e-05
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    49   2e-05
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    48   3e-05
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    48   4e-05
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    46   1e-04
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    45   2e-04
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    45   3e-04
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    45   4e-04
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    44   5e-04
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    43   0.001
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    43   0.001
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    43   0.002
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    42   0.004
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    41   0.007
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    34   1.1  
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    33   1.8  
Kpol_1029.17 s1029 (32401..36405) [4005 bp, 1334 aa] {ON} (32401...    32   3.2  
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    31   5.8  
TPHA0B00340 Chr2 complement(67479..72254) [4776 bp, 1591 aa] {ON...    31   9.1  

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/467 (89%), Positives = 417/467 (89%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKRE 120
           LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKRE
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKRE 120

Query: 121 YAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIP 180
           YAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIP
Sbjct: 121 YAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIP 180

Query: 181 CPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLV 240
           CPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLV
Sbjct: 181 CPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLV 240

Query: 241 HADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVI 300
           HADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVI
Sbjct: 241 HADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVI 300

Query: 301 FQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEER 360
           FQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEER
Sbjct: 301 FQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEER 360

Query: 361 DFDRFTDGKFDLLKSLIAHDNKKNATNFNAXXXXXXXXXXXXXXXXFPXXXXXXXXXXXX 420
           DFDRFTDGKFDLLKSLIAHDNKKNATNFNA                FP            
Sbjct: 361 DFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQFEIDSSDEDSEDEFPDLDGEDLESDGG 420

Query: 421 XXXXXXQLDNGXXXXXXXXXXXXXXXXRKNLKDPKGKKYEDKDAKRL 467
                 QLDNG                RKNLKDPKGKKYEDKDAKRL
Sbjct: 421 SECGSEQLDNGEEDDSEEDDDEEYDDDRKNLKDPKGKKYEDKDAKRL 467

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/390 (77%), Positives = 342/390 (87%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS+E    KL L +     RDH+N++ILDK++H IKTDELS+TR KT+KDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKRE 120
           LDPRTMRFL+ L SRGV+S+ NGCLSTGKEANVYHAFAG   + SEE +K   ++  +RE
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERRE 172

Query: 121 YAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIP 180
           YA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QSGV+P
Sbjct: 173 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVP 232

Query: 181 CPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLV 240
            P+PIEV+SNVLVMEFLNRG+GFASP+LKD PYKDR+E  YYYHTMVAY+RLLYQ CQLV
Sbjct: 233 APEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLV 292

Query: 241 HADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVI 300
           HADLSEYNTIVH+ +LY+IDVSQSVQPEHPMSLDFLRMDIKNINSYFE+  IDIFPER I
Sbjct: 293 HADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAI 352

Query: 301 FQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEER 360
           FQF+IS+ L+KF+G+Y N +DLR YV+K L  KS  EDEAEDEVFRSLHLVRNL GLEER
Sbjct: 353 FQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEER 412

Query: 361 DFDRFTDGKFDLLKSLIAHDNKKNATNFNA 390
           DFDRFT GKFDLLKSLIAHDN+K A+NF A
Sbjct: 413 DFDRFTLGKFDLLKSLIAHDNQKVASNFTA 442

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/388 (75%), Positives = 346/388 (89%), Gaps = 7/388 (1%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS+E  F +L +        DH+N+++L+KYSH+IKTDELS ++ KT+KDKANRATVENV
Sbjct: 1   MSLEDRFDRLTV---SQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENV 57

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDEL---- 116
           LDPRTMRFL+ +V+RGV++DLNGCLSTGKEANVYHAFAG    P  + E    + L    
Sbjct: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117

Query: 117 VKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 176
           +++EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS
Sbjct: 118 LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 177

Query: 177 GVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQV 236
           GVIP P+P+EV++NVLVMEFL+RGNGFASP+L+D+PY+DREEI +YYHTMVAYMRLLYQV
Sbjct: 178 GVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQV 237

Query: 237 CQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFP 296
           C+LVHADLSEYNTI+H+D+LYMIDVSQSV+PEHPMSLDFLRMDIKN+N YFEK G+ IFP
Sbjct: 238 CRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFP 297

Query: 297 ERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNG 356
           ERVIFQF+ISE+L+KF+GDYHN  DL  Y++KNLP+KST +DEAEDE+FRSLHLVR+L G
Sbjct: 298 ERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 357 LEERDFDRFTDGKFDLLKSLIAHDNKKN 384
           LEERDFDR+TDGKFDLLKSLIAHDN++N
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNERN 385

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/390 (76%), Positives = 335/390 (85%), Gaps = 15/390 (3%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           M +E    KL LRD  D    H N+RIL+K++++IKTDELSLT+GKTNKDKANRATVENV
Sbjct: 1   MDLEDQLRKLKLRDDTD----HDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENV 56

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKRE 120
           LDPRTMRFLR LV+RGVLS+ NGCLSTGKEANVYHA +G      E           K E
Sbjct: 57  LDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE-----------KSE 105

Query: 121 YAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIP 180
           YAVKIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRI+QSGVIP
Sbjct: 106 YAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIP 165

Query: 181 CPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLV 240
           CPQP+E++SNVLVMEFLNRG+GFASPRLKD+P+KDR+EI +YYH MV+Y+RLLYQVCQLV
Sbjct: 166 CPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLV 225

Query: 241 HADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVI 300
           HADLSEYN+IVH  +LY+IDVSQSVQPEHPMSLDFLRMDIKNIN YFE+ GIDIFPERVI
Sbjct: 226 HADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVI 285

Query: 301 FQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEER 360
           FQF+ISETLDKF+GD  + +DLR YV+ NLP K TA+DEAED+VFRSLHLVRNL GLEER
Sbjct: 286 FQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEER 345

Query: 361 DFDRFTDGKFDLLKSLIAHDNKKNATNFNA 390
           DFDRFTDGKFDLLKSLIA DN K +  F A
Sbjct: 346 DFDRFTDGKFDLLKSLIAQDNAKISNTFTA 375

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/388 (76%), Positives = 341/388 (87%), Gaps = 7/388 (1%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS+E  F  L +  G     DH+N+++L+KYSH+IKTDELS +R KT+KDKANRATVENV
Sbjct: 1   MSLEDKFDSLSVSQGAS---DHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENV 57

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDEL---- 116
           LDPRTMRFL+ +V+RGV++DLNGCLSTGKEANVYHAFAG    P  + E    + L    
Sbjct: 58  LDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117

Query: 117 VKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 176
            + EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 118 SRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177

Query: 177 GVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQV 236
           GVIP P+PIEV++NVLVMEFL+RGNGFASP+LKD+PYK+R+EI +YYHTMVAYMRLLYQV
Sbjct: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQV 237

Query: 237 CQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFP 296
           C+LVHADLSEYNTIVH D+LYMIDVSQSV+PEHPMSLDFLRMDIKN+N YFEK GI IFP
Sbjct: 238 CRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297

Query: 297 ERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNG 356
           ERVIFQF+ISETL+KF+GDY+N   L  Y++ NLP+KST +DEAEDE+FRSLHLVR+L G
Sbjct: 298 ERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 357 LEERDFDRFTDGKFDLLKSLIAHDNKKN 384
           LEERDFDR+TDGKFDLLKSLIAHDN++N
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNERN 385

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/390 (75%), Positives = 340/390 (87%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS++     L LRD  +   DH+N++ILDK++H IK DELS++RGKT+KDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKRE 120
           LDPRTMRFL+ L SRGV+S  NGC+STGKEANVYHAFA    + +EEA +   +   +RE
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120

Query: 121 YAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIP 180
            A+KI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QSG++P
Sbjct: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180

Query: 181 CPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLV 240
            P+P+EVRSNVLVMEFL+RGNGFASPRLKD+PYKDREE  +YY+TMVAY+RLLYQ CQLV
Sbjct: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240

Query: 241 HADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVI 300
           HADLSEYN IVH+  LY+IDVSQSVQPEHPMSLDFLRMDIKN+N+YFE+  +D+FPERVI
Sbjct: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300

Query: 301 FQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEER 360
           FQF+ISETLDKF GDY +  DLRDYVSKNLP+KS  +DEAEDEVFRSLHLVRNL GLEER
Sbjct: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360

Query: 361 DFDRFTDGKFDLLKSLIAHDNKKNATNFNA 390
           DFDRFT GKFDLLKSLIAHDN++ A+ F A
Sbjct: 361 DFDRFTLGKFDLLKSLIAHDNERVASTFTA 390

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/421 (73%), Positives = 350/421 (83%), Gaps = 35/421 (8%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           M+++    KL+L +      +HVN++IL++Y++ IKTDELSLTRGKT+KDKANRATVENV
Sbjct: 2   MNIDDKLEKLNLAN----RDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENV 57

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQ----------------- 103
           LDPRTMRFL+ +++RG+LS  NGCLSTGKEANVYHAFAGN  +                 
Sbjct: 58  LDPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQN 117

Query: 104 -----------PSEEAEKDSK--DELV-KREYAVKIYKTSILVFKDRERYVDGEFRFRNS 149
                       SE+A   S   DE   K+EYAVKIYKTSILVFKDRERYVDGEFRFRNS
Sbjct: 118 IESTKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNS 177

Query: 150 RSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLK 209
           RSQHNPRKMIKIWAEKEFRNLKRI+QSGVIPCP+PIEVRSNVLVMEFLNRG+GFASPRLK
Sbjct: 178 RSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLK 237

Query: 210 DHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEH 269
           DHPYKDREEIK+YY+ M+AYMRLLYQVC+LVHADLSEYN+IVH D+LY+IDVSQSVQPEH
Sbjct: 238 DHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEH 297

Query: 270 PMSLDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKN 329
           PMSLDFLRMDIKN+NSYF+K GIDIFPERVIFQFIISE LDKF+GDY +  DL  YV+ N
Sbjct: 298 PMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADN 357

Query: 330 LPLKSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNATNFN 389
           LPLK T EDEAEDEVFRSLHL+RNL GLEERDFDRFTDGKFDLLKSLIA++N+K + NF 
Sbjct: 358 LPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFT 417

Query: 390 A 390
           A
Sbjct: 418 A 418

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/404 (74%), Positives = 345/404 (85%), Gaps = 21/404 (5%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS+E  F  L +  G     DH+N++ILDKY H+IKT+E SL+RGKTNKDKANRATVENV
Sbjct: 1   MSIEDKFDNLKISGGRGSS-DHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENV 59

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGN---ANQ-------------- 103
           LDPRTM+FL+ L+SRGV+S  +GCLSTGKEANVYHAFAG    A Q              
Sbjct: 60  LDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVD 119

Query: 104 PSEEAEKDSKDELV---KREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 160
           PSE + ++ KDE     + EYA+KIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIK
Sbjct: 120 PSELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIK 179

Query: 161 IWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIK 220
           IWAEKEFRNLKRI+QS VIP P+PIE+++NVLVMEFLNRG+GFASPRLKDHPYKDREEI 
Sbjct: 180 IWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIF 239

Query: 221 YYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDI 280
           +YYHT+VAY+RLLYQVC LVHADLSEYNT+VH  RLY+IDVSQSV+PEHPMSLDFLRMDI
Sbjct: 240 HYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDI 299

Query: 281 KNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEA 340
           KN+N YFEK GIDIFPER+IFQF+ISETLDKF GDY +  DLRDYV +NLP+K+T +DEA
Sbjct: 300 KNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEA 359

Query: 341 EDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKN 384
           EDE+FRSL+LVRNLNGLEERDFDR+T+G+FDLLKSL+AHDN+KN
Sbjct: 360 EDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKN 403

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/388 (75%), Positives = 342/388 (88%), Gaps = 7/388 (1%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS E  F KL +        DH+N+++LDK+SH+IKTDELS ++ KT+KDK+NRATVENV
Sbjct: 1   MSFEDKFEKLTV---SQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENV 57

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDEL---- 116
           LDPRTMRFL+ +V+RGV++DLNGCLSTGKEANVYHAFAG    P  + E    + L    
Sbjct: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVVDEETGKYEVLETDG 117

Query: 117 VKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 176
           ++ EYA+KIYKTSILVFKDRE+YVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLKRIHQS
Sbjct: 118 LRAEYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQS 177

Query: 177 GVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQV 236
           GVIP P+P+EV++NVLVMEFL+RG+GFASP+LKD+PYKDREEI +YY+TMVAYMRLLYQV
Sbjct: 178 GVIPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQV 237

Query: 237 CQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFP 296
           C+LVHADLSEYNTI+H D+LYMIDVSQSV+PEHPMSLDFLRMDIKN+N YFEK GI+IFP
Sbjct: 238 CRLVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIFP 297

Query: 297 ERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNG 356
           ERVIFQF+ISE L+KF+GDY N  DL  Y+SKNLP+KST +DEAEDE+FRSLHLVR+L G
Sbjct: 298 ERVIFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 357 LEERDFDRFTDGKFDLLKSLIAHDNKKN 384
           LEERDFDR+TDGKFDLLKSLIAHDN++N
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNERN 385

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/388 (75%), Positives = 341/388 (87%), Gaps = 7/388 (1%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS+E +F KL +        DH+N+++L+KYSH+IKTDELS  R KT+KDKANRATVENV
Sbjct: 1   MSLEDNFDKLTV---SQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENV 57

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDEL---- 116
           LDPRTMRFL+ +V+RGV++DLNGCLSTGKEANVYHAFAG    P  + E    + L    
Sbjct: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDG 117

Query: 117 VKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 176
            + EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 118 PRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177

Query: 177 GVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQV 236
           GVIP P+PIEV++NVLVMEFL+RGNGFASP+LKD+PY+DR EI +YY+TMVAYMRLLYQV
Sbjct: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQV 237

Query: 237 CQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFP 296
           C+LVHADLSEYNTI+H D+L+MIDVSQSV+PEHPMSLDFLRMDIKN+N YFEK GI IFP
Sbjct: 238 CRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297

Query: 297 ERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNG 356
           ERVIFQF+ISE+L+KF+ DYHN  DL  Y++KNLP+KST +DEAEDE+FRSLHLVR+L G
Sbjct: 298 ERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357

Query: 357 LEERDFDRFTDGKFDLLKSLIAHDNKKN 384
           LEERDFDR+TDGKFDLLKSLIAHDN++N
Sbjct: 358 LEERDFDRYTDGKFDLLKSLIAHDNERN 385

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/418 (72%), Positives = 342/418 (81%), Gaps = 38/418 (9%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS +  F +L +  G D     VN+RIL+KY H+IKTDELS T+GKTNKDKANRATVENV
Sbjct: 1   MSFDEKFDRLKI-SGND-----VNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENV 54

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNA------------------- 101
           LDPRTMRFL+ L +RGV+S  NGCLSTGKEANVYHAFAG+                    
Sbjct: 55  LDPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSV 114

Query: 102 --NQPSEEAEKD---------SKDELV--KREYAVKIYKTSILVFKDRERYVDGEFRFRN 148
             NQ SEE   D         SK E V  ++EYA+KIYKTSILVFKDRERYVDGE+RFRN
Sbjct: 115 EVNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRN 174

Query: 149 SRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRL 208
           SRSQHNPRKMIKIWAEKEFRNL+RIHQSGVIP P+P+EV+SNVLVMEFLNRGNGFASPRL
Sbjct: 175 SRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRL 234

Query: 209 KDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPE 268
           KD+PYKDR+EI +YYH +VAYMRLLYQVC+LVHADLSEYNTIVH  +LYMIDVSQSV+PE
Sbjct: 235 KDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPE 294

Query: 269 HPMSLDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSK 328
           HPMSLDFLRMDIKN+N YFEK GIDIFPER+IFQF+ISE L+ F+GD ++  DLR++V  
Sbjct: 295 HPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKN 354

Query: 329 NLPLKSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNAT 386
           NLP+KST EDEAEDEVFRSLHLVRNL GLEERDFDRFTDGKFDLLK+LIA DN+KN T
Sbjct: 355 NLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFT 412

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/421 (69%), Positives = 345/421 (81%), Gaps = 39/421 (9%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS+E  F +L++ + P    +H N++ILDKY H+ KTDE+S TR KTNKDKANRATVENV
Sbjct: 1   MSLEDKFDRLNISNEP--RTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENV 58

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNA------------------- 101
           LDPRTMRFL+ L SRGV+SD NGCLSTGKEANVYHAFAG++                   
Sbjct: 59  LDPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDED 118

Query: 102 ------------NQPSEEAEKDSKDELV------KREYAVKIYKTSILVFKDRERYVDGE 143
                       +   E+ E + + E++      K+EYAVKI+KTSILVFKDRERYVDGE
Sbjct: 119 ENEEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGE 178

Query: 144 FRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGF 203
           FRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QSGVIP P+PIEV++NVLVMEFL RG+GF
Sbjct: 179 FRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGF 238

Query: 204 ASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQ 263
           ASPRLKDHPYKDREEI +YYHT+VAYMRL+YQ+C+LVHADLSEYN ++H D++Y+IDVSQ
Sbjct: 239 ASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQ 298

Query: 264 SVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLR 323
           SV+PEHPMSLDFLRMDIKNIN YFEK GIDIFPERVIFQFIIS+TL+ F GDY +  DLR
Sbjct: 299 SVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLR 358

Query: 324 DYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKK 383
           DYV++NLP+K + +DEAEDE+FRSL+LVRNL GLEERDFDR+TDGKFDLLKSLIAHDN+K
Sbjct: 359 DYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEK 418

Query: 384 N 384
           N
Sbjct: 419 N 419

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/390 (73%), Positives = 335/390 (85%), Gaps = 26/390 (6%)

Query: 21  DHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENVLDPRTMRFLRGLVSRGVLSD 80
           DH+N++I+DKY H+IKTDELS+ + KTNKDKANRATVENVLDPRTMRFL  LV+RGV++ 
Sbjct: 16  DHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRTMRFLNALVNRGVIAG 75

Query: 81  LNGCLSTGKEANVYHAFAGN---ANQPSEEAEKD--------------------SKDELV 117
           LNGCLSTGKEANVYHAFAG+     Q S+E ++D                    + ++L+
Sbjct: 76  LNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSKGNIDISENRAKTAEDLI 135

Query: 118 K---REYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIH 174
           +   +EYA+KIYKTSIL+FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+
Sbjct: 136 REGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIY 195

Query: 175 QSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLY 234
           Q GVIP P+PIEV++NVLVMEFLNRG+GFASP+L+D+PYKDREEI YYYH +V+YMRLLY
Sbjct: 196 QMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREEIYYYYHILVSYMRLLY 255

Query: 235 QVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDI 294
           QVC+LVHADLSEYNTIVH ++LYMIDVSQSV+PEHPMSLDFLRMDIKN+N YFEK GI+I
Sbjct: 256 QVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGIEI 315

Query: 295 FPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNL 354
           F E+ IFQF+I++TLDKF GD ++ +DLR YV+ N+P+K T EDEAEDEVFRSLHLVRNL
Sbjct: 316 FQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQEDEAEDEVFRSLHLVRNL 375

Query: 355 NGLEERDFDRFTDGKFDLLKSLIAHDNKKN 384
            GLEERDFDRFTDGKFDLLKSL+A DNKKN
Sbjct: 376 EGLEERDFDRFTDGKFDLLKSLLAQDNKKN 405

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/476 (63%), Positives = 353/476 (74%), Gaps = 20/476 (4%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           M +E    +L L D    H +H NSRILDK++++IKTDELS+TRGKT+KDKANRATVENV
Sbjct: 33  MDLENKLGRLKLLD----HSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENV 88

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEK---------D 111
           LDPRTMRFLR L+ RG++++ NGCLSTGKEANVYHAF GNA    E+  K         D
Sbjct: 89  LDPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVDIVEKQHKVIRQSSICSD 147

Query: 112 SKDELVKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 171
           S+ +  K EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK
Sbjct: 148 SEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 207

Query: 172 RIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMR 231
           RI+ +GVI CP+PIE++SNVLVMEFLNRG+GFASP+LKD+PY DR+EI Y+YH MVAY+R
Sbjct: 208 RIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIR 267

Query: 232 LLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTG 291
           LLYQVCQLVHADLSEYN+IVH  +LY+IDVSQSVQPEHPMSLDFLRMDIKNIN+YF K G
Sbjct: 268 LLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIG 327

Query: 292 IDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLV 351
           I++F ER IFQF+ISE L+KF+GDY +   L+ Y S+ LPLK T EDE EDE+FRSLHLV
Sbjct: 328 INVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLV 387

Query: 352 RNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNATNFNAXXXXXXXXXXXXXXXXFPXXX 411
           RNL GLEE DFDRFT+GKFDLLKSL++ DN+K A  F A                     
Sbjct: 388 RNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGT------DSVD 441

Query: 412 XXXXXXXXXXXXXXXQLDNGXXXXXXXXXXXXXXXXRKNLKDPKGKKYEDKDAKRL 467
                          + +N                    +K+PKGKKYEDKD ++L
Sbjct: 442 HGDSDEDLSSDESNSETENDSDDSQSSDEEPDEDTREHRIKEPKGKKYEDKDTRKL 497

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/402 (71%), Positives = 334/402 (83%), Gaps = 24/402 (5%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           M ++  F KL L +      +H N+RILDK+ H+IKTDE S++RGKTNKDKANRATVENV
Sbjct: 1   MVLDDDFQKLDLSN------NHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENV 54

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELV--- 117
           LDPRTMRFL+ L SRG++SD NGC+STGKEANVYHAFAG+   P E    DS + LV   
Sbjct: 55  LDPRTMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTY 114

Query: 118 ---------------KREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIW 162
                          ++EYA+KIYKTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIW
Sbjct: 115 DPYSNPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIW 174

Query: 163 AEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYY 222
           AEKEFRNLKRI+QS VIP P+PIEV++NVLVMEFLNRG+GFASPRLKD+PYKD  +I +Y
Sbjct: 175 AEKEFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHY 234

Query: 223 YHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKN 282
           YHTM+ Y+RLLYQVC+LVHADLSEYNT+VH ++LY+IDVSQSV+PEHPMSLDFLRMDIKN
Sbjct: 235 YHTMIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKN 294

Query: 283 INSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAED 342
           IN+YFE+ G+ IF ER+IFQF ISETLD F G+Y N+ DLR YV  NLPLK   +D+AED
Sbjct: 295 INNYFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAED 354

Query: 343 EVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKN 384
           E+FRSLHLVRNL GLEERDFDR+TDGKFDLLKSLIAHDN+KN
Sbjct: 355 EIFRSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKN 396

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/386 (74%), Positives = 334/386 (86%), Gaps = 14/386 (3%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS+E  F +L +  G    R+H N +ILDK+S+ IKTDELS TR K++KDKANRATVENV
Sbjct: 1   MSLEDQFDRLDISHG----REHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENV 56

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELV--- 117
           LDPRTMRFL+ +++RGV+S+ NGCLSTGKEANVYHAFAG       E+ +DSKD  V   
Sbjct: 57  LDPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAG-------ESIEDSKDGHVQGE 109

Query: 118 KREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSG 177
           K+E A+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QSG
Sbjct: 110 KKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSG 169

Query: 178 VIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVC 237
           VIP P+P+EV++NVLVMEFL+RG+GFASPRLKDH + DR EI +YYHTM+AY+RLLYQVC
Sbjct: 170 VIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVC 229

Query: 238 QLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPE 297
           +LVHADLSEYN IVH  +LY+IDVSQSV+PEHPMSLDFLRMDIKNIN+YFEK GIDIFPE
Sbjct: 230 RLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPE 289

Query: 298 RVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGL 357
           R+IFQF+ISETL+KF G+  +  DL +YVSK LP+KST  D  EDE+FRSLHLVRNL GL
Sbjct: 290 RLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGL 349

Query: 358 EERDFDRFTDGKFDLLKSLIAHDNKK 383
           EERDFDRFTDGKFDLLKSLIAHDN++
Sbjct: 350 EERDFDRFTDGKFDLLKSLIAHDNER 375

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/414 (68%), Positives = 335/414 (80%), Gaps = 33/414 (7%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60
           MS+E  F KL + +      +H+NS+IL+KY H+IKTDELS T+GKTNKDKANRATVENV
Sbjct: 1   MSLEGKFDKLKVHES-----EHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENV 55

Query: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNA------------------- 101
           LDPRTM+ L+ L++RGV+ + NGCLSTGKEANVYHAFAG+                    
Sbjct: 56  LDPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVL 115

Query: 102 ---------NQPSEEAEKDSKDELVKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 152
                      P+ ++E++      ++EYA+KIYKTSILVFKDRERYVDGEFRFRN+RSQ
Sbjct: 116 NKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQ 175

Query: 153 HNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHP 212
           HNPRKMIKIWAEKEFRNL+RI QSG+IP P+P+EV+ N+LVMEFL RG+GFASPRL+DH 
Sbjct: 176 HNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQ 235

Query: 213 YKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMS 272
           YK REEI YYYHT+VAY+RLLYQVC+LVHADLSEYNTIVH D+LY+IDVSQSV+PEHPMS
Sbjct: 236 YKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMS 295

Query: 273 LDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPL 332
           LDFLRMDIKN+N YFEK GIDIFPER+IFQF+IS  LDKF GD  +  DLR+Y++  LP+
Sbjct: 296 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPV 355

Query: 333 KSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNAT 386
           K T EDE +DE+FRSLHLVRNL+GLEERDFDRFTDGKFDLLK+LIA DN+KN T
Sbjct: 356 KCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFT 409

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/406 (69%), Positives = 338/406 (83%), Gaps = 26/406 (6%)

Query: 1   MSVEASFSKL----HLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTR-GKTNKDKANRA 55
           MSVE  F KL    H++D      D  N+++LDKY+H+IK D+ S ++  KT KDKANRA
Sbjct: 1   MSVEEKFEKLSIDHHVKD------DTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRA 54

Query: 56  TVENVLDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNA------NQPSEEA- 108
           TVENVLDPRTMRFL+ L++RG++SD NGCLSTGKEANVYHAFAG+         P EE+ 
Sbjct: 55  TVENVLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESL 114

Query: 109 -EKDSKDELV-------KREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 160
             + +++E         K+EYA+KI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK
Sbjct: 115 LARLTQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIK 174

Query: 161 IWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIK 220
           IWAEKEFRNLKRI+QSG +P P+P+EV++NVLVMEFLNRG+GFASPRL+D+PYKD + I+
Sbjct: 175 IWAEKEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIR 234

Query: 221 YYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDI 280
            YY T+VAYMRL+YQVC LVHADLSEYN +VH+DRLY+IDVSQSVQPEHPMSLDFLRMDI
Sbjct: 235 QYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDI 294

Query: 281 KNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEA 340
           KN+N YF K GIDIFPER+IFQF+ISE+LDKF+GDY + +DL +YV  NLP+K T +DE 
Sbjct: 295 KNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEM 354

Query: 341 EDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNAT 386
           EDEVFRSL+LVRNL GLEERDFDRFT+GKFDLLKSL+AHD +KN T
Sbjct: 355 EDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFT 400

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/368 (74%), Positives = 318/368 (86%), Gaps = 23/368 (6%)

Query: 40  LSLTRGKTNKDKANRATVENVLDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAG 99
           +S T+GKTNKDKANRATVENVLDPRTM+FL+ L SRGV+SD NGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 100 NA-------------NQPSEEAEKDSKDELV----------KREYAVKIYKTSILVFKDR 136
           ++             N   EEA K+  +  +          K+EYAVKI+KTSILVFKDR
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120

Query: 137 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEF 196
           ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QS VIP P+PIEV++NVL+MEF
Sbjct: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180

Query: 197 LNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRL 256
           LNRG+GFASPRL+D+PYKDREE+ +YYH  +AYMRL+YQVC+LVHADLSEYN ++H++ +
Sbjct: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240

Query: 257 YMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDY 316
           Y+IDVSQSV+PEHPMSLDFLRMDIKNIN YF++ GIDIFPERVIFQFIISETLDKF G+Y
Sbjct: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300

Query: 317 HNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSL 376
           ++  DLRDYV+K LP+K TA+DEAEDE+FRSL+LVRNL GLEERDFDR+TDGKFDLLKSL
Sbjct: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360

Query: 377 IAHDNKKN 384
           IAHDN+KN
Sbjct: 361 IAHDNEKN 368

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/385 (65%), Positives = 307/385 (79%), Gaps = 24/385 (6%)

Query: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRG-KTNKDKANRATVEN 59
           MS+E  F +LH+     +H+D  N+RIL+KY +RI+    +  +G KT KDK++RATVEN
Sbjct: 1   MSLETEFDRLHV----SKHQD--NTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVEN 54

Query: 60  VLDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKR 119
           VLDPRTM+FL  L +RGV+S+ NGC+S+GKEANVYHAF                     +
Sbjct: 55  VLDPRTMKFLSALTNRGVISEFNGCISSGKEANVYHAFGPEG-----------------Q 97

Query: 120 EYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 179
           E A+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIH SGV+
Sbjct: 98  ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGVV 157

Query: 180 PCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQL 239
           P   P+EV+SNVLVM+FLNRG+G  SPRLKD+ YKD  E+ +YY+  +AYMRLLYQVC+L
Sbjct: 158 PTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCRL 217

Query: 240 VHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERV 299
           VHADLSEYN +VH + L++IDVSQSV+P HPMSLDFLRMDIKNIN+YF K G+ +F ER+
Sbjct: 218 VHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQERM 277

Query: 300 IFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEE 359
           IFQFII+ETL+ FQGDY    DL +Y+ ++LPLK+  E   EDE+FRSLHLVR+L GLEE
Sbjct: 278 IFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLEE 337

Query: 360 RDFDRFTDGKFDLLKSLIAHDNKKN 384
           RDFDRFTDGKFDLLKSLIA+DN++N
Sbjct: 338 RDFDRFTDGKFDLLKSLIANDNERN 362

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 105/230 (45%), Gaps = 39/230 (16%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           LR L+++ V+  +   +  GKE+++Y             ++++   +++K     ++ +T
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQV-----------SDRNGTAKVMKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    K+   Y+      RNSR   N   + K+ A KEF  +  ++  G I  PQ     
Sbjct: 131 SFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQAYGCS 183

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            +V+VM+ +   +G+   RL++H     + I   Y  ++ ++  L     L+H D +E+N
Sbjct: 184 RHVVVMDLI---DGYPMRRLREH-----KNIPKLYSDLMTFIVKLAN-SGLIHCDFNEFN 234

Query: 249 TIVHHDR---------LYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++ +D            +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 235 IMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 100/229 (43%), Gaps = 39/229 (17%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAV-KIYK 127
           L+ L+++  +  + G +  GKE+++Y     N N               KR   + ++ +
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEGSDKNGN---------------KRVLKIHRLGR 129

Query: 128 TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEV 187
           TS    K+   Y+      R S    N   + K+ A KE++ +  ++  G    P+P + 
Sbjct: 130 TSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKG-FKVPEPFDN 182

Query: 188 RSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEY 247
             +V+VME +    G+   RL+ H     ++I   Y  ++ ++  L     L+H D +E+
Sbjct: 183 SRHVIVMELI---RGYPMRRLRKH-----KDIPKLYSDLMKFILQLAN-SGLIHCDFNEF 233

Query: 248 NTIVHHD-------RLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
           N ++  +          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 234 NIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 107/231 (46%), Gaps = 40/231 (17%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  L  +   +  GKE+++Y             ++K+  ++++K     ++ +T
Sbjct: 85  LKTMLNRDSLYSVGNTIGVGKESDIYKV-----------SDKNGVEKVMKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    ++   Y+      +NS++  N   + K+ A KE++ +  +H  G    P+P +  
Sbjct: 131 SFHTVRNNRDYLR-----KNSKNGANWMFLSKLAAAKEYQFMSLLHSRG-FRVPEPFDHS 184

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            ++++ME +    GF   RL+ H     + +   Y  ++ ++  L     L+H D +E+N
Sbjct: 185 RHIIIMELI---KGFPMTRLRKH-----QNVPKLYSDLMKFILELGN-SGLIHCDFNEFN 235

Query: 249 TIVHHDRL----------YMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++  D+L           +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 236 IMI-KDKLDGSDPNDTGFIVIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/228 (19%), Positives = 100/228 (43%), Gaps = 37/228 (16%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  +  + G +  GKE+++Y   A + N    +                ++ +T
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDGNPRVMKIH--------------RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    ++   Y+      RN++   N   + ++ A KE++ +  ++  G    P+P +  
Sbjct: 131 SFHTVRNNRDYL------RNTKQGVNWMYLSRLAANKEYQFMSMLYTKG-FEVPEPFDNS 183

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            +++VME +    G+   RL+ H     + I   Y  ++ ++  L     L+H D +E+N
Sbjct: 184 RHIIVMELI---KGYPMRRLRKH-----KNIPKLYSDLMNFIVKLGN-SGLIHCDFNEFN 234

Query: 249 TIV-------HHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++       +     +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 235 IMIKDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRFFKK 282

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 103/228 (45%), Gaps = 37/228 (16%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  +  +   +  GKE+++Y             ++K+ K  ++K     ++ +T
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKV-----------SDKNGKPRVMKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    ++   Y+      RNS    N   + ++ A KE++ +  ++  G    P+P +  
Sbjct: 131 SFHSVRNNRDYL------RNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNS 183

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            +++VME +    G+   RL+ H     + I   Y  ++ ++  L     L+H D +E+N
Sbjct: 184 RHIVVMELIE---GYPMRRLRKH-----KNIPKLYSDLMCFIVELAN-SGLIHCDFNEFN 234

Query: 249 TIVHHD-------RLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++ ++          +ID  Q V  +H  +  + + D+  I  +F+K
Sbjct: 235 IMIKNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/228 (19%), Positives = 105/228 (46%), Gaps = 36/228 (15%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  +  + G +  GKE+++Y             ++++  ++++K     ++ +T
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYRV-----------SDRNGTEKVMKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    K++  Y+      +N+++  N   + KI A KE++ +  +   G    P+  +  
Sbjct: 131 SFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKG-FDVPEAFDCS 184

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            + +VME +    G+   RL+ H     + I   Y  +++++  L     L+H D +E+N
Sbjct: 185 RHCIVMELI---KGYPMRRLRKH-----KNIPKLYSDLMSFIVKLGN-SGLIHCDFNEFN 235

Query: 249 TIV-------HHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++       +     +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 236 IMIKDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/228 (18%), Positives = 104/228 (45%), Gaps = 36/228 (15%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  +  + G +  GKE+++Y             ++K+   +++K     ++ +T
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQV-----------SDKNGVSKVMKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    ++   Y+      +N ++  N   + ++ A KE++ +  ++  G    P+P +  
Sbjct: 131 SFHTVRNNRDYLK-----KNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-FEVPEPFDNS 184

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            ++++M  +    G+   RL+ H       I   Y+ ++ ++  L     L+H D +E+N
Sbjct: 185 RHIIIMGLI---EGYPMRRLRKH-----NNIPKLYNDLMKFIVRLAN-SGLIHCDFNEFN 235

Query: 249 TIVHHD-------RLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++  +          +ID  Q +  +HP +  + + D+  I  +F+K
Sbjct: 236 IMIKDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 100/229 (43%), Gaps = 40/229 (17%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           LR ++SR  +  +   +  GKE++VY   A           KD    ++K     ++ +T
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRVSA-----------KDGSARVLKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIHQSGVIPCPQPIEV 187
           S    K+   Y+         R+Q      + ++ A KE++ +  +H  G    P+P + 
Sbjct: 131 SFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLHSKG-FTVPEPFDN 181

Query: 188 RSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEY 247
             ++++ME +   +G+    ++ H    +   K Y   M+  ++L      L+H D +E+
Sbjct: 182 SRHMILMELI---DGYPMRNMRLH----KNLPKLYSDLMLFIVKLANH--GLIHCDFNEF 232

Query: 248 NTIVHH-------DRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
           N ++ +       +   +ID  Q +  +H  +  F + D+  I  +F+K
Sbjct: 233 NIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK 281

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 95/229 (41%), Gaps = 38/229 (16%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           ++ +++R  +  +   +  GKE+++Y     N N    +  +              + +T
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIYKVSDRNGNAQVMKIHR--------------LGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    ++   Y+      ++SR   +   +  + A KE+  L  +H  G    P+  +  
Sbjct: 131 SFTSVRNNRDYL------KHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQVPEAFDNS 183

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            ++++MEF+    GF    L+ H       I   Y  ++ +   L +   L+H D +E+N
Sbjct: 184 RHMVLMEFIK---GFPMKNLRTH-----SNIPKLYSDLMKFAVDLAK-SGLIHCDYNEFN 234

Query: 249 TIVHHD--------RLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++              +ID  Q +  +HP +  F R DI+ I  +F+K
Sbjct: 235 IMIKDQDTTDSSDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 96/228 (42%), Gaps = 37/228 (16%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  +  +   +  GKE+++Y     N N    +                ++ +T
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIYKVSDKNGNPRVMKIH--------------RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    ++   Y+      +NS    N   + ++ A KE++ +  ++  G    P+P +  
Sbjct: 131 SFHSVRNNRDYL------KNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNS 183

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            +++VME +    G+   RL+ H     + I   Y  ++ ++  L     L+H D +E+N
Sbjct: 184 RHIVVMELI---EGYPMRRLRKH-----KNIPKLYSDLMCFVVELAN-SGLIHCDFNEFN 234

Query: 249 TIV-------HHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            +V             +ID  Q V  +H  +  + + D+  I  +F+K
Sbjct: 235 IMVKDKVEDEQDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/229 (20%), Positives = 100/229 (43%), Gaps = 40/229 (17%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ L+ +  +  +   +  GKE+++Y        Q S+ A +     LV + +  ++ +T
Sbjct: 85  LKSLLEKNAIYSVGNTIGVGKESDIY--------QVSDAASQ----SLVMKIH--RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQH-NPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEV 187
           S    K +  Y+         R Q  N  ++  + AE+E+  +  ++  G    P+P   
Sbjct: 131 SFHTVKTKREYL--------KRGQSANWMRLSHLSAEREYAYMCLLYSKG-FSVPKPYAN 181

Query: 188 RSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEY 247
             + +VME++    G+   RL+ H       +   Y  ++A++  L     ++H D +E+
Sbjct: 182 SRHAIVMEYI---RGYPMRRLRSH-----SNVPKLYSDLMAFVVKLAN-HGMIHCDFNEF 232

Query: 248 NTIVHHD-------RLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
           N ++  D          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 233 NIMIKDDIDDPEDQGFVVIDFPQCISIQHQEAEYYFKRDVDCIRRFFKK 281

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/229 (19%), Positives = 100/229 (43%), Gaps = 40/229 (17%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  +  +   +  GKE++VY   A           KD    ++K     ++ +T
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRVSA-----------KDGTPRVLKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIHQSGVIPCPQPIEV 187
           S    K+   Y+         R+Q      + ++ A KE++ +  ++  G +  P+P + 
Sbjct: 131 SFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLYSKGFV-VPEPFDN 181

Query: 188 RSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEY 247
             ++++M+ +   +G+   R++ H    +   K Y   M   ++L      L+H D +E+
Sbjct: 182 SRHMILMQLI---DGYPMRRMRSH----KNLPKLYSDLMSFIVKLANH--GLIHCDFNEF 232

Query: 248 NTIVHHD-------RLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
           N ++ +           +ID  Q +  +H  + ++ + D+  I  +F K
Sbjct: 233 NIMIKNKVTDADDCGFIVIDFPQCISIQHQDAEEYFKRDVDCIRRFFAK 281

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/228 (18%), Positives = 94/228 (41%), Gaps = 38/228 (16%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  +  +   +  GKE+++Y     N N    +                ++ +T
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIYQVSDRNGNSRVMKIH--------------RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    K+   Y+ G       R   +   + ++ A KE++ +  ++  G    P+P +  
Sbjct: 131 SFQTVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLLYSKG-FKVPEPFDNS 182

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            ++++ME +    G+   RL+ H     +  K Y   M   + L      L+H D +E+N
Sbjct: 183 RHIILMELI---KGYPMRRLRKH----HDLPKLYSDLMCFIVNLANH--GLIHCDFNEFN 233

Query: 249 TIVHHD-------RLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++  +          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 234 IMIKDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKK 281

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/229 (19%), Positives = 98/229 (42%), Gaps = 39/229 (17%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  +  +   +  GKE+++Y     N N    +                ++ +T
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGNPRVMKIH--------------RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    ++   Y+      + S    N   + ++ A KE++ +  ++  G    P+P +  
Sbjct: 131 SFHSVRNNRDYL------KKSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNS 183

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            +++VME +    G+   RL+ H     + I   Y  ++ ++  L     L+H D +E+N
Sbjct: 184 RHIVVMELI---EGYPMRRLRKH-----KNIPKLYSDLMCFIVDLAN-SGLIHCDFNEFN 234

Query: 249 TIVHHDRL--------YMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++  D+L         +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 235 IMI-KDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/228 (18%), Positives = 100/228 (43%), Gaps = 37/228 (16%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           ++ +++R  +      +  GKE+++Y             ++K+   +++K     ++ +T
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDIYQV-----------SDKNGVAKVMKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    K+   Y+      + +    N   +  + A+KE++ +  ++  G I  PQP +  
Sbjct: 131 SFHTVKNNRDYL------KKNAHGTNWMHLSLLAAQKEYQFMSLLYSKGFI-VPQPYDNS 183

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            ++++ME ++   GF    L++H       I   Y  ++ +   L     L+H D +E+N
Sbjct: 184 RHIVLMELID---GFPMRNLRNH-----SNIPKLYSDLMTFAVKLAN-SGLIHCDFNEFN 234

Query: 249 TIVHHD-------RLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++ +           +ID  Q +  +H  +  + + DI+ I  +F K
Sbjct: 235 IMIKNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIECIRRFFRK 282

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/230 (18%), Positives = 105/230 (45%), Gaps = 42/230 (18%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ L+++  L  +   +  GKE+++Y            +    + + LV + +  ++ +T
Sbjct: 85  LKSLLNKNALYSVGNTIGVGKESDIY------------QVSTSTSEALVMKIH--RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    K+   Y+    R +++   H    +  + A KE++ +  ++  G    P+P +  
Sbjct: 131 SFHTVKNNRDYLK---RGQSASWMH----LSSLAANKEYQFMNLLYSKG-FKVPRPYDNS 182

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQ--LVHADLSE 246
            ++++ME++    G+   RL++H     +++   Y  +   M+ + Q+    L+H D +E
Sbjct: 183 RHIILMEYI---KGYPMRRLREH-----KDLPRLYSEL---MKFIVQLGNHGLIHCDFNE 231

Query: 247 YNTIVHHDR-------LYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
           +N ++             +ID  Q +  +H  +  + + D++ I  +F+K
Sbjct: 232 FNIMIKDKTDGPDDLGFIVIDFPQCISIQHKDAEYYFQRDVECIRRFFKK 281

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/228 (17%), Positives = 101/228 (44%), Gaps = 37/228 (16%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ L+++  +  +   +  GKE+++Y A           ++++ +  ++K     ++ +T
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQA-----------SDRNGEHRVMKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    K+   Y+      +      +   + ++ A KE++ +  ++  G    P+  +  
Sbjct: 131 SFHTVKNNRDYL------KKYNQGASWMFLSRVAANKEYQFMSLLYSKG-FTVPKAFDNS 183

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            +++VME +    GF   RL+ H     + I   Y  ++ ++  L     L+H D +E+N
Sbjct: 184 RHIVVMELI---KGFPLRRLRKH-----DNIPKLYSDLMCFIVNLAN-SGLIHCDFNEFN 234

Query: 249 TIVHHDR-------LYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++  ++         +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 235 IMIKDEKDDENDCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRFFKK 282

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 99/228 (43%), Gaps = 38/228 (16%)

Query: 69  LRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKREYAVKIYKT 128
           L+ +++R  L  +   +  GKE+++Y             +++  + +++K     ++ +T
Sbjct: 85  LKSMLNRDTLYSVGTTIGVGKESDIYQV-----------SDRSGESKVLKIH---RLGRT 130

Query: 129 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVR 188
           S    K+   Y+      RN +S  +   + K+ A KE++ +  ++       PQP +  
Sbjct: 131 SFHTIKNNRDYL------RNGQSA-SWMHLSKLAANKEYQFMTMLYDRN-FEVPQPFDNS 182

Query: 189 SNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYN 248
            + ++ME +    G+   RL  H    +   K Y   M   ++L      L+H D +E+N
Sbjct: 183 RHCVLMEHI---RGYPMRRLGKH----KNLPKLYSDLMCFIVKLANH--GLIHCDFNEFN 233

Query: 249 TIVHHD-------RLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEK 289
            ++  +          +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 234 IMIKDEPEGEDDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 72/137 (52%), Gaps = 26/137 (18%)

Query: 125 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIH--QSGVIPCP 182
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+   ++G    P
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRVKLIENG----P 364

Query: 183 QPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHA 242
           + I++  ++++M+   + +G        H   + +E+   +  M+    +L  +C+LV  
Sbjct: 365 RCIDL--DIVMMK---KSDG-------QHVLWNSDELVIPHSRMLERTFVLEPLCELVA- 411

Query: 243 DLSEYNTIVH---HDRL 256
             SE + I     HDRL
Sbjct: 412 -FSEVHPITGEFLHDRL 427

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 130 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 179
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  +  S VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>Kpol_1029.17 s1029 (32401..36405) [4005 bp, 1334 aa] {ON}
           (32401..36405) [4005 nt, 1335 aa]
          Length = 1334

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 173 IHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRL 232
           IH SG+I  P+ +E  +N++ +E  +R   FA   +  HP   +E    Y + M+ Y  +
Sbjct: 314 IHDSGLIESPRTVEDDANIIDIESKSRYLNFAKTFISSHPTIAQE----YVNKMIMYPEM 369

>KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]
           {ON} uniprot|O60042 Kluyveromyces lactis GSK-3 Protein
           kinase
          Length = 415

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query: 207 RLKD----HPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYM---- 258
           RLK+    H   DR EIK Y   +   +  L+QV  + H D+   N +V  D L +    
Sbjct: 171 RLKEFISLHQPMDRYEIKIYMFQLFKSLNYLHQVVNVCHRDIKPQNILVDPDTLLLKICD 230

Query: 259 IDVSQSVQPEHP 270
           +  ++ ++P  P
Sbjct: 231 LGSAKQLKPNEP 242

>TPHA0B00340 Chr2 complement(67479..72254) [4776 bp, 1591 aa] {ON}
            Anc_4.373 YJR138W
          Length = 1591

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 12/98 (12%)

Query: 85   LSTGKEANVYHAF--AGNANQPSEEAEKDSKDELVKREYAVKIYKTSILVFKDRERYVDG 142
            L +   +N +H F     A  P EEA+ + K+ L K ++   IY     + K  +  +D 
Sbjct: 1420 LCSIPASNPFHTFIEVKLAINPFEEADLNIKNMLTKNKFYYHIY-----LLKKSDFLLDN 1474

Query: 143  -EFRFRNSRSQHNPRKMIKI-WAEKEFRNLKRIHQSGV 178
              F F N     N   +IK  W    F+N + IH+SG 
Sbjct: 1475 RAFHFLN---DENSSFVIKYSWGAPTFKNAQYIHKSGA 1509

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,222,651
Number of extensions: 2100773
Number of successful extensions: 6742
Number of sequences better than 10.0: 58
Number of HSP's gapped: 6884
Number of HSP's successfully gapped: 61
Length of query: 500
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 386
Effective length of database: 40,409,475
Effective search space: 15598057350
Effective search space used: 15598057350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)