Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02464g5.431ON56355027970.0
KLTH0F16126g5.431ON55454716630.0
Kwal_55.214375.431ON55454716300.0
Suva_8.1715.431ON56755414600.0
YOR118W (RTC5)5.431ON56755114520.0
Smik_15.2965.431ON56655014400.0
KLLA0E21143g5.431ON57255214380.0
NCAS0H020505.431ON57355714170.0
TDEL0E019405.431ON56755213940.0
Ecym_47645.431ON56655513620.0
Skud_15.2815.431ON56753913490.0
NDAI0C016105.431ON58457313480.0
ZYRO0F09966g5.431ON55455312621e-168
TPHA0H017905.431ON56555112451e-165
Kpol_1016.75.431ON56254912151e-161
KNAG0B042305.431ON57755211441e-150
AER258C5.431ON55754710821e-141
CAGL0L11616g5.431ON55555410591e-137
TBLA0A065305.431ON4925266729e-81
KNAG0L020705.695ON85158751.7
SAKL0G13816g5.165ON64472723.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02464g
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...  1082   0.0  
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   645   0.0  
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   632   0.0  
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   566   0.0  
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   563   0.0  
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   559   0.0  
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   558   0.0  
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   550   0.0  
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   541   0.0  
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   529   0.0  
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   524   0.0  
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   523   0.0  
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   490   e-168
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   484   e-165
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   472   e-161
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   445   e-150
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   421   e-141
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   412   e-137
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   263   9e-81
KNAG0L02070 Chr12 (368525..371080) [2556 bp, 851 aa] {ON} Anc_5....    33   1.7  
SAKL0G13816g Chr7 (1183028..1184962) [1935 bp, 644 aa] {ON} simi...    32   3.3  

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 1082 bits (2797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/550 (95%), Positives = 523/550 (95%)

Query: 14  NVLQFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNE 73
           NVLQFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNE
Sbjct: 14  NVLQFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNE 73

Query: 74  LLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYI 133
           LLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYI
Sbjct: 74  LLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYI 133

Query: 134 ALALRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCT 193
           ALALRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPAD             RHCT
Sbjct: 134 ALALRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADSMLQLLTLSLVLSRHCT 193

Query: 194 VNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVL 253
           VNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVL
Sbjct: 194 VNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVL 253

Query: 254 KPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVG 313
           KPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVG
Sbjct: 254 KPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVG 313

Query: 314 RESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQH 373
           RESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQH
Sbjct: 314 RESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQH 373

Query: 374 IIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTL 433
           IIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTL
Sbjct: 374 IIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTL 433

Query: 434 GGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXXX 493
           GGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPG          
Sbjct: 434 GGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGTLMTKLEEEK 493

Query: 494 XXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGL 553
               YKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGL
Sbjct: 494 TTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGL 553

Query: 554 VGQHQSGGSM 563
           VGQHQSGGSM
Sbjct: 554 VGQHQSGGSM 563

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/547 (55%), Positives = 416/547 (76%), Gaps = 9/547 (1%)

Query: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76
            FES++DLL ++  +A K  +TPELV++K N+ GK  +  ++ +E++++L++   NE + 
Sbjct: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76

Query: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136
            LL NC++TL+NFPLI++ Y+++T  G+LKSC+LL+ +RC++YV  K Y+  KL+YI+LA
Sbjct: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136

Query: 137 LRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCTVNN 196
           L K VKE+ S P+     DA  +I  +N+V  ++L VPA+             +   + N
Sbjct: 137 LNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATVIKN 196

Query: 197 AKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVLKPL 256
           +++  ++ + WD +K  A+++LRTMN DI+ +QD ++ VIS+ QF N I++V P +L PL
Sbjct: 197 SRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPL 256

Query: 257 EILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVGRES 316
           E L+EH+L+L+RDL D   S  +   SKLVTEPLLAQL+T+ P+ELV+S+L+KLYVGR+S
Sbjct: 257 ECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDS 316

Query: 317 GFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQHIID 376
           GFSMRSFQ+KAFKWMAPSILL+ G RI DDQ+YA  KN RYKKFL+EYPRLKD+DQHI+ 
Sbjct: 317 GFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHIL- 375

Query: 377 PCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTLGGG 436
           P    +RKLLFA+ +NEPWKVTN ELFGD+KTT+VQLSP QE++KA + GNVYFNTLGGG
Sbjct: 376 PALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLGGG 435

Query: 437 IGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXXXXXX 496
           IG+G  QP+IK +G K+ PGNVSLTID +LEFA+FR+VG+GG+I+P              
Sbjct: 436 IGIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS--------NTPTS 487

Query: 497 XYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGLVGQ 556
            +KF++QD+E WGCGGEKEL+EQ+K WEWEEAEA+RRQRINL+S+ +DRALLE+AGLVGQ
Sbjct: 488 EHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGLVGQ 547

Query: 557 HQSGGSM 563
           +QSGGS+
Sbjct: 548 NQSGGSV 554

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/547 (55%), Positives = 409/547 (74%), Gaps = 9/547 (1%)

Query: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76
           QF S+ D++ +F  +A K  T+PELV+FK+N+ GKD +D V+ +E+L++L++   NE ++
Sbjct: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76

Query: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136
            L+ NC++TLSNFP IR+ Y++IT +GLLKSC+LL+  RC+ YV  K YD  KL+YI+LA
Sbjct: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136

Query: 137 LRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCTVNN 196
           L KTVKE+ SS +  +  DA  II  +NSV +++L VP++             +   + N
Sbjct: 137 LNKTVKEVSSSSNSQESLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTIIKN 196

Query: 197 AKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVLKPL 256
           +K+  +V + W+ ++  A+++LRTMN +I    D ++  I+F QF + I+ V P +L P 
Sbjct: 197 SKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLLPF 256

Query: 257 EILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVGRES 316
           E L+EH+L+L RDL D   S      SKLV+EPLLAQL+T+ P+ELV+S+L+KLYVGR+S
Sbjct: 257 ESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGRDS 316

Query: 317 GFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQHIID 376
           GFSMRSFQ+KAFKWMAPSILLI G+RI +D+EYA +KN RYK FLEEYPRLK++DQ ++ 
Sbjct: 317 GFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQVLLP 376

Query: 377 PCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTLGGG 436
           P S  ++KLLFAVYVN PWKVTN ELFGDLKTT++QLSP QE++KA R GN+YFNTLGGG
Sbjct: 377 PFS-GKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLGGG 435

Query: 437 IGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXXXXXX 496
           IGVG  QP++KP  +KY PGNVSLTID +LEFA FR  G+GG+I P              
Sbjct: 436 IGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPS--------STIVN 487

Query: 497 XYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGLVGQ 556
            +KF++QD+E WGCGGEKEL+EQ+K WEWEEAEA+RRQRINL+SI +DRALLEMAGLVGQ
Sbjct: 488 EHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAGLVGQ 547

Query: 557 HQSGGSM 563
           +QSGGS+
Sbjct: 548 NQSGGSI 554

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/554 (51%), Positives = 389/554 (70%), Gaps = 7/554 (1%)

Query: 14  NVLQFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNE 73
           N+ +F +  D+L YF  +A +Q T PELV+ K NL+ +D N  +S + +  +L  P  + 
Sbjct: 17  NLRKFTNNGDVLAYFNHKAQQQVTVPELVSLKGNLQIEDMNTPISHKSLCSVLHFPQKHT 76

Query: 74  LLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYI 133
           LL+ ++ N ++ LSNFPL+  SY+ IT  GLLK  +LL+  RC KY+ FK+YDQLKL++I
Sbjct: 77  LLSGIVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGRCGKYLKFKSYDQLKLLFI 136

Query: 134 ALALRKTVKELPSSPDPA---KPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXR 190
           +L+L+KT KE  S  +     K  + K II N++ VD + LYVPAD              
Sbjct: 137 SLSLQKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVLYVPADFMLQFLSWLLILSV 196

Query: 191 HCTVNNAKIRES-VFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVF 249
            C  +N+K+  S ++  WD +K +AMNLLRTMNPD+V+  +T   +I+F+QFS +I  V 
Sbjct: 197 ECPTSNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVS--NTESHLITFDQFSTSIRTVM 254

Query: 250 PQVLKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRK 309
           P +LKPLE L+EH  YL+ DL +   S S    S+++T  LL QLST+LP+EL   KL+ 
Sbjct: 255 PNLLKPLENLMEHFFYLENDLVNYDTSLSSVRDSRIMTPALLTQLSTVLPRELFIQKLQS 314

Query: 310 LYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKD 369
           LY+GR+SGFSMRS Q+K FKWMAPSIL++ G RIT+  EYA  KNPRY+ FLEE+P+LKD
Sbjct: 315 LYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDEYAAQKNPRYRHFLEEFPKLKD 374

Query: 370 KDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVY 429
            DQ  +D    N++K  FAVY+++PWKVTNK+ FGD+ T ++Q+SP+Q+++K  R G +Y
Sbjct: 375 SDQK-MDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISPRQDIYKVNRKGTIY 433

Query: 430 FNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXX 489
           FNT+GGGIG+G  QP+IKP  K++ PGNVSLT DS+LEFA FRH GYGG++ PG      
Sbjct: 434 FNTIGGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLEFAVFRHTGYGGSLEPGSLSVER 493

Query: 490 XXXXXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLE 549
                     F++QDVEVWGCGGEKEL+EQ+KQ  WEEAE+KRRQ+INL+S+GEDRALLE
Sbjct: 494 KEEDSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRRQQINLRSLGEDRALLE 553

Query: 550 MAGLVGQHQSGGSM 563
           MAGLVGQ++ GGSM
Sbjct: 554 MAGLVGQNRGGGSM 567

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/551 (52%), Positives = 381/551 (69%), Gaps = 7/551 (1%)

Query: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76
           +F +  D+L YF  +A +Q T PELV+FK NL+ +D N  +S + +   L  P  + ++ 
Sbjct: 20  KFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIV 79

Query: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136
            ++ N ++ LSNFPL++ SY+ IT  GLLK  +LL+  RC K++  K+YDQLKL++I+L+
Sbjct: 80  GIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLS 139

Query: 137 LRKTVKEL---PSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCT 193
           L+KT KE     S  D  K    K II  ++ VD + L +PAD               C 
Sbjct: 140 LQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCP 199

Query: 194 VNNAKIRES-VFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQV 252
             N+K+  +     W ++K +A+NLLRTMNPD+V   D     I+F+QFS AI  V P +
Sbjct: 200 TTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIRTVMPNL 257

Query: 253 LKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYV 312
           LKPLE L+EH  YL  DL D   + S    SK++T  LLAQLST LPKEL   KL+ LY+
Sbjct: 258 LKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYI 317

Query: 313 GRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQ 372
           GR+SGFSMRS Q+K FKWMAPSIL++ GMRIT+ +EYA  KNPRY+ FLEE+P+LK+ DQ
Sbjct: 318 GRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQ 377

Query: 373 HIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNT 432
            ++D   LN+RK  FAVY+++PWKVTNK+ FGDL T ++++SP+Q+++K  + G +YFNT
Sbjct: 378 -MMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNT 436

Query: 433 LGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXX 492
           +GGGIG+G  QP+IKP  K+Y PGNVSLT DS+LEFA FR+ GYGG++ PG         
Sbjct: 437 IGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEE 496

Query: 493 XXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAG 552
                  F++QDVEVWGCGGEKEL+EQIKQ EWEEAE+KRRQ+INL+S+GEDRALLEMAG
Sbjct: 497 NSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQINLRSLGEDRALLEMAG 556

Query: 553 LVGQHQSGGSM 563
           LVGQHQ GGSM
Sbjct: 557 LVGQHQGGGSM 567

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/550 (51%), Positives = 376/550 (68%), Gaps = 6/550 (1%)

Query: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76
           +F +  D+L YF  +A +Q T PELV+ K NL+ ++ N  +S + +   L  P  + ++ 
Sbjct: 20  KFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIV 79

Query: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136
            ++ N ++ LSNFPL+  SY+ IT  GLLK  +LL+  RC K++  K+YDQLKL++I+L+
Sbjct: 80  GIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLS 139

Query: 137 LRKTVKELPSSPDP---AKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCT 193
           L+KT KE  S  +     K  + K II  ++ VD + LY+PAD               C 
Sbjct: 140 LQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECP 199

Query: 194 VNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVL 253
             N+ I       WD +K  AMNLLRTMNPD+VN  ++    I+++QFS AI  V P +L
Sbjct: 200 TTNSTINNETNVQWDKFKIPAMNLLRTMNPDVVNNIES--HFITYQQFSTAIRTVMPNLL 257

Query: 254 KPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVG 313
           KPLE L+EH LYL  DL D   + S    SK++T  LLAQLST LPKEL   KL+ LY+G
Sbjct: 258 KPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIG 317

Query: 314 RESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQH 373
           R+SGFSMRS Q+K FKWMAPSIL++ G+RIT+ +EYA  KNPRY+ FLEE+P LKD DQ 
Sbjct: 318 RKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQK 377

Query: 374 IIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTL 433
            +D   +N++K  FAVY+++PWKVTNK+ FGDL T ++Q+SP+Q+++K  + G VYFNT+
Sbjct: 378 -MDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTI 436

Query: 434 GGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXXX 493
           GGGIG+G  QP+IK   K+Y PGNVSLT DS+LEFA FR+ GYGG++ PG          
Sbjct: 437 GGGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEEN 496

Query: 494 XXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGL 553
                  ++QDVEVWGCGGEKEL+EQIKQ  WEEAE+KRRQ+INL+S+GEDRALLEMAGL
Sbjct: 497 SSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGL 556

Query: 554 VGQHQSGGSM 563
           VGQHQ GGSM
Sbjct: 557 VGQHQGGGSM 566

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/552 (52%), Positives = 389/552 (70%), Gaps = 15/552 (2%)

Query: 24  LLGYFAARATKQFTTPELVAFKSNL-KGKDQNDKVSVEEMLQLLKIPLGNELLADLLHNC 82
           L+ +F  R  KQ TT EL++FK+N+ +GK+ ND V V ++ ++  IP  + ++  +  N 
Sbjct: 24  LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNM 83

Query: 83  IKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALALRKTVK 142
             TL+NFPL+++SY+ +T   LLK+ +LL  +R IKY  +K Y+ LK+++I L+L K +K
Sbjct: 84  FHTLANFPLLQDSYEKVTFKTLLKATLLLVKERAIKYTDWKKYNDLKMLFITLSLEKNIK 143

Query: 143 ELP----SSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCTVNNAK 198
             P    S+    K W  K +IR+YN  D D+L V A+             R C +NN K
Sbjct: 144 AEPLMDSSALSDCKDW--KGVIRSYNGTDFDELKVNANNLLHFLALILALSRCCILNNCK 201

Query: 199 IRESVF-QHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVLKPLE 257
           I   V  +  +D+K  A+N++RTMNP+I++  D +   I++ QFS A+  V P +L PL+
Sbjct: 202 IDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLK 261

Query: 258 ILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVGRESG 317
           +L+EH+LY+DRDL D      + + +K+V E  L+QL+T LPKE+V+S+ +KLYVGRESG
Sbjct: 262 MLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESG 321

Query: 318 FSMRSFQSKAFKWMAPSILLIGGMRITD----DQEYATTKNPRYKKFLEEYPRLKDKDQH 373
           FSMRSFQSK FKWMAP+IL + GMRI D    D +    KNPRY+ FL+EY +LK +DQH
Sbjct: 322 FSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAVKNPRYRNFLQEYGKLKSEDQH 381

Query: 374 IIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKA--VRTGNVYFN 431
           + D  S  +RKLLFAV + +PWKV+NK+LFGD  T ++QL P+QE+F A   +TGNVYFN
Sbjct: 382 L-DTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFN 440

Query: 432 TLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXX 491
           T+GGGIG+G +QP+IK NGKKYFPGNVSLTIDSSLEF  FRH+G GG+  PG        
Sbjct: 441 TVGGGIGIGSSQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGE 500

Query: 492 XXXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMA 551
                 Y+FI+QDVEVWGCGGEKEL+EQ+KQW+WEEAEAKRRQ+INLQS+GEDRALLEMA
Sbjct: 501 ERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMA 560

Query: 552 GLVGQHQSGGSM 563
           GLVGQHQSGGS+
Sbjct: 561 GLVGQHQSGGSI 572

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/557 (50%), Positives = 370/557 (66%), Gaps = 17/557 (3%)

Query: 16  LQFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDK------VSVEEMLQLLKIP 69
           + F S+ +L   F  R    FT  ELVAFK  + G +Q D       +S  E+  LL +P
Sbjct: 25  ITFNSEEELRESFKRRILCHFTPLELVAFKKKI-GHEQTDSEAGVEYISKNELTNLLHLP 83

Query: 70  LGNELLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLK 129
             N LL DL +  I  LSNFPL+RE   ++T  GLL   ILLS +RC +++G   YDQL 
Sbjct: 84  RENVLLVDLTYKLIAILSNFPLLREPQTEVTEIGLLMCIILLSKERCHRFIGSNTYDQLG 143

Query: 130 LIYIALALRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXX 189
           LI+IA++L    K LP +  P K  + + ++R ++++ ID+L +PA              
Sbjct: 144 LIFIAMSLDYADKLLPYARTPKK-LNVEELLRTFDNIPIDELEIPAPVLLQFLSWGLLLL 202

Query: 190 RHCTVNNAKIR--ESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAA 247
             C  +N +++     +Q+W  Y+  A N++R+M+  I+     V+  I++ QFS+   A
Sbjct: 203 IKCPTSNCQLKPINEFYQNWSSYEKAAKNIIRSMDQSIIRNLTDVR--INYTQFSDVFKA 260

Query: 248 VFPQVLKPLEILVEHMLYLDRDLTDELNSTSMP-STSKLVTEPLLAQLSTMLPKELVYSK 306
           V P    PLE L+ H+LY+D DL D     +MP + SKL++EPLLAQL+T+LPKEL  SK
Sbjct: 261 VLPNFTTPLESLMGHLLYMDSDLIDH---ETMPMNNSKLMSEPLLAQLATVLPKELFLSK 317

Query: 307 LRKLYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPR 366
           L+KLYVGRESGFSMRS QSK F W APSILL+ GM I+DD +YA  KNPRY KFLE+YP+
Sbjct: 318 LQKLYVGRESGFSMRSLQSKCFNWEAPSILLVSGMLISDDLQYAKEKNPRYGKFLEQYPK 377

Query: 367 LKDKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTG 426
           LK++ QH+ D C   R+K  FAVY+++PW+VTNKE FG + + ++QL+P+Q++F A +  
Sbjct: 378 LKEEQQHL-DACHSQRKKATFAVYIDDPWRVTNKEFFGSMNSMIIQLAPRQDVFHASKPN 436

Query: 427 NVYFNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXX 486
            +YFNT+GGGIG G  QP+I    KKY PGNVSLTIDS+LEFA FRH+GYGGA  P    
Sbjct: 437 MIYFNTVGGGIGFGNKQPLISNAHKKYIPGNVSLTIDSTLEFAVFRHIGYGGAFKPSALL 496

Query: 487 XXXXXXXXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRA 546
                       KFI+QDVEVWGCGGEKELQEQIK+ EWEEAEAKRRQ INL+S+GEDRA
Sbjct: 497 TKRGKEDESFEIKFIIQDVEVWGCGGEKELQEQIKKLEWEEAEAKRRQHINLKSLGEDRA 556

Query: 547 LLEMAGLVGQHQSGGSM 563
           LLEMAGLVGQ QSGGSM
Sbjct: 557 LLEMAGLVGQSQSGGSM 573

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/552 (50%), Positives = 374/552 (67%), Gaps = 9/552 (1%)

Query: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76
           QF S  +L+ +F  RA   FT  EL AFKS L+GK   D V  EE+ + L+IP  N LL 
Sbjct: 20  QFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLC 79

Query: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136
           + ++  ++ LSNFPL+++S+DD+T  GLLKS +L +  +C KYVG KNYD +KL++IAL+
Sbjct: 80  EAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALS 139

Query: 137 LRKTVKELPSSPDPAKPWDAK---SIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCT 193
           +RK+VKE PS        D     +++R YN++ +DDL +PA               +C 
Sbjct: 140 MRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCP 199

Query: 194 VNNAKIRESV-FQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQV 252
            +N +  E V +  W  +K  A NLLRTMN +IV   ++    + FEQFS AI+ V P +
Sbjct: 200 TSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS--VKFEQFSKAISTVMPNI 257

Query: 253 LKPLEILVEHMLYLDRDLTDELNSTSMPS-TSKLVTEPLLAQLSTMLPKELVYSKLRKLY 311
            + L+ ++EH+LY D DL    ++++ P  TSK  T+ +LAQL T L  E+ ++K + LY
Sbjct: 258 FRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALSNEMTFAKFQNLY 317

Query: 312 VGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKD 371
           VGRESGFSMRS Q+K FKWMAP+++L+ G  + DD+++ + KN RY+ FL +YP+LKD+D
Sbjct: 318 VGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDF-SKKNSRYRDFLSKYPKLKDRD 376

Query: 372 QHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFN 431
           QH+ D    N+ K++FAVY+ EPWK TNK+ FG   TT+VQLSP Q++FKA     +YFN
Sbjct: 377 QHLSD-LQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFN 435

Query: 432 TLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXX 491
           TLGGGIG+G  QP IK   K Y PGNVSLTIDS+LEFA+FRHVGYGG  +PG        
Sbjct: 436 TLGGGIGIGNNQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNR 495

Query: 492 XXXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMA 551
                  KF++QDVEVWGCGG++EL+EQ K+W+WEEAEAKRRQ INL+S GEDRALLEMA
Sbjct: 496 EDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMA 555

Query: 552 GLVGQHQSGGSM 563
           GLVG  Q+GGSM
Sbjct: 556 GLVGHSQNGGSM 567

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/555 (47%), Positives = 369/555 (66%), Gaps = 12/555 (2%)

Query: 16  LQFESQHDLLGYFAARATKQFTTPELVAFKSNLK-GKDQNDKVSVEEMLQLLKIPLGNEL 74
           L F  + ++L +F  +A +Q    ELVAF++N+    D  D +S E ++QL K+P     
Sbjct: 17  LIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYG 76

Query: 75  LADLLHNCIKTLSNFPLIR--ESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIY 132
              + +  I   S FPL+      D  T  GL+K+C+L  + + +KY   K YDQ+ LI+
Sbjct: 77  FVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIF 136

Query: 133 IALAL----RKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXX 188
           I LAL    + + KEL   P     +DA+ I+ ++N ++++ + V AD            
Sbjct: 137 ILLALEPHAKVSKKELGRPPSS---YDARKIMESFNDINLETIEVSADDLLQFMTFLLVI 193

Query: 189 XRHCTVNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAV 248
            ++C   N ++  S++++W DY++ A+N+LRTMNP IV+  D  + V++  QF + I AV
Sbjct: 194 TKYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAV 253

Query: 249 FPQVLKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLR 308
            P +L PL + ++H+LY    L  +  +T    +S ++T+PLLAQL T+ PK ++Y  L+
Sbjct: 254 CPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLK 313

Query: 309 KLYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLK 368
           KL++ ++SGFS+RSFQ+K   WMAPSILL+ GM+I DD +    KN RYK FL+EYP+LK
Sbjct: 314 KLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKL-LAKNQRYKSFLQEYPKLK 372

Query: 369 DKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNV 428
           D+DQ   D     +RK+ FAV+V+E WKVTNKE FG+LKT ++QLSP+QE+F+A + GN+
Sbjct: 373 DEDQK-ADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNI 431

Query: 429 YFNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXX 488
           YFNT+GGGIG+G +QPVIK +GKKYFPGNVSLTID S EF  FR+VG+GG+ISPG     
Sbjct: 432 YFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFLE 491

Query: 489 XXXXXXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALL 548
                     +FI+QDVEVWGCGG+KE + Q+KQWEWEEAE++RRQ INL SIGED+ALL
Sbjct: 492 RPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALL 551

Query: 549 EMAGLVGQHQSGGSM 563
           EM GLVG HQSGGS+
Sbjct: 552 EMVGLVGHHQSGGSL 566

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/539 (50%), Positives = 365/539 (67%), Gaps = 7/539 (1%)

Query: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76
           +F +  D+L YF  +A +Q T PELV+FK NL+ ++ N  +S + +  +L  P  + ++ 
Sbjct: 20  KFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVV 79

Query: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136
            ++ N ++ LSNFPLI  SY+ IT  GLLK  +LL+  RC K++  K+YDQLKL++I+L+
Sbjct: 80  GIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLS 139

Query: 137 LRKTVKELPSSPDPAKPW---DAKSIIRNYNSVDIDDLYVPADXXXXXXX-XXXXXXRHC 192
           L+KT KE  S  +          K II +++ VD + L +PAD              +  
Sbjct: 140 LQKTDKEELSEENEENINRERHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFP 199

Query: 193 TVNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQV 252
           T N+    +  ++ WD +K +AMNLLRTMNPD+V+  ++    I+FEQFS AI  V P +
Sbjct: 200 TTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVES--HFITFEQFSTAIRTVMPNL 257

Query: 253 LKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYV 312
            KPLE L+EH  YLD DL     + S    S+++T  LLAQLST LPKEL   KL+ LY+
Sbjct: 258 FKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYI 317

Query: 313 GRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQ 372
           GR+SGFSMRS Q+K FKWMAPSIL++ GMRIT+  EYA  KNPRY+ FL+E+P+LKD DQ
Sbjct: 318 GRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQ 377

Query: 373 HIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNT 432
             +D   L+++K  FAVY+++PWKVTNK+ FGDL T ++Q+SP+Q+++K  + G +YFNT
Sbjct: 378 K-MDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNT 436

Query: 433 LGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXX 492
           +GGGIG+G  QP IK   K+Y PGNVSLT DS+LEFA FRH GYGG + PG         
Sbjct: 437 IGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEE 496

Query: 493 XXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMA 551
                  F++QDVEVWGCGGEKEL+EQIKQ  WEEAE+KRRQ+IN +S+GEDRALLEMA
Sbjct: 497 NSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMA 555

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/573 (46%), Positives = 377/573 (65%), Gaps = 34/573 (5%)

Query: 16  LQFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELL 75
           +QF +  ++  YF  R    FT  EL+++K+ L     +D ++ EE++QLL +P  N +L
Sbjct: 21  IQFGNALEVQKYFQKRTIGHFTPLELISYKNKLNHDHLDDMITKEEIIQLLHLPDDNVIL 80

Query: 76  ADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIAL 135
           ++++ N + +L NFP + E   DIT   LL   ILL +DRC +++G K+YDQ+KL++I L
Sbjct: 81  SNMIFNMVHSLCNFPFLGERIWDITAGNLLTCIILLDNDRCQRFIGSKSYDQIKLLFILL 140

Query: 136 AL---RKTVKELPSSPDPAKP----------------WDAKSIIRNYNSVDIDDLYVPAD 176
            L     + K L +S    +                 ++   I+++YN + IDDL VPA 
Sbjct: 141 CLSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIGYNLTDILQSYNGISIDDLSVPAL 200

Query: 177 XXXXXXXXXXXXXRHCTVNNAKI--RESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQC 234
                          C   N KI   E+++  W++Y+  ++N+LR+M+  IV+  D  + 
Sbjct: 201 SLSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQKASLNILRSMDSSIVSNLDDYR- 259

Query: 235 VISFEQFSNAIAAVFPQVLKPLEILVEHMLYLDRDLTDELNSTSMP-STSKLVTEPLLAQ 293
            ISF QF N   +V P    PLE ++ H+LY+D+DL   +N   M    SKL++E LLAQ
Sbjct: 260 -ISFTQFENVFTSVVPNFTHPLENIMNHLLYMDKDL---INHPVMEIPKSKLMSESLLAQ 315

Query: 294 LSTMLPKELVYSKLRKLYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTK 353
           LST LPKEL  SKL+KLY+GR+SGFSMRS QSK FKW+AP+ILL+ G+ I +D+EY    
Sbjct: 316 LSTTLPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEEY---N 372

Query: 354 NPRYKKFLEEYPRLKDKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQL 413
           NPR+K+FL+E+P+L D +Q + +PC   ++K+ FAVY++EPW+VTNKE FGDL + +++L
Sbjct: 373 NPRFKRFLQEFPKLNDNEQSL-EPCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIEL 431

Query: 414 SPKQELFKAVRTGN-VYFNTLGGGIGVGCAQPVIK--PNGKKYFPGNVSLTIDSSLEFAS 470
           SP+Q++FK++++   +YFNT+G GIG+G  QP +    N +KY PGNVSLT++S+LEFA 
Sbjct: 432 SPRQDIFKSLKSHELIYFNTIGCGIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAV 491

Query: 471 FRHVGYGGAISPGXXXXXXXXXXXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEA 530
           FRHVG+GGA SP                KFI+QDVEVWGCGGEKEL+EQ+KQ  WEEAEA
Sbjct: 492 FRHVGHGGAFSPSELLTKRGTEEESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEA 551

Query: 531 KRRQRINLQSIGEDRALLEMAGLVGQHQSGGSM 563
           KRRQ++NL+SI EDRALLEM GLVGQHQSGGSM
Sbjct: 552 KRRQQVNLKSISEDRALLEMVGLVGQHQSGGSM 584

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  490 bits (1262), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 264/553 (47%), Positives = 371/553 (67%), Gaps = 19/553 (3%)

Query: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76
            F S  D+L  F  RA KQFT  ELV+FK+ L GKD N++++ EE+ + L +P    LL 
Sbjct: 15  HFTSNSDILKSFNDRALKQFTVTELVSFKNKL-GKDLNERLTNEELTKWLSVPQDEILLR 73

Query: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136
           +LL+N ++ L NFPL++ SY+++T  G+LK+ IL + +RC KYV  +NYDQLKL +IAL+
Sbjct: 74  ELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALS 133

Query: 137 LRKTVKELPS---SPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCT 193
           +RKTVKE P+   S    + +D   I++ ++ + +++L VP                +C 
Sbjct: 134 IRKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCP 193

Query: 194 VNNAKIRE-SVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQV 252
           +NN K+   ++F +W+ Y  +A  +LR+M P   ++       I +E F++ + ++ P +
Sbjct: 194 INNCKLENVAMFDNWNSYIKSAHTILRSMRPMDESSW------IEYEPFAHTMRSIAPHI 247

Query: 253 LKPLEILVEHMLYLDRDLTDELNSTSMP-STSKLVTEPLLAQLSTMLPKELVYSKLRKLY 311
             PL  ++EH+L+ D +L D L+      ++SKL+   LLAQ+S+ L K+L    L++LY
Sbjct: 248 FDPLTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALSKQLPIYHLQRLY 307

Query: 312 VGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKD 371
           +GR+ GFSMRSFQ+K FKW AP+I+L+ G RI DD+EY + KN R++KFL EYP+LK  D
Sbjct: 308 LGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEY-SVKNTRFRKFLHEYPKLKPSD 366

Query: 372 QHI-IDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYF 430
               ++     + K++ AVYV++PWK+TNKE FG   TT+VQLSP QE+F + R   +YF
Sbjct: 367 MDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYF 426

Query: 431 NTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXX 490
           NT+GGGIG+G  QPVIK   K Y PGNVSLT+DS+LEFA  RH G GG + PG       
Sbjct: 427 NTIGGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDKD 486

Query: 491 XXXXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEM 550
                   K ++QDVEVWGCGGEKEL+EQ+KQWEWEE+EAKRRQ+INL+SIGEDRALLEM
Sbjct: 487 FEV-----KMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRRQQINLRSIGEDRALLEM 541

Query: 551 AGLVGQHQSGGSM 563
           AGLVGQ QSGGS+
Sbjct: 542 AGLVGQAQSGGSV 554

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  484 bits (1245), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 256/551 (46%), Positives = 355/551 (64%), Gaps = 16/551 (2%)

Query: 20  SQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLADLL 79
           S+ +++ YF  R   QF+  EL+ FK  L+  D +  +    + +LL+I   ++ L +L+
Sbjct: 24  SELEIVDYFNKRVISQFSNIELLCFKHLLEIDDYSTIIDDAVVYKLLQIQDVSDRLRNLI 83

Query: 80  HNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALALRK 139
            N IK L+NFP I    D++T  GLLK+ ++L   + IKY      + LK+++IAL    
Sbjct: 84  LNFIKRLTNFPFISTVADNVTAYGLLKTIVILQKQKFIKYTNNNQLNMLKILFIALG--- 140

Query: 140 TVKELPSSPDPAKPWDA-----KSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCTV 194
              +     D  K  D       +I+  Y+ + I D+ V +                C  
Sbjct: 141 ---DYDREEDNKKILDCHNISISTILTTYDGIPIHDISVSSSNMISFLTWILALSNVCPT 197

Query: 195 NNAKI-RESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVL 253
           NN+ +  + +F++W+ Y+ +A++L+R+MNPDI+   D     I F QF  A+  + P V 
Sbjct: 198 NNSIVDTKHMFKYWEKYETSAISLVRSMNPDIIKPDDNQN--ILFIQFKTALETIMPHVY 255

Query: 254 KPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVG 313
            PLE L+ H+L+++  L            SKL+T  + +QLST+L  ++V SKL KLY G
Sbjct: 256 LPLEHLLNHLLFMESSLIKSQEIEISFQESKLMTFAVASQLSTLLRNDVVISKLHKLYSG 315

Query: 314 RESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQH 373
           RESGFSMRSFQSKAFKW AP+ILLI GMR+TDD EYAT KNPRYKKF+++YPRL+D DQ+
Sbjct: 316 RESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVEYATKKNPRYKKFIDQYPRLRDLDQN 375

Query: 374 IIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTL 433
           + +PC    RK+ FAVYV+EPWKV+NK  FG LKT +V+LSP+Q+ F+A + G +YFNT+
Sbjct: 376 L-EPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRAAKPGVIYFNTV 434

Query: 434 GGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXXX 493
           GGGIG+G +QPV K N   Y PGNVSLTID+SLEF +FRH GYGG+I P           
Sbjct: 435 GGGIGIGSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFRHTGYGGSIEPSSILQKKEDAT 494

Query: 494 XXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGL 553
                +F++QD+EVWGCGGEKE+ EQ+KQW WEE EAK+RQR+NL+S+GEDRALLEMAG+
Sbjct: 495 RTFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKRQRVNLKSMGEDRALLEMAGI 554

Query: 554 VGQH-QSGGSM 563
           +G H  SGGS+
Sbjct: 555 IGNHAHSGGSL 565

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  472 bits (1215), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 251/549 (45%), Positives = 352/549 (64%), Gaps = 9/549 (1%)

Query: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76
           + +S+ D+L +F  R+       E+  FKS L  KD +D ++ +E   LL+I   N  L 
Sbjct: 21  ELKSREDILDFFNNRSLSILLPMEIECFKSRLGDKDLSDPLTKDEFNTLLRIADSNSQLQ 80

Query: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136
            LL N    +S FP +    + +T  G+LK  ILL+ +R  KY+G+ N   +KLI+I L 
Sbjct: 81  ILLWNFFLKISAFPFLSNRSESMTGFGILKGIILLTRERIKKYLGWSNAKLIKLIFIGL- 139

Query: 137 LRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCTVNN 196
              T +E       A  +  + ++   + +D+    V                 HC  +N
Sbjct: 140 ---TSQEKVGVKTEASVFKIQHVLDTLDGIDLASSTVKDTDMLSFITWLLLLSVHCPTSN 196

Query: 197 AKIRE-SVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVLKP 255
            K+ E S++  W DY+  A +++R+MN  I  T   +   IS+  FS+ I AV   V+ P
Sbjct: 197 CKLNEKSLYDKWKDYEIVASSMVRSMNKKITTTGKGIG--ISYSDFSHTIVAVSKNVMSP 254

Query: 256 LEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVGRE 315
           LE +VEHMLY   DL +     +    +KL+T PL+AQL T+LP E+V S+L+KLYVGRE
Sbjct: 255 LENIVEHMLYKQDDLLEFPCLDTFLKETKLMTYPLVAQLCTVLPNEIVMSQLQKLYVGRE 314

Query: 316 SGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQHII 375
           SG+SMRS QSK F W A +ILL+ G RI DD EY+  KNPRYK+FLEEYP+LKD+DQ + 
Sbjct: 315 SGYSMRSLQSKVFNWKAATILLVSGTRIVDDIEYSENKNPRYKRFLEEYPKLKDEDQEM- 373

Query: 376 DPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTLGG 435
           D C   ++K+ FAVY++EPW+VTNK  FG+ +T++++LSP+Q+ F +++ G+VYFNT+GG
Sbjct: 374 DDCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTSIIELSPRQDKFNSLKVGSVYFNTIGG 433

Query: 436 GIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXXXXX 495
           GIG+G  QPV K N  +Y PGNVSLT+D++LEF  FRH GYGG I P             
Sbjct: 434 GIGIGNNQPVTKLNSVRYAPGNVSLTLDNTLEFGVFRHTGYGGTIGPSELLKKNNEENKA 493

Query: 496 XXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGLVG 555
              +F+++DVEVWGCGGEKEL+EQ+++W+WEEAEAKRRQ INL+++GEDRALLEMAG++G
Sbjct: 494 FEIRFLIRDVEVWGCGGEKELEEQLREWKWEEAEAKRRQEINLKTMGEDRALLEMAGIIG 553

Query: 556 QH-QSGGSM 563
           QH QSGGS+
Sbjct: 554 QHGQSGGSI 562

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  445 bits (1144), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 243/552 (44%), Positives = 338/552 (61%), Gaps = 22/552 (3%)

Query: 28  FAARATKQFTTPELVAFKSNLKGKDQ-NDKVSVEEMLQLLKIPLGNELL--ADLLHNCIK 84
           +  R  +QF   EL  FK  +    Q ND V  +E+L+ L +PL   L   + LL   IK
Sbjct: 32  YNDRVLRQFNASELYTFKCRVGMTRQLNDVVLEQELLEWLCLPLEGHLQQPSKLLVGVIK 91

Query: 85  TLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALALRK----- 139
            L  FP I  +  ++T   LLK+ IL++  +C+KY+G K+Y+ L+LI++AL L +     
Sbjct: 92  VLGQFPFISNTGGNLTAVSLLKAVILINRGKCLKYIGNKSYNHLELIFMALYLAQDSHDS 151

Query: 140 TVKELPSSPDPAKPWDAKSIIRNY--NSVDIDDLYVPADXXXXXXXXXXXXXRHCTVNNA 197
           T KE   S DP +P + + +I +Y  NS  + ++ V AD                   N+
Sbjct: 152 TKKE---SYDPKEPHNIEKVISSYDGNSDCVSEITVQADNLLQFTTMLLLLSARIPRPNS 208

Query: 198 KIR-ESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVLKPL 256
           +I  ++    W  Y+ +A N++RTMN  I+++  T    ISF QF + I+ + P +L  L
Sbjct: 209 QIDLKTADNDWAKYEKSAYNVIRTMNSSIISSCQT--HTISFHQFYDVISILLPTILTTL 266

Query: 257 EILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLP-KELVYSKLRKLYVGRE 315
           + L++H+LY    L D        + +K++     A L   L  K    SKL+KLYVGR+
Sbjct: 267 DNLLQHLLYTPDQLVDHTALGPTFTETKVMNHGSFALLQFALADKGYPISKLQKLYVGRD 326

Query: 316 SGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQHII 375
           SGFSMRSFQ K F W AP++L + G RI DD +Y+  KNPRY KFLE++ +L+D DQ + 
Sbjct: 327 SGFSMRSFQGKVFHWHAPTLLFVSGSRIQDDDDYSKNKNPRYSKFLEDFRKLRDTDQQL- 385

Query: 376 DPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTLGG 435
            PC L +RK++F +Y+  PW+VTNK+ F   +TT+ QLSP+ ++FKA R   VYFNT+GG
Sbjct: 386 SPCLLKKRKVMFVIYIESPWRVTNKDYFSAGRTTIFQLSPELDIFKANRDDVVYFNTMGG 445

Query: 436 GIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXX----XX 491
           GIG+G  QP  K N ++Y PGN+SLT+DSSLEF +FR+VG GG   PG            
Sbjct: 446 GIGIGDTQPYTKVNYREYRPGNISLTLDSSLEFGAFRNVGPGGMFEPGALFTRRNGDGVV 505

Query: 492 XXXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMA 551
                  +F++QDVEVWGCGGEKEL EQ+KQ +WEE EAKRRQ +NL+S+ EDRALLEMA
Sbjct: 506 TSNSYELRFLIQDVEVWGCGGEKELSEQMKQLQWEETEAKRRQHVNLKSLSEDRALLEMA 565

Query: 552 GLVGQHQSGGSM 563
           GLVGQHQSGGS+
Sbjct: 566 GLVGQHQSGGSI 577

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  421 bits (1082), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 212/547 (38%), Positives = 327/547 (59%), Gaps = 9/547 (1%)

Query: 18  FESQHDLLGYFAARATKQFTTPELVAFKSNL-KGKDQNDKVSVEEMLQLLKIPLGNELLA 76
           F  +  L+ +F ARA +Q +  E  AF  N+ K  +  +++ ++ +  L  +P       
Sbjct: 19  FTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELDLQALATLYGVPADVPWFT 78

Query: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136
           ++ +  +  L++FPL+ +     T  GLLK C+L +  R  +Y   K+YD   L+   LA
Sbjct: 79  EVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAARYTARKSYDVASLVLALLA 137

Query: 137 LRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCTVNN 196
             +   +     +    +D   +I   +   I +L V  +             + C  +N
Sbjct: 138 PPRDACD-----ENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPFIAQISQVCNGSN 192

Query: 197 AKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVLKPL 256
             +  S+F  W+      + LLR+++  IV+  D     I+++QF+  + +VFP V   L
Sbjct: 193 EPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFPNVFDAL 252

Query: 257 EILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVGRES 316
            + +E + Y+ RD T++L  T    TS +VT  LL QLST+ P+  +++ +++L+V  ++
Sbjct: 253 GLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSMQRLFVAGDA 312

Query: 317 GFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQHIID 376
           GFSM  FQ+K FKWMAP+IL + G RI DD E   TKN RYK FL++YP LKD +Q +  
Sbjct: 313 GFSMSVFQAKVFKWMAPTILFVSGTRIQDD-EIVCTKNKRYKAFLQDYPALKDAEQQLA- 370

Query: 377 PCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTLGGG 436
            C   +R L++A++V +PWK+TNK+LFGD+ TT++QL+P+Q++FKA    N+YFN +GGG
Sbjct: 371 LCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIYFNAVGGG 430

Query: 437 IGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXXXXXX 496
           IG G +QP +KP GK+YFPGNVS T+D S+EFA FR+VG GG  S G             
Sbjct: 431 IGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAPAEQPLSY 490

Query: 497 XYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGLVGQ 556
            ++ +++D+EVWG GGE+ELQ+QI++W+WEEAEA +R+ I      EDRALLEMAG+VG 
Sbjct: 491 EHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLEMAGIVGH 550

Query: 557 HQSGGSM 563
           +QSGGS+
Sbjct: 551 YQSGGSV 557

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  412 bits (1059), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/554 (40%), Positives = 326/554 (58%), Gaps = 24/554 (4%)

Query: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQN---DKVSVEEMLQLLKIPLGNE 73
           QF+++ ++L YF  R  K FT  E+ AFK      D N   D   ++E L L   P    
Sbjct: 19  QFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNAIDLNEPIDDTLIKEALYLDAQPN--- 75

Query: 74  LLADLLHNCIKTLSNFPLIRESY-DDITVAGLLKSCILLSHDRCIKYVG--FKNYDQLKL 130
            +   +   I+ L NFPL  +   D IT  GLLK   +++  R  K V      YD    
Sbjct: 76  -VWSAVSETIRLLQNFPLFHQPIADSITGFGLLKVIAIINVKRFEKLVNTTITRYD---- 130

Query: 131 IYIALALRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXR 190
           I + L L    KE   S +  K  +   I++ Y+ ++I+ +++P D              
Sbjct: 131 ITVTLGLCGQAKE---SENKIKSTNLGDILKTYDHIEIESIHIPYDKLILLVAWLLTLVT 187

Query: 191 HCTVNNAKIRES-VFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVF 249
                N K+  S    +W+++K++A+++  T++   +   + +   I      NA   + 
Sbjct: 188 GVATTNCKVELSDTIANWNNFKSSAISIANTISTSALGNANDIG--IPATDILNAFNTIM 245

Query: 250 PQVLKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRK 309
             ++  +  L EH+L+   DL D +N  +  S   ++T  L AQ+   LP  +  +KL+K
Sbjct: 246 ISLVPYMSNLFEHLLFGVDDLIDHVNDLANLSHQDVLTPSLYAQVIIGLPNSITITKLQK 305

Query: 310 LYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKD 369
           LYVG+ESGFSMRS QSK F+W AP+++++ G RI+DD+ YA +KNPRY+ FL  +P+L++
Sbjct: 306 LYVGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDESYADSKNPRYRSFLYSFPKLRE 365

Query: 370 KDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVY 429
            DQ++ D   L ++K+ +AVY++EPWKV+NKE FG    T+++L+P+Q+ +++     +Y
Sbjct: 366 NDQNL-DAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIMELTPQQKTYQSCMERTMY 424

Query: 430 FNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXX 489
           FNT+GGGIGVG  QP++K N  K+ PGN+SLT+DSSLEF  FRHVG GG           
Sbjct: 425 FNTIGGGIGVGSEQPIVKQNDIKFIPGNISLTMDSSLEFGVFRHVGAGGGFKTS---LLD 481

Query: 490 XXXXXXXXYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLE 549
                    +FI+Q+VEVWGCGGEKEL EQ+KQ EWEEAEAKRRQ INLQS+ ED+ALLE
Sbjct: 482 NDDSKSFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAKRRQTINLQSLSEDKALLE 541

Query: 550 MAGLVGQHQSGGSM 563
           M GLVGQHQSGGS+
Sbjct: 542 MVGLVGQHQSGGSV 555

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  263 bits (672), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 185/526 (35%), Positives = 267/526 (50%), Gaps = 66/526 (12%)

Query: 36  FTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLADLLHNCIKTLSNFPLIRES 95
           FT  EL+ F+  +  +  +D +S +E+++   IP     L  L    I+ L+ +P    S
Sbjct: 25  FTVSELITFQKRI-NRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP----S 79

Query: 96  YDDI-TVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALALRKTVKELPSSPDPAKPW 154
            D+I T    LK   LL+  R  K   F   + +K+I++ L+  +   + P        W
Sbjct: 80  NDNIITGYSYLKIITLLNKKRRNKM--FPKIEWIKIIFMCLSDEEV--QFPC-------W 128

Query: 155 DAKSIIRNYNSVDIDDLYVPADXXXXXXXXXXXXXRHCTVNNAKIRESVF---QHWDDY- 210
           +              D++V  +              +C  +   I + +      WD Y 
Sbjct: 129 ETTH-----------DIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYW 177

Query: 211 KANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVLKPLEILVEHMLYLDRDL 270
           + +A  ++R M           +C +  E+F N +  V P +   L+ L+EH LY    L
Sbjct: 178 RKSASCIVRDMK----------ECNV--EEFENVLLIV-PNIFDCLKNLIEHSLYTKDQL 224

Query: 271 TDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVGRESGFSMRSFQSKAFKW 330
            +     S  + +K+    L   L +M  + +    + KLY+GRE+G+SMRSFQSK FKW
Sbjct: 225 KECPLGPSQFTKTKMNQAILCQILLSMRKRSM---DISKLYIGRENGYSMRSFQSKVFKW 281

Query: 331 MAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQHIIDPCSLNRRKLLFAVY 390
            AP+ILLI G +I +DQEY+  KN RYK FL  YPRLKD       P         FA+Y
Sbjct: 282 KAPTILLITGKKIINDQEYS-EKNNRYKSFLNSYPRLKDGKTTFQTPLHYT-----FAIY 335

Query: 391 VNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTLGGGIGVGCAQPVIKPNG 450
           + EPWK+T K  FG L T ++QLSP+Q++F       VYF+T   GIG+G        + 
Sbjct: 336 IEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH---MSSD 390

Query: 451 KKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGXXXXXXXXXXXXXXYKFIVQDVEVWGC 510
            KY PGNVS+TIDS+LEFA FRH G      PG               +  +Q VEVWGC
Sbjct: 391 NKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRLHIQSVEVWGC 444

Query: 511 GGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGLVGQ 556
           GG KEL EQ  +WEWEE EA+RRQ +++  + EDRALLE+AG++G+
Sbjct: 445 GGAKELAEQKHEWEWEEREAQRRQHVSMH-VTEDRALLELAGIIGE 489

>KNAG0L02070 Chr12 (368525..371080) [2556 bp, 851 aa] {ON} Anc_5.695
           YIL143C
          Length = 851

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 311 YVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLK 368
           +VGR SG +++ F+SKA +  A    L GG    +D  YA T   R K+  E +P ++
Sbjct: 790 FVGR-SGGALKRFKSKAVRGQASMAGLAGG----EDMAYAETGPNRNKEIKEHHPLIR 842

>SAKL0G13816g Chr7 (1183028..1184962) [1935 bp, 644 aa] {ON} similar
           to uniprot|P47069 Saccharomyces cerevisiae YJL019W MPS3
           Essential integral membrane protein required for spindle
           pole body duplication and for nuclear fusion localizes
           to the spindle pole body half bridge interacts with
           DnaJ-like chaperone Jem1p and with centrin homolog
           Cdc31p
          Length = 644

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 231 TVQCVISFEQFSNAIAAVFPQVLKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPL 290
           T++ +IS  QF   I  +FP  LK ++IL   +  L+  + D   S S+ + ++   + L
Sbjct: 207 TIKLIIS--QFEKNIKKLFPSGLKDVQILKSDLQKLNTKVQDLSESLSLGNVTQW-QDQL 263

Query: 291 LAQLSTMLPKEL 302
           + +L  +LP+E+
Sbjct: 264 MGELPDLLPQEI 275

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,294,124
Number of extensions: 2414908
Number of successful extensions: 6972
Number of sequences better than 10.0: 29
Number of HSP's gapped: 7094
Number of HSP's successfully gapped: 29
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)