Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02442g5.430ON62362323590.0
Skud_4.6355.430ON62959613301e-176
ZYRO0F09944g5.430ON61158212861e-170
NCAS0F033505.430ON63942812751e-168
Kpol_1016.85.430ON63743012571e-165
Kwal_55.214445.430ON64443112241e-160
KLLA0E21165g5.430ON62741912091e-158
Ecym_47905.430ON63041611941e-156
TPHA0H017805.430ON62242311911e-156
KAFR0E039105.430ON62541211911e-155
KLTH0F16148g5.430ON64642911861e-155
AER259W5.430ON61940711811e-154
NDAI0B056405.430ON66945111681e-151
CAGL0L11638g5.430ON60841511601e-151
Suva_2.5385.430ON62942511451e-149
Smik_4.6325.430ON62741311371e-147
TDEL0E019505.430ON61741211301e-146
YDR365C (ESF1)5.430ON62841311241e-145
KNAG0C049405.430ON64242811001e-142
TBLA0A065405.430ON65943810951e-141
AFR468W4.77ON68945698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02442g
         (623 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   913   0.0  
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   516   e-176
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   499   e-170
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   495   e-168
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   488   e-165
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   476   e-160
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   470   e-158
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   464   e-156
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   463   e-156
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   463   e-155
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   461   e-155
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   459   e-154
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   454   e-151
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   451   e-151
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   445   e-149
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   442   e-147
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   439   e-146
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   437   e-145
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   428   e-142
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   426   e-141
AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic ...    31   8.7  

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/623 (76%), Positives = 475/623 (76%)

Query: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60
           MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR
Sbjct: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60

Query: 61  LKDVDNKETKDFERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXXX 120
           LKDVDNKETKDFERYF                TKVTSLDRARGEVPSDY           
Sbjct: 61  LKDVDNKETKDFERYFEKEEESSSPSDEEGESTKVTSLDRARGEVPSDYLSSSEEESSSE 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGG 180
                                 KPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGG
Sbjct: 121 SEEESENSELESEESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGG 180

Query: 181 KILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXXXXLYEEGDAEK 240
           KILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRK           LYEEGDAEK
Sbjct: 181 KILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKDGDDSDVDIKDLYEEGDAEK 240

Query: 241 DYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDF 300
           DYDSKA             AVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDF
Sbjct: 241 DYDSKALRRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDF 300

Query: 301 SDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFK 360
           SDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFK
Sbjct: 301 SDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFK 360

Query: 361 AYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGLXX 420
           AYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGL  
Sbjct: 361 AYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGLDE 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNKSDSQSKTADEV 480
                                                         LNKSDSQSKTADEV
Sbjct: 421 AKKDDEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLNKSDSQSKTADEV 480

Query: 481 XXXXXXXXXXXXXXXXXXNDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEF 540
                             NDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEF
Sbjct: 481 EKEKKSKAELELLMMDDDNDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEF 540

Query: 541 KPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRVSXXXXXXXXXLEQPRK 600
           KPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRVS         LEQPRK
Sbjct: 541 KPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRVSKKKGNKKRKLEQPRK 600

Query: 601 NNNSNELNGLVAKLKRRNKKSRK 623
           NNNSNELNGLVAKLKRRNKKSRK
Sbjct: 601 NNNSNELNGLVAKLKRRNKKSRK 623

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  516 bits (1330), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 300/596 (50%), Positives = 366/596 (61%), Gaps = 22/596 (3%)

Query: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60
           M+GDK+   +  D RF+GI SDPKFK+ + ++ KIKLD RFSKKDLE++ K+KVDKYGR+
Sbjct: 1   MAGDKSEKESI-DARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRK 59

Query: 61  LKDV-DNKETKDFERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXX 119
           +KD  +NKE +DF++YF                     +DRARGEVPSDY          
Sbjct: 60  IKDARNNKELEDFDKYFEKEAEHDEDSEVAAKIV----VDRARGEVPSDYVSSSDEFTSS 115

Query: 120 XXXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKG 179
                                     +GD ++ LAVVNLDWDHVKS DLM+TFSSFVP+G
Sbjct: 116 DSESSGESEVESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRG 175

Query: 180 GKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXX------XXLY 233
           GKI +IAI+PSEFG+ERM+REEVEGPP+ELFQ K K    K                 LY
Sbjct: 176 GKIERIAIFPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDGDIGINDLY 235

Query: 234 EEGDAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRY 293
           EEGDA+KD DS+A             AVV C++  +A+AIY NCDGTEYESTANMFDLRY
Sbjct: 236 EEGDADKDVDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRY 295

Query: 294 VPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKE 353
           VP+GM F D  +DEC  +PKNY+P QFSTDALQHSNVKLTWDETPA+R+E++KRAFTQKE
Sbjct: 296 VPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKE 355

Query: 354 IEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEG---GDVDM 410
           I+DMDFKAYLASDS+ S+E+++ED++NKLKSLV       D ++  K  N+G   G+VDM
Sbjct: 356 IDDMDFKAYLASDSDESDEQVDEDAKNKLKSLVGGL----DFNMKKKGANDGKEEGEVDM 411

Query: 411 EITFTPGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNKS 470
           EITFTP L                                                L KS
Sbjct: 412 EITFTPALEGENEKPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKL-KS 470

Query: 471 DSQSKTADEVXXXXXXXXXXXXXXXXXXND--TESKLNKKAHFNMTEILRSEKEKGKRTK 528
            ++   ADE                   +D  TE  +N KAHF+M EILRSEKEK KR +
Sbjct: 471 VNKKHVADEEEIKNNAKSKAELELLMDEDDAETEGSMNSKAHFSMKEILRSEKEKHKRGR 530

Query: 529 YQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRV 584
           YQ +E+IVED F PDL DPRF+EVFEDHDFAIDP+QPE+K T AM  ILKER +RV
Sbjct: 531 YQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRV 586

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  499 bits (1286), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 290/582 (49%), Positives = 360/582 (61%), Gaps = 26/582 (4%)

Query: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETK 70
           ++DPRF+GI +DPKF++ K K LK+KLDDRFSKKDL++++KAKVDKYGRR+   ++K+ K
Sbjct: 10  SSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITG-ESKDLK 68

Query: 71  DFERYFXXXXXXXXXXXXXXXXTKVTS------LDRARGEVPSDYXXXXXXXXXXXXXXX 124
           DF++YF                           +DRARGE+P  Y               
Sbjct: 69  DFDKYFEKEGKEGKEDESSSSSEDEEEETESKVVDRARGELPEAYTSSESEDSESDLSEE 128

Query: 125 XXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILK 184
                             KP +GD ++ LAVVNLDWDHV++ DLM+TFSSF+P GGKI K
Sbjct: 129 ESEADVAEAVEEA-----KPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIEK 183

Query: 185 IAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXXXXLYEEGDAEKDYDS 244
           I IYPSEFGKERMQREE EGPPRE+F   KKK               LYEEGDA+K+ D+
Sbjct: 184 ICIYPSEFGKERMQREEKEGPPREIFN--KKKKHHDEDSDSDVDIRDLYEEGDADKEVDN 241

Query: 245 KAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEP 304
            A             A+V+CNNVET E+IY NCDGTEYESTAN+FDLRYVPEGM+F DEP
Sbjct: 242 AALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEP 301

Query: 305 KDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLA 364
           KDEC+++PKNYKP +FSTDALQHSNVKLTWDETP +R+E+SKRAF+QKE+EDMDF+AYLA
Sbjct: 302 KDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLA 361

Query: 365 SDSEGSE--EEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGLXXXX 422
           S ++ S+  E  NE+++NKLKSLV +S+  G +        +  + DMEITFTPGL    
Sbjct: 362 SGTDESDGEENNNEEAKNKLKSLVGQSLAYGKQ--------QEEEPDMEITFTPGLDDSK 413

Query: 423 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNKSDSQSKTADEVXX 482
                                                       L    ++ +  DE   
Sbjct: 414 PQADEDHEETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKLRSGKNKKQVEDE--S 471

Query: 483 XXXXXXXXXXXXXXXXNDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKP 542
                           +DTE  LNKKAHFNM EIL+SEKEK K+ KYQ++ KI+EDEFKP
Sbjct: 472 DAKSKAELELLMMEDEDDTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMEDEFKP 531

Query: 543 DLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRV 584
           DLNDPRF EVFE+ DFAIDPSQPE+K T AMKEIL+ER++R 
Sbjct: 532 DLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRA 573

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  495 bits (1275), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 259/428 (60%), Positives = 304/428 (71%), Gaps = 12/428 (2%)

Query: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60
           MS D N    T+D RFSGI++DPKF+  K KNLKIKLD+RFSKKDLEI++KAKVDKYGR+
Sbjct: 1   MSED-NSTKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRK 59

Query: 61  LK---DVDNKETKDFERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXX 117
           +    D++NKE KDF++YF                  VT +DRARGEVP+DY        
Sbjct: 60  IHEDNDMNNKELKDFDKYFEKEGESADEKKEEEEIETVT-VDRARGEVPADYVSSSDEYT 118

Query: 118 XXXXXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVP 177
                                     P TGDAT+ LAVVNLDWDHV+S+DLM+TFS F+P
Sbjct: 119 SSESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVNLDWDHVRSSDLMITFSGFLP 178

Query: 178 KGGKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXXXX----LY 233
           KGGKI KI + PSEFGKERMQREE EGPPRELFQ KKKK +R                LY
Sbjct: 179 KGGKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDVDIKDLY 238

Query: 234 EEGDAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRY 293
           EEGDA+KD D++A             AVV+CN+VE A AIY+NCDGTEYESTANMFDLRY
Sbjct: 239 EEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTANMFDLRY 298

Query: 294 VPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKE 353
           VP+GMDF DEP+D+C  +PKNYKP QFSTDALQHSNVKLTWDETPAERVE++KRAFTQKE
Sbjct: 299 VPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQKE 358

Query: 354 IEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDN-EGGD--VDM 410
           IEDMDFKAYLASDS+GSE+E+N+D++NKLKSLV +S+RIG++ +F   D  EG D  VDM
Sbjct: 359 IEDMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIGNQPIFGSKDTLEGEDEEVDM 418

Query: 411 EITFTPGL 418
           EITF PGL
Sbjct: 419 EITFDPGL 426

 Score =  127 bits (318), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 78/87 (89%)

Query: 499 NDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDF 558
           +DTE+ +NKKAHFNM EILRSEKEK K+ KYQ++ +IVED FKPDLNDPRF+EVFEDHDF
Sbjct: 508 DDTETGINKKAHFNMKEILRSEKEKSKKGKYQDKRRIVEDNFKPDLNDPRFKEVFEDHDF 567

Query: 559 AIDPSQPEFKGTTAMKEILKERNQRVS 585
           AIDPS+PEFK T AMKEILKER++R S
Sbjct: 568 AIDPSRPEFKETPAMKEILKERSKRSS 594

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  488 bits (1257), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 262/430 (60%), Positives = 305/430 (70%), Gaps = 14/430 (3%)

Query: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60
           MSG+ ++  ++ DPRFSGI+SDPKFK++K KN+KIKLDDRF K DL+IK K+KVDKYGR+
Sbjct: 1   MSGEDSMKQSS-DPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRK 59

Query: 61  LKDV-DNKETKDFERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXX 119
           LKDV DNKE +DF++YF                 KV  LDRARGEVPSDY          
Sbjct: 60  LKDVKDNKELEDFDKYFEKEDEEDKEEEIGTE-AKVKVLDRARGEVPSDYESSSEEFTSS 118

Query: 120 XXXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKG 179
                                  KP +GD+++ LAVVNLDWD+VKS DLM+TFSSF+PKG
Sbjct: 119 DSESSGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITFSSFLPKG 178

Query: 180 GKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXXX--------- 230
           GKI KI IYPSEFGKERM REEVEGPPRELF  KK K   K                   
Sbjct: 179 GKIEKICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDESDSDVDIR 238

Query: 231 XLYEEGDAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFD 290
            LYEEGDAEKD DSKA             AVV+CNN+ +AE+IY+NCDGTEYES+AN+FD
Sbjct: 239 ELYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYESSANIFD 298

Query: 291 LRYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFT 350
           LRYVP+G +F DEP+DEC  +PKNYK  QF+TDALQHSNVKLTWDETPA+RVE++KRAFT
Sbjct: 299 LRYVPDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVEIAKRAFT 358

Query: 351 QKEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLF-DKSD-NEGGDV 408
           QKEIE+MDFKAYLASDS+ SEEE N+D +NKLKSLVS+S  IGDKS+F DK D NE  DV
Sbjct: 359 QKEIEEMDFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFDDKGDNNEEDDV 418

Query: 409 DMEITFTPGL 418
           DMEITFTPGL
Sbjct: 419 DMEITFTPGL 428

 Score =  118 bits (295), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 63/77 (81%), Positives = 72/77 (93%)

Query: 503 SKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDP 562
           S LNKKAHFNM EI+RSEKEKGK++KYQ++ KIVED+FKPDLNDPRF+E+FEDHDFAIDP
Sbjct: 516 STLNKKAHFNMNEIVRSEKEKGKKSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDP 575

Query: 563 SQPEFKGTTAMKEILKE 579
           +Q EFK TTAMKEILKE
Sbjct: 576 TQSEFKETTAMKEILKE 592

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  476 bits (1224), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 247/431 (57%), Positives = 295/431 (68%), Gaps = 24/431 (5%)

Query: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETK 70
           ++DPRF+ +HSDPKF++ K K  KIKLDDRFSKKDL+ K+KA+VDKYGR LK  +NK+ K
Sbjct: 12  SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQENKDKK 71

Query: 71  DFERYF---------------------XXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDY 109
           DF++Y+                                      K  SLDRARGEVPSDY
Sbjct: 72  DFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEVPSDY 131

Query: 110 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLM 169
                                            KP +GD+++ LAVVNLDWDHVKSTDLM
Sbjct: 132 VSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKSTDLM 191

Query: 170 VTFSSFVPKGGKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXX 229
           +TFSSFVP GGKI+KIA+YPSEFGKER++REE+EGPPRE+F+ K  K +           
Sbjct: 192 ITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSDSDVD 251

Query: 230 XX-LYEEGDAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANM 288
              LYEEGDAE DYD+K+             AVV+CNNV TAEAIY+NCDGTE+ESTANM
Sbjct: 252 VRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGTEFESTANM 310

Query: 289 FDLRYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRA 348
           FDLRYVP+GM F DE +DEC  +PKNY+P+QFSTDALQHS VKLTWDETPA+RV MSKRA
Sbjct: 311 FDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPADRVAMSKRA 370

Query: 349 FTQKEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEG-GD 407
           FTQKEIEDMDFKAYLASDSE SE E N+D + KLKSLVS+S+++GDKS+FD++  EG  D
Sbjct: 371 FTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFDQAPEEGESD 430

Query: 408 VDMEITFTPGL 418
           VDM+ITF PGL
Sbjct: 431 VDMQITFAPGL 441

 Score =  155 bits (393), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 91/121 (75%)

Query: 499 NDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDF 558
           N++ SKLNKKAHFNM EI+RSEKEKGK+++YQN++KIVEDEFKPDLNDPRF EVFED DF
Sbjct: 521 NNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDF 580

Query: 559 AIDPSQPEFKGTTAMKEILKERNQRVSXXXXXXXXXLEQPRKNNNSNELNGLVAKLKRRN 618
           AIDPSQPEFKGT AMK+IL+ER +R                  N  ++L GLV KLK  +
Sbjct: 581 AIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLANQNGQSDLKGLVKKLKHSS 640

Query: 619 K 619
           K
Sbjct: 641 K 641

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  470 bits (1209), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 248/419 (59%), Positives = 290/419 (69%), Gaps = 17/419 (4%)

Query: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETK 70
           T DPRFSGIH+DPKF+  K KN KIKLDDRFSK+DLE+++KAKVDKYGR++ D  NK+ K
Sbjct: 12  TEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDA-NKDVK 70

Query: 71  DFERYFXXXX----------XXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXXX 120
           DF+RYF                              S+DRARGE P+DY           
Sbjct: 71  DFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAKSVDRARGEPPADYVSSSDEESSSE 130

Query: 121 XXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGG 180
                                 KP +G+AT  LAVVNLDWDHVKS DL VTF SFVPKGG
Sbjct: 131 SEEESGDSDIESEEIELEES--KPASGNATNTLAVVNLDWDHVKSADLFVTFKSFVPKGG 188

Query: 181 KILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXXXXLYEEGDAEK 240
           +I KIAIYPSEFGKERMQREE+EGPP+ELFQ KK K   K           +YEEGDAE 
Sbjct: 189 EIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKSKKNDKDDDEINVES--IYEEGDAE- 245

Query: 241 DYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDF 300
           DYDSKA             AVV+C+++ TAE+IYQNCDGTEYESTAN+FDLRYVP+GM+ 
Sbjct: 246 DYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVPDGMEM 305

Query: 301 SDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFK 360
            D+P+DEC  +PKNYKPAQFSTDALQHS VKLTWDETPA+RVE+SKRAFTQKEIE+MDFK
Sbjct: 306 DDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIEEMDFK 365

Query: 361 AYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFD-KSDNEGGDVDMEITFTPGL 418
           AYLASDSE SE E ++  +NKLK+LV +S+++G KSLFD K D +  + DMEITFTPGL
Sbjct: 366 AYLASDSEESEVEHDDQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADMEITFTPGL 424

 Score =  130 bits (328), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/126 (57%), Positives = 93/126 (73%), Gaps = 2/126 (1%)

Query: 499 NDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDF 558
           N+ ES +N KAHFNM EIL+SEKEK K+ KYQN+EKIV+DEF PD+NDPRF+EVFEDHDF
Sbjct: 501 NEGESTINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDF 560

Query: 559 AIDPSQPEFKGTTAMKEILKERNQRVSXXX--XXXXXXLEQPRKNNNSNELNGLVAKLKR 616
           AIDP+QPEFK T AM++ILKER  R S           +     + + N++ GLV KLK 
Sbjct: 561 AIDPTQPEFKKTPAMEKILKERTVRSSKKSRGKKRNHEIANTEHSKDINKIGGLVEKLKA 620

Query: 617 RNKKSR 622
           +NK+++
Sbjct: 621 KNKRTK 626

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  464 bits (1194), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 241/416 (57%), Positives = 285/416 (68%), Gaps = 7/416 (1%)

Query: 8   NPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNK 67
           +P TND RF+GIH+DPKF+  K   LKI LDDRFSKKDLE K+KAKVDKYGRR+   D K
Sbjct: 9   DPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEK 68

Query: 68  ETKDFERYFXXXXXXXXXXXX----XXXXTKVTSLDRARGEVPSDYXXXXXXXXXXXXXX 123
           E KDF+RYF                      V++LDRARGEVP DY              
Sbjct: 69  EAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPLDYESSSDENSSSESEE 128

Query: 124 XXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKIL 183
                              KP TGD T++ AVVNLDWDHV+S DL+ TF+SFVP GG I 
Sbjct: 129 ESEDSALDPDSELEIEES-KPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIK 187

Query: 184 KIAIYPSEFGKERMQREEVEGPPRELFQGKK-KKSQRKXXXXXXXXXXXLYEEGDAEKDY 242
           K+AIYPSEFGKERM+REEVEGPPRELF+ K+ KK +             LYE  DAEKDY
Sbjct: 188 KVAIYPSEFGKERMKREEVEGPPRELFKRKQSKKEKDSDDENSDIDINDLYEVDDAEKDY 247

Query: 243 DSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSD 302
           DSKA             AVV+C++V TA+AIYQNCDGTE+ESTANMFDLRYVP+ M F D
Sbjct: 248 DSKALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFED 307

Query: 303 EPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAY 362
           +P+D+C  VPK+YKP QFST ALQHS VKLTWDETPA+RVE+SKRAF QKEIE+MDFKAY
Sbjct: 308 DPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAY 367

Query: 363 LASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGL 418
           LASDS+ SE E NE ++N L+SLV++SI++  KS+FDK  +E  + D+EITFTPGL
Sbjct: 368 LASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSE-EEADVEITFTPGL 422

 Score =  129 bits (324), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (85%)

Query: 503 SKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDP 562
           S LN  AHFNM EI++S+KEK K+++YQN+  IV+D FKPDLNDPRF+EVFEDHDFAIDP
Sbjct: 507 STLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDP 566

Query: 563 SQPEFKGTTAMKEILKERNQRVS 585
           SQPEFK T AMKEIL+ER +R S
Sbjct: 567 SQPEFKKTPAMKEILEERTRRSS 589

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  463 bits (1191), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 302/423 (71%), Gaps = 14/423 (3%)

Query: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60
           MS DK   P   D RFSG+ +DPKFK+A+ KNLKIKLD RFSK DLE+ +KA+VDKYGR+
Sbjct: 1   MSSDK---PVNTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRK 57

Query: 61  LKDVDNKETKDFERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXXX 120
           + +++N+E KDF++YF                     +DRARGEVPSDY           
Sbjct: 58  ISNLNNQEAKDFDKYFEKEEDGKGEEIAVKPL-----IDRARGEVPSDYQSSLDDYTSSE 112

Query: 121 XXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGG 180
                                 KP +GD+++ +AVVNLDWDHVK+TDL+VTFSSFVPKGG
Sbjct: 113 SEDSEDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVPKGG 172

Query: 181 KILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKXXXX----XXXXXXXLYEEG 236
           KI +IAI+PSEFGK+RM+REE+EGPP+ELFQ KKKK+ +K               LYEEG
Sbjct: 173 KIERIAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSDVDINDLYEEG 232

Query: 237 DAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPE 296
           D +K+ DSK+             AVVFCNN+ TAEAIY NCDGTEYESTAN+FDLRYVP+
Sbjct: 233 DVDKEVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPD 292

Query: 297 GMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIED 356
           GMDF D+P DEC ++PKNY P  F+TDALQHSNVKLTWDETPA+RVE++KRAFTQKEI++
Sbjct: 293 GMDFEDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDE 352

Query: 357 MDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFD-KSDNEGGDVDMEITFT 415
           MDFKAYLASDSE SE E NE+ +NKLKSLV  S++IGDKS+ D KSDNE G+VDMEITFT
Sbjct: 353 MDFKAYLASDSEESEGE-NEEVKNKLKSLVGLSMKIGDKSIMDNKSDNEDGEVDMEITFT 411

Query: 416 PGL 418
           PGL
Sbjct: 412 PGL 414

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/81 (76%), Positives = 72/81 (88%)

Query: 503 SKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDP 562
           S +NKKAHFNM EILRSEKEK K++K+QN+EKIVED FK DLNDPRF E+FEDHDFAIDP
Sbjct: 502 STINKKAHFNMKEILRSEKEKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAIDP 561

Query: 563 SQPEFKGTTAMKEILKERNQR 583
           +Q E+K T AMKEILKER++R
Sbjct: 562 TQSEYKETAAMKEILKERSKR 582

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  463 bits (1191), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 253/412 (61%), Positives = 290/412 (70%), Gaps = 10/412 (2%)

Query: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNK-ET 69
           ++DPRFS I++DPKFK+AK K+LKI+LD RFSK+DLEI+ KAKVDKYGR+ KD  +K E 
Sbjct: 8   SDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGSKKEL 67

Query: 70  KDFERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXXXXXXXXXXXX 129
            DFE+YF                 +   +DRARGEVPSDY                    
Sbjct: 68  DDFEKYFEKEDEEEKKDTEET--EEKPKVDRARGEVPSDYVSSSDEYTSSESEDSEEEEL 125

Query: 130 XXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYP 189
                        KP TGDA++ LAVVNLDWDHVKS DLMVTFSSFVPKGGKI +I IYP
Sbjct: 126 DSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYP 185

Query: 190 SEFGKERMQREEVEGPPRELFQGKKKKSQRKXX---XXXXXXXXXLYEEGDAEKDYDSKA 246
           SEFGKER+QREEVEGPP+ELFQ K KK                  LYEEGDAEKD DSKA
Sbjct: 186 SEFGKERLQREEVEGPPKELFQKKNKKKASHKEDFDSDSDVDIKDLYEEGDAEKDVDSKA 245

Query: 247 XXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKD 306
                        AVV+CNN++TA AIY+NCDGTEYESTANMFDLRYVP+GM F DEP+D
Sbjct: 246 LRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDEPRD 305

Query: 307 ECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASD 366
           EC  +PKNYKP QFSTDALQHSNVKLTWDETPA+RVE++KRAF+QKEIEDMDFKAYLASD
Sbjct: 306 ECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYLASD 365

Query: 367 SEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGL 418
           S+ SEEE+NE+S+NKLK+LV ES+  G       SD E  +VDMEITFTPGL
Sbjct: 366 SDESEEEVNENSKNKLKALVGESLDFGTNGA---SDGE-SEVDMEITFTPGL 413

 Score =  132 bits (333), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 75/128 (58%), Positives = 94/128 (73%), Gaps = 3/128 (2%)

Query: 499 NDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDF 558
           +DTE  LNKKAHFN+ EI+RSEKEKGK+ KYQ +EKIVED+FKPDL+DPRF+EVFEDHDF
Sbjct: 495 DDTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDDFKPDLSDPRFKEVFEDHDF 554

Query: 559 AIDPSQPEFKGTTAMKEILKERNQRV---SXXXXXXXXXLEQPRKNNNSNELNGLVAKLK 615
           AIDPSQPEFK T AMK+IL ER++R    S         L+     N  N ++ +V KLK
Sbjct: 555 AIDPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKKRKLDTSTSKNGKNAISNIVNKLK 614

Query: 616 RRNKKSRK 623
           +  K++ +
Sbjct: 615 KNGKQNNR 622

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  461 bits (1186), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 233/429 (54%), Positives = 292/429 (68%), Gaps = 22/429 (5%)

Query: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETK 70
           ++DPRF+G+ +DPKF++ + K  KIKLDDRFSKKDLE K+KA+VDKYGRRLK  ++K+ +
Sbjct: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQESKDKR 71

Query: 71  DFERYFXXXXXXX-------------------XXXXXXXXXTKVTSLDRARGEVPSDYXX 111
           DF++Y+                                    K  SLDRARGEV SDY  
Sbjct: 72  DFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDRARGEVHSDYVS 131

Query: 112 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVT 171
                                          +  +GD+++ LAVVNLDWDHVKSTDLMVT
Sbjct: 132 SSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDWDHVKSTDLMVT 191

Query: 172 FSSFVPKGGKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKK-KSQRKXXXXXXXXXX 230
           FSSFVPKGGKI ++AIYPSEFGKER+ +EE EGPPRE+F+ K+K K              
Sbjct: 192 FSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDEELTVK 251

Query: 231 XLYEEGDAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFD 290
            LYEEGDA+ D+D+K+             AVV+CNN +TAE+IY+NCDGTEYESTANMFD
Sbjct: 252 DLYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDGTEYESTANMFD 310

Query: 291 LRYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFT 350
           LRYVP+GMDF DE +DEC+ VPKNY+P++FSTDALQHS VK TWDETPA+R  M+KRAFT
Sbjct: 311 LRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAMAKRAFT 370

Query: 351 QKEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEG-GDVD 409
           Q+EIEDMDFKAYLASDSE SE E N++ +NKLKSLV++S+++G+KS+FD+   +G  DVD
Sbjct: 371 QREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPKDGESDVD 430

Query: 410 MEITFTPGL 418
           M+ITF P L
Sbjct: 431 MQITFAPAL 439

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 92/121 (76%)

Query: 503 SKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDP 562
           SKLNKKAHFNM EI+RSEKEKGK+ K+Q++ +IVEDEFKPDLNDPRF EVFEDHDFAIDP
Sbjct: 524 SKLNKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDP 583

Query: 563 SQPEFKGTTAMKEILKERNQRVSXXXXXXXXXLEQPRKNNNSNELNGLVAKLKRRNKKSR 622
           SQPEFKGT AMK+IL+ERN+R                + + +N+L GLV KLK  +K  R
Sbjct: 584 SQPEFKGTAAMKQILQERNKRSQKGKNKKREANGDIAEPSGNNDLKGLVNKLKHSSKNKR 643

Query: 623 K 623
           +
Sbjct: 644 Q 644

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  459 bits (1181), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 244/407 (59%), Positives = 283/407 (69%), Gaps = 6/407 (1%)

Query: 13  DPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETKDF 72
           D RF+ I SDPKF+  K KNLKIKLDDRFSK+DLE K+KAKVDKYGRR+     KE KDF
Sbjct: 14  DKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKEEKDF 73

Query: 73  ERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXXXXXXXXXXXXXXX 132
           E+YF                + V  LDRARGEVP+DY                       
Sbjct: 74  EKYFTKESSESAAEESDKEDSSVAKLDRARGEVPADYVSSSDEESSSESEADSDDATAES 133

Query: 133 XXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPSEF 192
                        +GD +++LAVVNLDWDHVK  DL+V F+SFVP+GGKI ++AIYPSEF
Sbjct: 134 DEEVEIEEEKPE-SGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYPSEF 192

Query: 193 GKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXXXXLYEEGDAEKDYDSKAXXXXXX 252
           GKERMQREEVEGPPRE+F+  KK  + K           LYE+GDAEKDYDSKA      
Sbjct: 193 GKERMQREEVEGPPREVFK-SKKDKKAKQDDDDEIGLKDLYEQGDAEKDYDSKALRRYQL 251

Query: 253 XXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDECEDVP 312
                  AVV+CNNV TAEAIYQNCDGTEYESTANMFDLRYVPEG+ F DEP++EC  VP
Sbjct: 252 ERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREECASVP 311

Query: 313 KNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDSEGSEE 372
           K+YKP QFST ALQH  VKLTWDETPA+RVEM+KRAF+QKEIEDMDFKAYLASDSE SE 
Sbjct: 312 KDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLASDSEESEA 371

Query: 373 EINEDSRNKLKSLVSESIRIGDKSLF-DKSDNEGGDVDMEITFTPGL 418
           + N +++NKL+SLVS S+++ DK LF D+SD E  DV  +ITFTPGL
Sbjct: 372 DDNSEAKNKLRSLVS-SVKVADKPLFADESDEEEADV--QITFTPGL 415

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 83/109 (76%), Gaps = 1/109 (0%)

Query: 505 LNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQ 564
           +N  AHFNM +ILRSEKE+GK++KYQ ++KIVED+FKPDLNDPRF+EVFED DFAIDPSQ
Sbjct: 500 INSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPSQ 559

Query: 565 PEFKGTTAMKEILKERNQRVSXXXXXXXXXLEQP-RKNNNSNELNGLVA 612
           PEFK T AMK+IL+ER +R S          EQ     +++ +L GLVA
Sbjct: 560 PEFKETAAMKQILQERRKRSSKSASKKRKTDEQSDSAMDSAGDLKGLVA 608

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  454 bits (1168), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 239/451 (52%), Positives = 297/451 (65%), Gaps = 34/451 (7%)

Query: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60
           M+   + N  + DPRF+ I++DPKF+  K K+LKIKLDDRFSKKDLEI++K+KVDKYGR+
Sbjct: 1   MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK 60

Query: 61  LKDV--DNKETKDFERYFXXXXXXXXXXXXXXXXTKV-------------------TSLD 99
           L D   + KE  DF++YF                +                     T++D
Sbjct: 61  LADSKGNEKEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNID 120

Query: 100 RARGEVPSDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLD 159
           RARG+VP+DY                                 +P +G+ ++ LAVVNLD
Sbjct: 121 RARGDVPADYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLD 180

Query: 160 WDHVKSTDLMVTFSSFVPKGGKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKS-- 217
           WDHVKS+DLM+TFSSF+P+GG+I  IAIYPSEFGKERMQRE+VEGPP+ELFQ +KKK+  
Sbjct: 181 WDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSK 240

Query: 218 ------QRKXXXXXXXXXXXLYEEGDAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAE 271
                 +             LYEEGDA+KD D+KA             AVV+CNN+ETA 
Sbjct: 241 SKKISDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETAT 300

Query: 272 AIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVK 331
           AIYQNCDGTEYESTANMFDLRYVP+GMDF+DEP+D+C+ +PKNYKP QFSTDALQHSNVK
Sbjct: 301 AIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVK 360

Query: 332 LTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIR 391
           LTWDETP ER E++KRAFTQKEI+DMDFKAYLASDS+GSE+E+NED++NKLK+LV     
Sbjct: 361 LTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGG-G 419

Query: 392 IGDKSLFDKSDNEGG----DVDMEITFTPGL 418
            G + +F     + G    +VDMEITF P L
Sbjct: 420 FGSREIFGGKGAKAGEDEDEVDMEITFNPAL 450

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (91%)

Query: 500 DTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFA 559
           +T S +N KAHFNM EILRSEKEKGKR KYQN++KIVEDEFKPDLNDPRF+EVFEDHDFA
Sbjct: 536 ETGSTINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFA 595

Query: 560 IDPSQPEFKGTTAMKEILKERNQRV 584
           IDPS+PEFK T AMKEILKER++R+
Sbjct: 596 IDPSRPEFKETKAMKEILKERSKRI 620

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  451 bits (1160), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 242/415 (58%), Positives = 291/415 (70%), Gaps = 11/415 (2%)

Query: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETK 70
           +NDPRFS I++DPKFK +  K LKIKLDDRF KKDLE+ ++AKVDKYGR++K+  +K+ +
Sbjct: 6   SNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEGSSKDIE 65

Query: 71  DFERYFXXXXXXXXXXXXXXXXTKVTS--LDRARGEVPSDYXXXXX--XXXXXXXXXXXX 126
           DF++YF                   +   +DRARGEVPSDY                   
Sbjct: 66  DFDKYFEKDEKSAEEESADEGDVAKSKKIVDRARGEVPSDYVSSEDEFTSSDSDTSGDSD 125

Query: 127 XXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIA 186
                           K  TGDAT+ LA VNLDWDHV+S D+MVTFSSF+PKGGKI KI 
Sbjct: 126 YDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGKIEKIC 185

Query: 187 IYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXX---XXLYEEGDAEKDYD 243
           IYPSEFGKERM+REEVEGPPRELFQ  KKK ++               LYEEG+A+   D
Sbjct: 186 IYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEESDVDIKDLYEEGNADDQVD 245

Query: 244 SKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDE 303
            +A             AV++CNNVE+A+AIY+NCDGTEYESTAN+ DLRYVP+GMDF DE
Sbjct: 246 KRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDGMDFDDE 305

Query: 304 PKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYL 363
           PKD+CE++PKNYKP QFSTDALQHSNVKLTWDETP +RVE++KRAFTQKEIEDMDFKAYL
Sbjct: 306 PKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDMDFKAYL 365

Query: 364 ASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGL 418
           ASDS+ SEEE+NE+++NKLKSLV ES++I  K   D SD + G +DMEITFTPGL
Sbjct: 366 ASDSDESEEEVNEEAKNKLKSLVGESLKIDGK---DGSDEDEG-MDMEITFTPGL 416

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/85 (71%), Positives = 74/85 (87%)

Query: 499 NDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDF 558
           N++ S +N KAHFNM EILRSEKEK K+ K+Q +++IVED+FKP+L+D RF+EVFEDHDF
Sbjct: 493 NESNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQRIVEDDFKPNLDDDRFKEVFEDHDF 552

Query: 559 AIDPSQPEFKGTTAMKEILKERNQR 583
           AIDPSQPEFK T AMKEILKER +R
Sbjct: 553 AIDPSQPEFKETKAMKEILKERRKR 577

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  445 bits (1145), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 233/425 (54%), Positives = 289/425 (68%), Gaps = 14/425 (3%)

Query: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60
           M+ DK L   + D RF+GI++DPKFK+ + ++ KIKLD RFSKKDLE++ K+KVDKYGR+
Sbjct: 1   MAVDK-LEKESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRK 59

Query: 61  LKDVDN-KETKDFERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXX 119
           +KD  N KE +DF++YF                T    +DRARGEVP+DY          
Sbjct: 60  IKDAHNTKELEDFDKYFEKEAENEEDTEADVKAT----VDRARGEVPNDYVSSGDEFTSS 115

Query: 120 XXXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKG 179
                                  KP +GDA++ LAVVNLDWDHVKS DLM+TFS FVPKG
Sbjct: 116 DSESSGESEIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFSGFVPKG 175

Query: 180 GKILKIAIYPSEFGKERMQREEVEGPPRELFQGKK------KKSQRKXXXXXXXXXXXLY 233
           GKI +I++YPSEFGKERMQREE+EGPP+ELFQ KK      K++              LY
Sbjct: 176 GKIERISVYPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDIGIKDLY 235

Query: 234 EEGDAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRY 293
           EEGDA+KD DS+A             A+V C+++ TA AIY+NCDGTEYESTANMFDLRY
Sbjct: 236 EEGDADKDVDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTANMFDLRY 295

Query: 294 VPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKE 353
           VP+GM F D  +D C  +PKNY+P QFSTDALQHSNVKLTWDETPA+RVE++KRAFTQKE
Sbjct: 296 VPDGMTFDDTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKE 355

Query: 354 IEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEIT 413
           I+DMDFKAYLASDS+ S+EE+NED+++KLKSLV   +    K   + +D +  +VDMEIT
Sbjct: 356 IDDMDFKAYLASDSDESDEEVNEDAKSKLKSLVG-GLGFNSKKE-NANDGDEEEVDMEIT 413

Query: 414 FTPGL 418
           FTP L
Sbjct: 414 FTPAL 418

 Score =  134 bits (337), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 61/85 (71%), Positives = 73/85 (85%)

Query: 500 DTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFA 559
           + ES +N KAHFNM EILRSEKEK K+++YQ +E+IVED F PDL DPRF+EVFEDHDFA
Sbjct: 502 EAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERIVEDNFTPDLEDPRFKEVFEDHDFA 561

Query: 560 IDPSQPEFKGTTAMKEILKERNQRV 584
           IDP+QPE+KGT AM +ILKER +RV
Sbjct: 562 IDPTQPEYKGTQAMNKILKERGKRV 586

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  442 bits (1137), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 232/413 (56%), Positives = 282/413 (68%), Gaps = 14/413 (3%)

Query: 13  DPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDV-DNKETKD 71
           D RF+GI+SDPKFK+ + K+ KIKLD RFSKKDLE++ K+KVDKYGR++K+  +NKE +D
Sbjct: 12  DTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNTQNNKELED 71

Query: 72  FERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXXXXXXXXXXXXXX 131
           F++YF                   T +DRARGE+  DY                      
Sbjct: 72  FDKYFQKEAENDEDTEASVK----TVVDRARGEISGDYVSSSDEFTSSDSESSEQSEVES 127

Query: 132 XXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPSE 191
                      KP  GD ++ LAVVNLDWDHVKS DLM+TFSSFVPKGGK+ ++AIYPSE
Sbjct: 128 EVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLERVAIYPSE 187

Query: 192 FGKERMQREEVEGPPRELFQGKKK-KSQRKXXXXXXXXX-----XXLYEEGDAEKDYDSK 245
           FGKERMQREEVEGPP+ELFQ K K K  RK                LYEEGDA+KD DS+
Sbjct: 188 FGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDIGINDLYEEGDADKDVDSR 247

Query: 246 AXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPK 305
           A             A+V+C+++ T++AIY NCDGTEYESTANMFDLRYVP+GM F D  +
Sbjct: 248 ALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAVR 307

Query: 306 DECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLAS 365
           DEC  +PKNY+P QFSTDALQHSNVKLTWDETPA+R+E++KRAFTQKEI+DMDFKAYLAS
Sbjct: 308 DECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLAS 367

Query: 366 DSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGL 418
           DS+ S+E+I+ED++NKLKSLV   I    K    K  +E  +VDMEITFTP L
Sbjct: 368 DSDESDEQIDEDAKNKLKSLVG-GINFNSKKENVKDSDE--EVDMEITFTPAL 417

 Score =  134 bits (337), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 60/85 (70%), Positives = 73/85 (85%)

Query: 500 DTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFA 559
           + +  +N KAHFNM EILRSEKEK K+++YQN+E+IVED F PDLNDPRF+EVFEDHDFA
Sbjct: 500 EAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERIVEDNFTPDLNDPRFKEVFEDHDFA 559

Query: 560 IDPSQPEFKGTTAMKEILKERNQRV 584
           IDP+QPE+K T AM +ILKER +RV
Sbjct: 560 IDPTQPEYKSTQAMNKILKERGKRV 584

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  439 bits (1130), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 238/412 (57%), Positives = 294/412 (71%), Gaps = 9/412 (2%)

Query: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDV-DNKET 69
           + DPRFS I+ DPKF + K K  K+KLDDRFSKKDLEIK+K KVDKYGRR++DV D+KE+
Sbjct: 6   SKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSKES 65

Query: 70  KDFERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXXXXXXXXXXXX 129
           KDF++YF                T++ ++DRARGEVPSDY                    
Sbjct: 66  KDFDKYFEQSDEEKKKDKD----TEILTVDRARGEVPSDYVSSSDEFTSSDSEVSDNEVE 121

Query: 130 XXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYP 189
                        +P +GD+++ LAVVNLDWD+V+S+DLM+TFSSF+P GG+I KIAIYP
Sbjct: 122 SESESEVELEKT-EPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYP 180

Query: 190 SEFGKERMQREEVEGPPRELFQGKKKKSQ--RKXXXXXXXXXXXLYEEGDAEKDYDSKAX 247
           SEFGKERMQREEVEGPP+ELFQ KKKKS+  ++           LYEEGDA+K+ D+KA 
Sbjct: 181 SEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDSDIDVKDLYEEGDADKNVDNKAL 240

Query: 248 XXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDE 307
                       AVV+CNNV  AE+IY NCDGTEYESTAN+FD+RYVP+GMDF  +PKD 
Sbjct: 241 RQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDS 300

Query: 308 CEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDS 367
           C ++PKNYKP QFSTDALQHSNVKLTWDETPA+R++++KRAFTQKEIEDMDFKAYLASDS
Sbjct: 301 CTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLASDS 360

Query: 368 EGSEEEINEDSRNKLKSLVSESIRIG-DKSLFDKSDNEGGDVDMEITFTPGL 418
           + SE+E++  S++KLKSLV+ S      +   D+ D    +VDMEITFTPGL
Sbjct: 361 DDSEDEVDAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGL 412

 Score =  100 bits (248), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 89/125 (71%), Gaps = 1/125 (0%)

Query: 499 NDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDF 558
           +DTE  +NKKAHFNM EIL+SEKEK K+ KYQ++ KIV D+FKPDL DPRF+E+FE HDF
Sbjct: 492 DDTEKSINKKAHFNMKEILKSEKEKKKKNKYQDKNKIVVDDFKPDLEDPRFKEMFEGHDF 551

Query: 559 AIDPSQPEFKGTTAMKEILKERNQRVSXXXXXXXXXLEQPRKNNNSNELNGLVAKLKRRN 618
           AIDP+Q EF+GT AMKE+L +R+++            ++   N N +  N +VAKLK+  
Sbjct: 552 AIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQENDTNENGDIAN-IVAKLKKGG 610

Query: 619 KKSRK 623
           +K  K
Sbjct: 611 RKKVK 615

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  437 bits (1124), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 283/413 (68%), Gaps = 14/413 (3%)

Query: 13  DPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDV-DNKETKD 71
           D RF+GI+SDPKFK+ K K+ KIKLD RFSKKDLE++ K+KVDKYGR++K+  +N+E +D
Sbjct: 12  DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNRELED 71

Query: 72  FERYFXXXXXXXXXXXXXXXXTKVTSLDRARGEVPSDYXXXXXXXXXXXXXXXXXXXXXX 131
           F++YF                   T +DRARGEVP DY                      
Sbjct: 72  FDKYFEKEAENDEDSEVNAK----TVVDRARGEVPDDYVSSSDEFTSSDSESSGESEVES 127

Query: 132 XXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPSE 191
                      KP +GD ++ LAVVNLDWDHVKS DLM+TFSSFVPKGGKI ++AIYPSE
Sbjct: 128 EEENEVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSE 187

Query: 192 FGKERMQREEVEGPPRELFQGKKKKSQRKXXXXXXXXX------XXLYEEGDAEKDYDSK 245
           FGKERMQREEVEGPP+ELFQ K K    K                 LYEEGDA+KD DS+
Sbjct: 188 FGKERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKDLYEEGDADKDVDSR 247

Query: 246 AXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPK 305
           A             A+V+C++  T++AIY NCDGTEYESTANMFDLRYVP+GM F D+ +
Sbjct: 248 ALRQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVR 307

Query: 306 DECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLAS 365
           DEC  +PKNY+P QFSTDALQHS+VKLTWDETPA+RVE++KRAFTQKEI+DMDFKAYLAS
Sbjct: 308 DECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLAS 367

Query: 366 DSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGL 418
           DS+ S+ +++E+++NKLKSLV +    G  S  +  ++E  +VDMEITFTP L
Sbjct: 368 DSDESDGQVDEEAKNKLKSLVGD---FGFNSKKETPNDEDEEVDMEITFTPAL 417

 Score =  131 bits (329), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (87%)

Query: 505 LNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQ 564
           +N KAHFNM EILRSEKEK K+ +YQ +E+IVED F PDL DPRF+EVFEDHDFAIDP+Q
Sbjct: 506 INNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQ 565

Query: 565 PEFKGTTAMKEILKERNQRV 584
           PEFKGT AM +ILKER++RV
Sbjct: 566 PEFKGTQAMSKILKERSKRV 585

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  428 bits (1100), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 231/428 (53%), Positives = 284/428 (66%), Gaps = 20/428 (4%)

Query: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLK--DVDNKE 68
           ++DPRFSG+++DPKF+  K K LK+KLD RFSKKDLE+KKKAKVDKYGR++K  D + KE
Sbjct: 6   SSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDANKKE 65

Query: 69  TKDFERYFXXXXXXXXXXXXXXXXTKV-TSLDRARGEVPSDYXXXX-----XXXXXXXXX 122
            +DF++YF                  V   +DRARGEVP DY                  
Sbjct: 66  LEDFDKYFEKEDEAKESEDAEAPEAPVKVVVDRARGEVPDDYVSSADEFTSSDSESSGSS 125

Query: 123 XXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKI 182
                               KP +GD ++ LAVVNLDWDHVKS DLM+TF+ F+PKGGKI
Sbjct: 126 ESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGGKI 185

Query: 183 LKIAIYPSEFGKERMQREEVEGPPRELFQGKKK-----------KSQRKXXXXXXXXXXX 231
            +I IYPSEFGKER+ REE EGPP+ELF  KK            +S +            
Sbjct: 186 ERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSKGAESGKSDDDVSDVDIKD 245

Query: 232 LYEEGDAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYESTANMFDL 291
           LYEEGDAEKD DSKA             AVV+CNNVETA+AIY NCD TEYESTANMFDL
Sbjct: 246 LYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMFDL 305

Query: 292 RYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQ 351
           RYVPEGM F D+P+DECE +PKNYKP  F+TDALQHSNVKLTWDETPA+RVE++KRAF+Q
Sbjct: 306 RYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAFSQ 365

Query: 352 KEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIG-DKSLFDKSDNEGGDVDM 410
           KEI+DMDFKAYLASDSE S+ +++E  +N+LK+LV  +++    K   ++ +++   +DM
Sbjct: 366 KEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAEEDEDDEEGMDM 425

Query: 411 EITFTPGL 418
           EITFTPGL
Sbjct: 426 EITFTPGL 433

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 75/85 (88%)

Query: 500 DTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFA 559
           D++S LNKK HFNM EI+RSEKEK K++K+Q++ +IVEDEFKPDL+D RF+EVFEDHDFA
Sbjct: 519 DSKSTLNKKMHFNMNEIMRSEKEKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFA 578

Query: 560 IDPSQPEFKGTTAMKEILKERNQRV 584
           IDPS+PEFK T AM++IL+ER+ R 
Sbjct: 579 IDPSRPEFKETPAMQKILQERSNRA 603

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  426 bits (1095), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 231/438 (52%), Positives = 287/438 (65%), Gaps = 33/438 (7%)

Query: 13  DPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETKDF 72
           D RF+G+ +DPKF+ +K  +LK+KLD+RFSKKDL++  K+KVD+YGR++ D + K+ KDF
Sbjct: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRNEKDKKDF 68

Query: 73  ERYFXXXXXXXXXXXXXXXX----------------------TKVTSLDRARGEVPSDYX 110
           ++Y+                                       ++  LDRARG+VPSDY 
Sbjct: 69  DKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRARGDVPSDYV 128

Query: 111 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPPTGDATRMLAVVNLDWDHVKSTDLMV 170
                                           KP TGD ++ +AVVNLDWDHVKSTDLM+
Sbjct: 129 SSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWDHVKSTDLMI 188

Query: 171 TFSSFVPKGGKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKK-----SQRKXXXXX 225
           TFS F+PKGGKI KIAIYPSEFGKERMQREE+EGPP+ELF+ K KK     ++       
Sbjct: 189 TFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKSTAEDNEDDVS 248

Query: 226 XXXXXXLYEEGDAEKDYDSKAXXXXXXXXXXXXXAVVFCNNVETAEAIYQNCDGTEYEST 285
                 LYEEGDA+K+ DSK+             AVV+CNN+ TAE+IY+NCDGTEYEST
Sbjct: 249 DVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKNCDGTEYEST 308

Query: 286 ANMFDLRYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMS 345
           AN+FD+RYVP+ M F D P+DEC+ +PKNYKP QFSTDALQHSNVKLTWDETPA+RVE+S
Sbjct: 309 ANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADRVEIS 368

Query: 346 KRAFTQKEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESI---RIGDKSLF--DK 400
           KRAF+QKEI++MDFKAYLASDS+ SE E+N DS+NKLKSLV         G  + +  D 
Sbjct: 369 KRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGGAFGNVFGKDTEYDLDG 428

Query: 401 SDNEGGDVDMEITFTPGL 418
           SD+E G VDMEITFTPGL
Sbjct: 429 SDDEDG-VDMEITFTPGL 445

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%)

Query: 499 NDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDF 558
           +D  S +N KAHFNM EILRSEKEKGK++KYQ++ KIV+DEFKP+LND RF E+FEDH F
Sbjct: 533 DDRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAF 592

Query: 559 AIDPSQPEFKGTTAMKEILKERNQRVS 585
           AIDP+QPEFK T+AMKEIL ER +R S
Sbjct: 593 AIDPTQPEFKQTSAMKEILNERTKRAS 619

>AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR145W (ENP2)
          Length = 689

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 8/45 (17%)

Query: 530 QNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMK 574
           Q  EKI+EDE        RF+E+FED DF +D    ++K    +K
Sbjct: 474 QAAEKILEDE--------RFKEMFEDEDFLVDEDDYDYKQLNPVK 510

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,992,286
Number of extensions: 2397659
Number of successful extensions: 8406
Number of sequences better than 10.0: 82
Number of HSP's gapped: 8607
Number of HSP's successfully gapped: 111
Length of query: 623
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 507
Effective length of database: 40,180,143
Effective search space: 20371332501
Effective search space used: 20371332501
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)