Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02354g5.426ON1458145877600.0
KLTH0F16236g5.426ON1460146069190.0
NDAI0C016205.426ON1460146068320.0
Ecym_55255.426ON1459145768310.0
AER252C5.426ON1459145968280.0
NCAS0H020405.426ON1460145368110.0
KLLA0E21253g5.426ON1457145368070.0
TDEL0E019905.426ON1460146067830.0
YOR116C (RPO31)5.426ON1460146067600.0
Smik_15.2945.426ON1460146067420.0
Suva_8.1695.426ON1460146067300.0
Skud_15.2795.426ON1460146067260.0
ZYRO0F09856g5.426ON1458145866950.0
KAFR0D050305.426ON1462145266770.0
Kpol_1016.95.426ON1460146066700.0
CAGL0L11660g5.426ON1459145965780.0
TBLA0A037205.426ON1458145965660.0
KNAG0B042405.426ON1455146164980.0
TPHA0H017605.426ON1459145164660.0
Kwal_55.214595.426ON1148114454600.0
Ecym_80657.314ON1743150918920.0
ZYRO0F05918g7.314ON1744150218890.0
ADR086C7.314ON1745151318690.0
KLLA0F05071g7.314ON1720149118650.0
KLTH0H02046g7.314ON1740152818550.0
SAKL0F10472g7.314ON1730150418540.0
Kwal_56.244897.314ON1728153018490.0
Skud_4.1147.314ON1726151618380.0
YDL140C (RPO21)7.314ON1733151216870.0
Kwal_55.21464singletonOFF32031514460.0
KNAG0C039707.314ON172192114851e-177
KAFR0B010607.314ON168592914751e-176
TDEL0C023207.314ON172793014601e-174
TBLA0F021707.314ON172692714581e-173
Suva_4.1047.314ON173392514581e-173
CAGL0I03828g7.314ON171591714541e-173
Smik_4.957.314ON171992514511e-172
NDAI0A021307.314ON172992314511e-172
TPHA0A030707.314ON171993114481e-172
NCAS0A139007.314ON171692814421e-171
Kpol_162.1singletonON131157712621e-149
CAGL0E05500g7.51ON164399111521e-131
YOR341W (RPA190)7.51ON166498011511e-131
KAFR0K005407.51ON166297811451e-130
Kwal_26.69797.51ON165497911391e-130
Smik_15.5197.51ON166598011351e-129
ZYRO0D04532g7.51ON166798511351e-129
Skud_15.5067.51ON166598011331e-129
KNAG0D049707.51ON167196711331e-129
TPHA0H028007.51ON1648108611291e-128
KLLA0F23243g7.51ON165397611271e-128
Suva_8.3917.51ON166598011261e-128
KLTH0D01628g7.51ON165497911221e-127
Kpol_1040.37.51ON165697411171e-127
NDAI0H012007.51ON166996811171e-127
TDEL0H040007.51ON166597811111e-126
NCAS0F007307.51ON167491211101e-126
TBLA0E019307.51ON165997510961e-124
SAKL0B10736g7.51ON165098310681e-120
ADR374C7.51ON164098010651e-120
Kpol_1019.277.314ON3642831895e-14
KAFR0A014501.274ON111699801.5
TPHA0H014405.359ON87555772.9
CAGL0F07381gsingletonON534105763.3
CAGL0F07249g6.141ON536105763.6
KLLA0E16369g5.125ON326151754.3
YOR236W (DFR1)8.657ON211165735.3
CAGL0J04928g1.332ON106588755.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02354g
         (1458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2993   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2669   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2636   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2635   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2634   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2628   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2626   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2617   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2608   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2601   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2597   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2595   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2583   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2576   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2573   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2538   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2533   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2507   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2495   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  2107   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   733   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   732   0.0  
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   724   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   723   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   719   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   718   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   716   0.0  
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   712   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   654   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   561   0.0  
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   576   e-177
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   572   e-176
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   566   e-174
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   566   e-173
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   566   e-173
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   564   e-173
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   563   e-172
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   563   e-172
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   562   e-172
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   560   e-171
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   490   e-149
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   448   e-131
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   447   e-131
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   445   e-130
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   443   e-130
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   441   e-129
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   441   e-129
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   441   e-129
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   441   e-129
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   439   e-128
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   438   e-128
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   438   e-128
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   436   e-127
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   434   e-127
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   434   e-127
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   432   e-126
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   432   e-126
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   426   e-124
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   416   e-120
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   414   e-120
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    77   5e-14
KAFR0A01450 Chr1 (286034..289384) [3351 bp, 1116 aa] {ON} Anc_1....    35   1.5  
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    34   2.9  
CAGL0F07381g Chr6 complement(719330..720934) [1605 bp, 534 aa] {...    34   3.3  
CAGL0F07249g Chr6 (705576..707186) [1611 bp, 536 aa] {ON} highly...    34   3.6  
KLLA0E16369g Chr5 complement(1464299..1465279) [981 bp, 326 aa] ...    33   4.3  
YOR236W Chr15 (780906..781541) [636 bp, 211 aa] {ON}  DFR1Dihydr...    33   5.3  
CAGL0J04928g Chr10 complement(468765..471962) [3198 bp, 1065 aa]...    33   5.6  

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2993 bits (7760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1444/1458 (99%), Positives = 1444/1458 (99%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLN              LKIIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420
            RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN
Sbjct: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420

Query: 421  GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480
            GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR
Sbjct: 421  GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
            LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL
Sbjct: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600
            TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY
Sbjct: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600

Query: 601  LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660
            LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG
Sbjct: 601  LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720
            VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD
Sbjct: 661  VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720

Query: 721  LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
            LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI
Sbjct: 721  LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780

Query: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
            RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP
Sbjct: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840

Query: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
            QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN
Sbjct: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900

Query: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIEN 960
            TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIEN
Sbjct: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIEN 960

Query: 961  TNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKI 1020
            TNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKI
Sbjct: 961  TNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKI 1020

Query: 1021 RKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRAK 1080
            RKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRAK
Sbjct: 1021 RKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRAK 1080

Query: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140
            VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN
Sbjct: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140

Query: 1141 AVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELTI 1200
            AVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELTI
Sbjct: 1141 AVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELTI 1200

Query: 1201 EDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQH 1260
            EDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQH
Sbjct: 1201 EDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQH 1260

Query: 1261 LRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEI 1320
            LRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEI
Sbjct: 1261 LRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEI 1320

Query: 1321 FNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDS 1380
            FNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDS
Sbjct: 1321 FNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDS 1380

Query: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDLK 1440
            VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDLK
Sbjct: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDLK 1440

Query: 1441 PKHTLFESLCNDVALKTH 1458
            PKHTLFESLCNDVALKTH
Sbjct: 1441 PKHTLFESLCNDVALKTH 1458

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2669 bits (6919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1268/1460 (86%), Positives = 1363/1460 (93%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVVDIAPK+IKGLEFSALSASDIVAQS+VEISTRDLFDLENGR PK GGALDT+MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS AECSTCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ +CK CA++LLS++DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
             QFL+ELRRPG+DNLRRMG LKK++DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEK+KWVGDWK VL HNPELERY+K+CMDDLNPLKTLNLFKQV PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS VKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS-GGKTKPIRGFCQRLKGKQ 359
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPG S GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYNK KLQQLVI
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420

Query: 420  NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGPN HPGANYLLKK+++ARRNLRYGDRMKLA+NLQYGDVVERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPH 599
            LTPKSGEPIIAATQDFITGSYLISHKDSFF RA   QLLSMMSDGN+QFD+PPP++MKP+
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600

Query: 600  YLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILS 659
            Y+WTGKQVFSLLIRPNK+SPV+IN+DAKNKV++PPK K LPNEMS+NDG+VVIRGS+ILS
Sbjct: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGA 719
            GVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCAR+LGNRGFSIGI+DVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720

Query: 720  DLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
            +LK KKE  VE+AYAKCD LID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            I+ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIE 959
            NT+RTSSNGIVQFTYGGDGLDP+DMEGNAQPVNF+RSW+HANN+TF H D  LLPYQI++
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960

Query: 960  NTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAK 1019
             TN +LKPLE+KLVR+DNLGN+L+   ++++EYIDQ DAERNFY+SLRDYM EKA+HLA 
Sbjct: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020

Query: 1020 IRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRA 1079
            IR  KGLK  LDEPA EL+ ++LDE  P   L +V+QLCKIS  LV  FL IAI KYH+A
Sbjct: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            KVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELT 1199
            NAVLVN+ DERAARVVKGRIEKT+LSDV +YIQDVYKDN+SF+Q KVDLGTIEKLQLELT
Sbjct: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200

Query: 1200 IEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQ 1259
            +EDIAVAITRA+KLKI+ +DVSI+G++K+NINV+PE  K KSISTSAKEP EN +FYRMQ
Sbjct: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260

Query: 1260 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319
            HLRRALPGIVVKGLPDI+RAVINI+DDG RELLVEGYGLR+VMTTDGVIG KTKTNHILE
Sbjct: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320

Query: 1320 IFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379
            +F+VLGIEAARTSIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDL 1439
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT ISE DL
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440

Query: 1440 KPKHTLFESLCNDV-ALKTH 1458
             PK TLFESLC+ V ALK +
Sbjct: 1441 APKPTLFESLCDSVTALKVN 1460

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2636 bits (6832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1256/1460 (86%), Positives = 1351/1460 (92%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVV   PK+I GLEFSALSA+DIVAQSEVEIS+RDLFDLE GR PK GGALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQG+CK C++ILLSD D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL ELRRPGVDNLRRMG LKK+LDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            D FRWVGKKSAPEK+KWVGDWK+VL H+PELER++KRC DDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG++S VKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            AGLEKGISINNMME WDYLQL VAMYINSDSVNPAM+PGAS  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGPN+HPGANYLLK N+DARRNLRYGDR+KLAKNLQ+GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM D N+QFD+PPPA+MKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
            HYLWTGKQ+FSLLI+PNK SPV+IN+DAKNKV++PPK K  PNEMS NDG+V+IRGS+IL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCAR+LGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE+ VE AYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDP++MEGNA+PVNFNRSWDHA NITF+    GLLPYQI+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
            E TN+ILKPLE +L+R+DNLG  +  ED  K EY+DQ DAER+FY+SLRDYM EKA  L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
             +RK++G+  ++DEPA ELK +N DEQ PE I  +V+QL KI+++LV+ FL IA+ KY +
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198
            INAVLVN+ DERAARVVKGRIEKT+LSDV YYIQDVYKDNLSFIQ ++DL TIEKLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258
            TIEDIAVA+TRA KLKI T+DV+I+G++KI INVFPEGYKAKSIST+AKEP+ENAVFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            QHLRRALP IVVKGLP+I+RAVINIRDDGKRELLVEGYGLRDVM TDGVIG KT TNHIL
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            E+  VLGIEAAR+SIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT I++E 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1439 LKPKHTLFESLCNDVALKTH 1458
            LKPK TLFE+L +  ++K +
Sbjct: 1441 LKPKPTLFENLTSSRSIKMN 1460

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2635 bits (6831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1262/1457 (86%), Positives = 1353/1457 (92%), Gaps = 1/1457 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVVD+APKKIKGL FSALSASDIVAQSEVEI TRDLFDLENGR PK GGALD+KMGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS AECSTCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQ +CKNCA+ILLS+++K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFLAELRRPG+DNLRRM TL+K+LDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEKEKW+GDW QVL+HNPELERYMKR MD+LNPLKTLNLFKQV+ +DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS VK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKP-IRGFCQRLKGKQ 359
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNPA+MPG +GG     IRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPE+VTRYNKHKLQQL+I
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLII 420

Query: 420  NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGPN+HPGANY+LKKN+DARRNLRYGDR+KLAKN+Q GDVVERHIEDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPH 599
            LTPKSGEPII+ATQDFITGSYLISHKDSFFDRAT TQLLSMM+D NMQFDLPPPA++KP 
Sbjct: 541  LTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKPC 600

Query: 600  YLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILS 659
            YLWTGKQVFSLLIRPNKKSPVIIN+DAKNKV++PPK+K  PNEMS NDG+V+IRGSEIL 
Sbjct: 601  YLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEILC 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGA 719
            GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCARYLGNRGFSIGI+DVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPGK 720

Query: 720  DLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
            +LK KKE+ VE AYAKCDELID F +G+LETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            IRELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVR+SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIE 959
            NTVRTSSNG+VQFTYGGDGLDPL+MEGNAQPVNFNRSWDHANNITF +++ GLLPYQI+E
Sbjct: 901  NTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIME 960

Query: 960  NTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAK 1019
             +NSIL PLE++L+R DN+GN ++ +     EYIDQ+DAER+FYQSLR YMT KA  LA+
Sbjct: 961  TSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLAQ 1020

Query: 1020 IRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRA 1079
            IRK+KGLK+LL+EPA ELK ++LD       L ++NQLCKIS NLV TFL IAISKYH+A
Sbjct: 1021 IRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHKA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            KVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELT 1199
            NA+LVND DERAARVVKGRIEKT+LSDVV+YIQDVY+DN+SFIQ KVDL TIEKLQLELT
Sbjct: 1141 NALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLELT 1200

Query: 1200 IEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQ 1259
            IEDIA+AI+RA KLKIST DVSI+G+NKINI+V  +  K KSIST   EP+EN VFYRMQ
Sbjct: 1201 IEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYRMQ 1260

Query: 1260 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319
            HLRRALP IVVKGLPDISRAVINI +DGKRELLVEGYGLRDVMTTDGVIG KTKTNH LE
Sbjct: 1261 HLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHFLE 1320

Query: 1320 IFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379
            +F VLGIEAARTSI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD
Sbjct: 1321 VFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDL 1439
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV+GT+IS ++L
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMDEL 1440

Query: 1440 KPKHTLFESLCNDVALK 1456
            KP  TLFE+LCN+ ALK
Sbjct: 1441 KPNPTLFENLCNNTALK 1457

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2634 bits (6828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1256/1459 (86%), Positives = 1349/1459 (92%), Gaps = 1/1459 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVVDI PK+I GLEFSALSASDIVAQSEVEI TRDLFDLE+GR PK GGALD++MGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS AECSTCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ +CKNCA +LL+++DK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL+ELRRPG+DNLRRM TLKK+LDQCKKQRRCLHCGMLN              LKIIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEK+KW+GDW QVL+H+PELERYMKR M++LNPLKTLNLFKQ+ P+DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS VK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGG-KTKPIRGFCQRLKGKQ 359
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNPA+MPG +GG KTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYNKHKLQQL++
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420

Query: 420  NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NG N+HPGANYLLKKN++ARRNLRYGDR+KLAKNLQ GDVVERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPH 599
            LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT  Q+LSMMSDGN+QFD+PPPA+M+PH
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600

Query: 600  YLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILS 659
            YLWTGKQ+FSLLI+PNKKSPVIIN+DAKNKV++ PK+K  PNEMS NDG+VVIRGS ILS
Sbjct: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGA 719
            GVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCARYLGNRGFSIGISDVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720

Query: 720  DLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
            +LK  KE+ VE AYAKCDELID + +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            IRELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIE 959
            NTVRTSSNGIVQFTYGGDGLDPL+MEGNA+PVNFNRSWDHANNIT+ H D G+LPYQI+E
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960

Query: 960  NTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAK 1019
             TN+IL PLEQ+L R+DN+GN L    E +  YIDQHDAER FYQSLR YM+EKA  LA 
Sbjct: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020

Query: 1020 IRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRA 1079
            I K++GLK L   PA EL++++LD   PE  + +VNQLCKIS  LV TFL IAISKY +A
Sbjct: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            KVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELT 1199
            NA LVND DERAARVVKGR+EKT+LSDV++YIQDVY+DN+SF+Q KVDL TIEKLQLELT
Sbjct: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200

Query: 1200 IEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQ 1259
            +EDIA+AIT A KLKIST DVSIVGRNKININV  +  KAKSIST A EP EN VF++MQ
Sbjct: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260

Query: 1260 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319
            HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGV+G KTKTNH LE
Sbjct: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320

Query: 1320 IFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379
            +++VLGIEAARTSI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD
Sbjct: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDL 1439
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVKGT+IS +DL
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440

Query: 1440 KPKHTLFESLCNDVALKTH 1458
            KPK TLFE+LC+   LK +
Sbjct: 1441 KPKPTLFENLCSLNTLKVN 1459

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2628 bits (6811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1255/1453 (86%), Positives = 1350/1453 (92%), Gaps = 2/1453 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVV   PK+I GLEFSALSA+DIVAQSE+E+S+RDLFDLE GR PK+GGALD KMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCK C++ILL+D DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL ELRRPGVDNLRRMG LKK+LDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEK+KWVGDWK+VL H+PELER+MKRC DDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS VKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            AGLEKGISINNMME WDYLQL VAMYINSDSVNPAM+PGAS  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYNK KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGPN+HPGANYLLKKN+DARRNLRYGDR+KLAKNLQ+GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMS+G ++FD+PPPA+MKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
            +Y+WTGKQVFSLLIRPNK+SPV+IN+DAKNKVFMPPK+K  PNEMS NDG+VVIRGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRM+KLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE+ VE AYAKCDELIDQF+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDP++MEGNA+PVNFNRSWDHA NITF++ + GLLPY+I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
            E TN ILKPLE++L+R+DN+G  + K+D EK EY+DQ DAER+FY+SLRDY+ EKA  LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
            ++RK++G+  +  EP  EL+ L+ DE+  E I  +V+QL KI++  V+TFL IA+ KY +
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198
            INAVLVN+ DERAARVVKGRIEKT+LSD+ YYIQDVYKDNLSFIQ +VDLGTIEKLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLEL 1200

Query: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258
            TIEDIAVAIT+A KLKI T+DV+I+G++KI INV+P+GYKAKSIST AKEPS NAVFYRM
Sbjct: 1201 TIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYRM 1260

Query: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            QHLRR LP IVVKG  DISRAVINIRDDGKRELLVEGYGLRDVM TDGVIG KT TNHIL
Sbjct: 1261 QHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            E+ NVLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT+ISE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEAD 1440

Query: 1439 LKPKHTLFESLCN 1451
            LKPK TLFE L N
Sbjct: 1441 LKPKPTLFEKLSN 1453

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2626 bits (6807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1250/1453 (86%), Positives = 1333/1453 (91%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKE V+DIAPKKIKG+ FSALSA+DIV+QSEVEISTRDLFDL+NGR+ K GGALD +MGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS AEC+TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ VCK C ++LLS++DK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R+FL ELRRPG+DNLRRM  LKKILDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEKE+W+GDWKQVLE+NPELERY+KRCMDDLNPLK LNLFKQ+KP DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS  KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP+M+PG+SG K+KPIRGFCQRLKGKQG
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQG 360

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420
            RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYNKHKLQQLVIN
Sbjct: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVIN 420

Query: 421  GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480
            GP +HPGANYLLKKN+DARRNLRYGDR+KLAK LQYGDVVERHIEDGDVVLFNRQPSLHR
Sbjct: 421  GPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHR 480

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
            LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL
Sbjct: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600
            TPKSGEPIIAATQDFITGSYLISHKDSFFDRA LTQLLSMMSD N+QFD+PPP++MKPHY
Sbjct: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHY 600

Query: 601  LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660
            LWTGKQVFSLLI+P++KSPV+IN+DAKNKV++PP  K  PNEMS NDGFV+IRGS ILSG
Sbjct: 601  LWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSG 660

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720
            VMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCARYLGNRGFSIGI+DVTPG+D
Sbjct: 661  VMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSD 720

Query: 721  LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
            LKQKKE  VE AYAKCDELID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI
Sbjct: 721  LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780

Query: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
            RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP
Sbjct: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840

Query: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
            QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN
Sbjct: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900

Query: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIEN 960
            TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSW HANN+T      GLLPYQII  
Sbjct: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAE 960

Query: 961  TNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKI 1020
            TN IL+PLE KL R+DN+G +L KEDE K EYIDQ DAER+FYQSLR++MTEKA  LA +
Sbjct: 961  TNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASL 1020

Query: 1021 RKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRAK 1080
            R  +GLK L+DEPA EL+  N DE  P  I  A+NQLCKISK LV+ FL IAISKYHRA+
Sbjct: 1021 RGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRAR 1080

Query: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140
            VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN
Sbjct: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140

Query: 1141 AVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELTI 1200
            AVLVND DERAARVVKGR+EKT+LSDV +Y+QD+Y+DN++F+Q K+D  TIEKLQLELT+
Sbjct: 1141 AVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELTL 1200

Query: 1201 EDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQH 1260
            EDI VAI +A KLKI T D+SI+G++KINI V  +G   KSIST+ KEP  N VFYRMQ 
Sbjct: 1201 EDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQ 1260

Query: 1261 LRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEI 1320
            LRRALP IVVKG  DISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE+
Sbjct: 1261 LRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEV 1320

Query: 1321 FNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDS 1380
            ++VLGIEAAR+ I+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMRDS
Sbjct: 1321 YDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDS 1380

Query: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDLK 1440
            VLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK T + E DL 
Sbjct: 1381 VLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDLT 1440

Query: 1441 PKHTLFESLCNDV 1453
            PK TLFE+LC+ V
Sbjct: 1441 PKPTLFETLCDTV 1453

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2617 bits (6783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1243/1460 (85%), Positives = 1342/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVV   PK+I GLEFSALSA+DIVAQSEVEISTRDLFDLENGR P+ GGALD KMGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC+TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQG+CKNC+++LL D D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPGVDNLRRMG L K+LDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+KWVGDW +VL HNPELERY+KRCMDDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            +GLEKGISINNMME WDYLQL+VAMYINSDSVNPAMMPGAS  GGK KPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+ KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGPN+HPGANYLLKK++DARRNLRYGDR+KLAKNL+ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDR +LTQLLSMMSDGN+QFD+P PA+MKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
             YLWTGKQVFSLLI+PNKKSPV+IN+DAKNKVF+PPK K LP+EMS NDG+V+IRGSEIL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLK+KKED VE AYAKCDELID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSW+HA N+TF + + GL PYQI 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
            E T+ IL PL  +L+R+DN+G  + KE +  IEYIDQ+DAERNFY SL+ +M  KA  LA
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
             +RK +G+K LLDEP PE K ++ DE  PE I  +V+QLC+I+ + V  FL IAISKY R
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198
            INAVLVND DERAARVVKGRIEKT+LSDV +YIQDVY+DNLSF+Q ++DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200

Query: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258
            TIEDIAVAITRA KLKI  +DV+I+ ++KI INVFPEGYKAKSISTSAKEP EN VF+RM
Sbjct: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260

Query: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRR+LPGIVVKGLPDISRAVIN+RDD KRELLVEGYGLRDVM+TDGV+G KT TNHIL
Sbjct: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            E+F+VLGIEAAR SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+KGT + E+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440

Query: 1439 LKPKHTLFESLCNDVALKTH 1458
            L+PK TLFESL  + A+K +
Sbjct: 1441 LRPKPTLFESLSKETAIKAN 1460

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2608 bits (6760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1244/1460 (85%), Positives = 1345/1460 (92%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVV   PK+IKGLEFSALSA+DIVAQSEVE+STRDLFDLE  R PK  GALD KMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CKNC++ILLS+ DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL ELRRPGVDNLRRMG LKKILDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEK+ WVG+WK+VL HNPELERY+KRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+ V SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG+S  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+HKLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            +NGPN+HPGANYLLK+N+DARRNLRYGDRMKLAKNLQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMMSDG   FD+PPPA+MKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
            +YLWTGKQVFSLLI+PN  SPV+IN+DAKNKVF+PPK K LPNEMS NDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE+ VE AY KCDELI  FNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSWDHA NITF ++D GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
            E  N IL PLE++LVR+DN G  + +ED  K EY+DQ+DAER+FY SLR+Y+  KAT LA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
             +RK++G+  LL+ PA EL+ ++ DE  P+ + T+V+QL +IS+  V  FL IA+ KY +
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198
            INAVLVND DERAARVVKGR+EKT+LSDV +Y+QDVYKDNLSFIQ ++DLGTI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258
            TIEDIAVAITRASKLKI  +DV+I+G+++I INVFPEGYKAKSISTSAKEPSEN VFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRRALP +VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGS+T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            E+F+VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT+ISE+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1439 LKPKHTLFESLCNDVALKTH 1458
            L PK  LFESL N+ ALK +
Sbjct: 1441 LVPKRCLFESLSNEAALKAN 1460

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2601 bits (6742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1237/1460 (84%), Positives = 1346/1460 (92%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVV   PK+IKGLEFSALSA+DIVAQSEVE+STRDLFDLE  R PK  GALD KMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CKNC++ILLS+ DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPGVDNLRRMG LKKILDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEK+ WVG+WK+VL HNPELERY+KRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+ V SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG+S  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+HKLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            +NGPN+HPGANYLLK+N+DARRNLRYGDR+KLAKNLQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMMSDG  QFD+PPPA+MKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
            +YLWTGKQVFSLLI+PN  SPV+IN+DAKNKVF+PPK K LPNEMS NDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE+ VE AY+KCDELI  FNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSWDHA NITF ++D GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
            + TN IL+PLE++LVR+DN G  + +E+  K EY+DQ+DAER+FY+SL++Y+  KAT LA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
             +RK++G+  LL+ P  E + ++ D+  P+ + T+V+QL +IS+  V  FL IA+ KY +
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198
            INAVLVND DERAARVVKGR+EKT+LSDV YY+QDVYKDNLSFIQ ++DLGTI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258
            TIEDIAVAITRA+KLKI  +DV+I+G+++I INVFPEGYKA+SISTSAKEPSEN VFYRM
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRRALP +VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGS+T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            E+F+VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT+ISE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1439 LKPKHTLFESLCNDVALKTH 1458
            L PK  LFESL N+ ALK +
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2597 bits (6730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1239/1460 (84%), Positives = 1343/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVV   PK+IKGLEFSALSA+DIVAQSEVE+STRDLFDLE  R P+  GALD KMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CKNC++ILLS+ DK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R+FL ELRRPGVDNLRRMG LKKILDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEK+ WVG+WK+VL HNPELERY+KRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+ V SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG+S  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+HKLQ+LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            +NGPN+HPGANYLLKKN+DARRNLRYGDRMKLAK+LQ GDV+ERH+EDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLL MMSDG  QFD+PPPA+MKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
            +YLWTGKQVFSLLI+P+ KSPV+IN+DAKNKVF+PPK K LP+EMS NDGFVVIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE+ VE AY KCDELI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSWDHA NITF ++D GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
            E  N IL PLE +LVR+DN G  +  ED++K E++DQ+DAER+FY+SLR+Y+  KAT LA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
             +RK++G+  L++ P  EL+ ++ DE  P  + T+V+QL +IS+  V+ FL IA+ KY +
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198
            INAVLVND DERAARVVKGR+EKT+LSDV YY+QDVYKDNLSFIQ ++DLGTI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258
            TIEDIAVAITRASKLKI   DV+I+G++KI INVFPEGYKAKSISTSAKEPSEN VFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRRALP +VVKGL DISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGSKT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            E+F+VLGIEAAR SIV EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+KGT++SE+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440

Query: 1439 LKPKHTLFESLCNDVALKTH 1458
            L PK  LFESL N+ ALK +
Sbjct: 1441 LIPKPCLFESLSNEAALKAN 1460

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2595 bits (6726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1234/1460 (84%), Positives = 1344/1460 (92%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVV   PK+IKGLEFSALSA+DIVAQSEVE+STRDLFDLE  R PK  GALD KMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CKNC+++LLS+ DK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPGVDNLRRMG LKKILDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEK+ WVG+WK+VL HNPELERY+KRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+ + SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG+S  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            +NGPN+HPGANYLLK+N+DARRNLRYGDRMKLAKNLQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMMSDG  QFD+PPPA+MKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
            +YLWTGKQVFSLLI+PN  SPV+IN+DAKNKVF+PPK K LP+EMS NDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE+ VE AY KCDELI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSWDHA NITF ++D GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
            +  N IL+PLE++LVR+DN G+ + +ED+++ EY+DQ+DAER+FY+SLR+Y+  KAT LA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
             +RK++G+   L+ P  EL+ ++LDE  P+ + T+V+QL +IS+  V  FL IA+ KY +
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198
            INAVLVND DERAARVVKGR+EKT+LSDV YY+QDVYKDNLSFIQ ++DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200

Query: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258
            TIEDIA+AITRASKLKI  +DV+I+G+++I INVFPEGYKAKSISTSAKEPSEN VFYRM
Sbjct: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRRALP +VVKGLPDISRAVINIRDD KRELLVEGYGLRDVM TDGVIGSKT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            E+F+VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT+ISE+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1439 LKPKHTLFESLCNDVALKTH 1458
            L PK  LFESL N+ ALK +
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2583 bits (6695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1232/1458 (84%), Positives = 1339/1458 (91%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVV   APKKI GLEFSALSA+DIVAQSEVEISTRDLFDLENGR PK GGALD KMGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQG+CK C+SILL D DK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            + FL+ELRRPGVDNLRRMG LKK+LDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEKEKW+GDW  VL H+PELERY+KRCMDDLNPLKTLNLFKQVKPEDCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS +KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360
            AGLEKGISINNMME WDYLQLAVAMYINSDSVNPA++ G +GGK KPIRGFCQRLKGKQG
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQG 360

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420
            RFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYNK KLQQLV+N
Sbjct: 361  RFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVN 420

Query: 421  GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480
            GPN +PGANYLLKK++DARRNLR+GDR+KLAKNL+ GD+VERH+EDGDVVLFNRQPSLHR
Sbjct: 421  GPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHR 480

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
            LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NLL
Sbjct: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLL 540

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600
            TPKSGEPIIAATQDFITGSYLISHKDSFFD+  +TQLLSMMSDG +QFD+PPP + KP Y
Sbjct: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPCY 600

Query: 601  LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660
            LWTGKQ+FSLLIRPNKKSPV++N+DAKNKV++PPK K LPNEMS NDGFV+IRGS+ILSG
Sbjct: 601  LWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSG 660

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720
            VMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCARY+GNRGFSIGISDVTP  +
Sbjct: 661  VMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAEE 720

Query: 721  LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
            LK+KKE+ VE AYAKCDELID F+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI
Sbjct: 721  LKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780

Query: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
             ELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSKTP
Sbjct: 781  NELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTP 840

Query: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
            QSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YDN
Sbjct: 841  QSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDN 900

Query: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIEN 960
            TVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNFNR+WDHA N+TF + D GLLPYQI++ 
Sbjct: 901  TVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQV 960

Query: 961  TNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKI 1020
            T  IL+PLE +LVR+DNLGN++ KE+ ++IEYIDQ+DAER FY SLRD++  KA  LAK 
Sbjct: 961  TEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKF 1020

Query: 1021 RKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRAK 1080
            R +K +K L+DEPA EL+ ++LDE  PE I  +V+Q+ +I+  +V  FL +AI KY RAK
Sbjct: 1021 RGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAK 1080

Query: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140
            VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN
Sbjct: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140

Query: 1141 AVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELTI 1200
            AVLVN+ DERAARVVKGRIEKT+LSDV +YIQDVY+DNLS++Q +VDL TI+KLQLELTI
Sbjct: 1141 AVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTI 1200

Query: 1201 EDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQH 1260
            EDIAVA+TRA KLKI  +DV IVG++KI INVFP+G KAKSIST AKEPSEN VFYRMQ 
Sbjct: 1201 EDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQ 1260

Query: 1261 LRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEI 1320
            LRRALPGIVVKGL DISRAVINIRDDGKRELLVEGYGLRDVM+TDGV+G KT TNHILE+
Sbjct: 1261 LRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILEV 1320

Query: 1321 FNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDS 1380
            ++VLGIEAAR SIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMRDS
Sbjct: 1321 YSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDS 1380

Query: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDLK 1440
            VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGT++SEE LK
Sbjct: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQLK 1440

Query: 1441 PKHTLFESLCNDVALKTH 1458
            PK TLFESL N+ ++K +
Sbjct: 1441 PKPTLFESLVNETSVKVN 1458

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2576 bits (6677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1223/1452 (84%), Positives = 1335/1452 (91%), Gaps = 3/1452 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVV+  APKKI G+EFSALSASDIVAQSEVEIS+RDLFDLE  R  K  GALD +MGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS   C TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CKNC+S+LLSD+DK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RQFLAELRRPG-VDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKII 179
            +++L ELR  G +DNL++MG LKK++DQCKKQRRCLHCG LN              LKII
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDC 239
            HDTFRWVGKKS PEK+ W+GDW +VL H+PELER++KRC DDLNPLKTLNLFKQV+PEDC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGIDS VKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKG 357
            KAGLEKGISINNMME WDYLQL VAMYIN+DSVNPAM+PGAS  GGK KPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 358  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQL 417
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+ KLQ+L
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 418  VINGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPS 477
            V+NGPNIHPGANYLLKKN++ARRNLRYGDR+KLAKNLQYGD+VERH+EDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 478  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 537
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 538  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMK 597
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT TQLLSMMSDGN+QFD+PPPA+MK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 598  PHYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEI 657
            P+YLWTGKQ+FSLLI+PN KSPV+IN+DAKNKV++PPK K LPNEMS NDGFV+IRGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 717
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 718  GADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
              DLK KKE+ VE AYAKCD+LID +NKGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 778  VCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 837
            VCI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 838  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 897
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQI 957
            YDNTVRTSSNGIVQFTYGGDGLDP++MEG+AQPVNFNRSWDHA NITF + + GLLPYQ+
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 958  IENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHL 1017
            ++ TN +L PLE++LVR+DNLGN++ KED +K+EY DQ DAER+FY++LR Y+  K+ HL
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1018 AKIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYH 1077
            A +RK++GL  LL EP  EL+ L+ DE+  +   ++V+QLCKI++  V  FL IA+SKY 
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1078 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137
            +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1138 IINAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLE 1197
            IINAVLVN+ DERAARVVKGR+EKT+LSDV YYIQDVYKDNLSF+Q ++DL TIEKLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1198 LTIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYR 1257
            LTIEDIAVA+T+A KLKI  +DVSI G +K+ +NVFPEG K+KSISTSAK+PSEN VFYR
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1258 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317
            MQ LRRALP IVVKGLP+I+RAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1318 LEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377
            LE+ +VLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEE 1437
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVKGT I  E
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1438 DLKPKHTLFESL 1449
            DLKPK TLFESL
Sbjct: 1441 DLKPKPTLFESL 1452

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2573 bits (6670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1227/1460 (84%), Positives = 1324/1460 (90%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVV   PKKI GLEFSALSASDIVAQSEVE+STRDLFDLENGR PK+GGALD KMGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC+TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQG+CKNC+SILL+D D+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNL+RM  +KKILDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKS+PEK++WVGDW++VL +NPELER+ KR MDDLNPLKTLNLFKQ++PEDCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS VK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            AGLEKGISINNMME WDYLQL+VAMYINSDSVNP+MMPGAS  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+ KLQ LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGPN+HPGANY+LK N++ARRNLRYGDR+K+AK L+ GD+VERH+EDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKD+F DRAT TQLLSMMSD N+QFD+PPP ++KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
            + LWTGKQ+FSLLI+PNK SPV+IN+DAKNKVF+PPK K LPNEMS NDGFVVIRGS+IL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
              LKQKKE+ VE AYAKCDELID F KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG++
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNF RSWDHA NITF +   GLLPY II
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
              TN IL P E++L+R+DN+G  +   D+ K E++DQ D+ERNFY SLR YM EKA+ LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
             IRK KGLK L  EP  E K ++LDE        AV +LCKI++  VE FL IA+SKY R
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198
            INAVLVND D+RAARVVKGRIEKT+LSDV YY+QDVYKDNLSF++ K+DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258
            TIEDIAVA+TRA KLKI T DV IV ++KI I+V+PEG KAKSISTS KEPSEN VFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRRALP IVV GLPDI+RAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+L
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            E+F+VLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FK++K T I  +D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1439 LKPKHTLFESLCNDVALKTH 1458
            LKPK TLFE+L  + ALK +
Sbjct: 1441 LKPKRTLFENLVAEPALKVN 1460

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2538 bits (6578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1218/1459 (83%), Positives = 1337/1459 (91%), Gaps = 5/1459 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVV+   PK+I GLEFSALS +DIVAQSE+EIS+RDLFDLEN R+PK GGALD +MGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            S+S  EC+TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQG+CK C++ILLS+ DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPGVDNLRRM  LKK+LDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKS PEK+KW+GDWK+VL HNPELERY+KR  DDLNPLKTLNLFKQ+  EDCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+  K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            AG+EKGISINNMME WDYLQ+ VAMYINSDS+NPAM+PG+S  GGK KPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN  KL+QLV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
             NGPN+HPGANYLLKKN++ARRNLRYGDR KLA NLQYGDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+LTQLLSMMSDG++QFD+PPPA+MKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
             YLWTGKQVFSLLI+PNK SPV IN+DAKNKV++PPK K  PNEMS NDGFV++RGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKED VE AYAKCDELID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNFNRSWDHA NITF + D GLLPY+I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
            +  ++ILKPLE++L+R+D LG  ++ ED++  +Y+DQHD+ER FY SLR++MT+KA  LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILT-AVNQLCKISKNLVETFLGIAISKYH 1077
            K+RK++GL  L+ +   EL+  + + ++ + I+  ++ QL +I+++ V+ FL IAISKYH
Sbjct: 1021 KLRKSRGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078

Query: 1078 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137
            RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1138 IINAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLE 1197
            IINAVLVN+ DERAARVVKGRIEKT+LSDV YYIQDVYK+N++++Q KVDL TI+KLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198

Query: 1198 LTIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYR 1257
            LTIEDIA+AITRA KLKI T+DV+++G++KI INV PEG+ +K+ STS KEP+EN VFYR
Sbjct: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258

Query: 1258 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317
            MQ LRRALP I+VKGL DI+RAVINIRDDGKRELLVEGYGLRDVM TDGVIG+KT TNH+
Sbjct: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318

Query: 1318 LEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377
            LEIFNVLGIEAAR SI+GEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378

Query: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEE 1437
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T I+E+
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438

Query: 1438 DLKPKHTLFESLCNDVALK 1456
            +LKPK TLFESL ++VA K
Sbjct: 1439 ELKPKRTLFESLTSNVANK 1457

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2533 bits (6566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1213/1459 (83%), Positives = 1310/1459 (89%), Gaps = 2/1459 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVV    PKKI GLEFSALSA+DIVAQSEV I+TRDL+DLE+GR PK  GALD +MGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS+ EC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CK+CA++LLSD+DK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPG+DNL+RMG LKKILDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKK  PEK+ WVGDW++VL HNPELER++KR MDDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS  KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS-GGKTKPIRGFCQRLKGKQ 359
            AGLEKGISINNMME WDYLQL+VAMYINSDSVNP +MPGAS G K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGNKVKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PE+VTRYNK KLQ LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALVL 420

Query: 420  NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGPN+HPGANYLLKK+++ARRNLRYGD++KLAKNLQ GDVVERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPH 599
            LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT TQLLSMM DGN+QFD+PPPA+MKP 
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKPC 600

Query: 600  YLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILS 659
            YLWTGKQ+FSLLI+PN  SPV+INVDAKNKVF PPK K LP+EMS NDGFVVIRGS+ILS
Sbjct: 601  YLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGA 719
            GVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPDD 720

Query: 720  DLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
             LK  KE+ VE AYAKCDELI  +N+GKLETQPGCNEEQTLEAKI G+LSKVREEVG++C
Sbjct: 721  KLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDIC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            I ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  INELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVRNSF+SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIE 959
            NTVRTSSNGIVQFTYGGDGLDP DMEGNAQPVNFNRSWDHA NI F + D  + PYQI+E
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQILE 960

Query: 960  NTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAK 1019
             TN IL PLE+KL+R+DN+G  +  E+  K E++DQ DAERNFY SLRDYMT+KA  LA 
Sbjct: 961  ITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELAD 1020

Query: 1020 IRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRA 1079
            +RK++G+K LL  P  E K+++LDEQ P+ I  +V Q+C+I++N V  FL IAI+KY RA
Sbjct: 1021 VRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRRA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            +VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELT 1199
            NAVLVN+ DERAARVVKGRIEKT+LSDV YYIQD YKDN S+++ K+DLGTIEKLQLELT
Sbjct: 1141 NAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLELT 1200

Query: 1200 IEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQ 1259
            + DIA AI RA KLKI   DV     +KI I+V PE   +K IS SAKEP EN VFYRMQ
Sbjct: 1201 MSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSK-ISASAKEPLENNVFYRMQ 1259

Query: 1260 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319
            HLRRALP IVVKGLPDI+RAVINIRD+GKRELLVEGYGLRDVM TDGVIGSKT TNH+LE
Sbjct: 1260 HLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVLE 1319

Query: 1320 IFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379
            + +VLGIEAAR SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD
Sbjct: 1320 VNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDL 1439
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T I    L
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGTL 1439

Query: 1440 KPKHTLFESLCNDVALKTH 1458
            KPK TLFESLC +  +K +
Sbjct: 1440 KPKRTLFESLCKETNIKIN 1458

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2507 bits (6498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1196/1461 (81%), Positives = 1314/1461 (89%), Gaps = 9/1461 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVV    KKI G+EFSAL+A+DIVAQSEVEI+TRDLFDLE GR  K GGALD +MGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ +CK+C+++LLSD D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNLR+M  LKK++DQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKK  PEK++W+G+W ++L H+PELER++KRC DDLNPLKTL LFKQ+K EDCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+S V+SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358
            AGL KGISINNMME WDYLQL VAMYINSDSVNPAM+PGAS  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYNK KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGP +HPGANYLLKKN++ARRNLRYGD++KLAKNLQYGDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD  +LTQLLSMMSD  +QFD+PPPA+MKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
            +YLWTGKQVFSLLIRPNKKSPV+IN+DAKNKV++PPK K  PNEMS+NDGFV+IRGSEIL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+ MNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
            +DL+ KKE+ V  AYAKCDELID F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            D+TVRTS+NGIVQFTYGGDGLDPLDMEGNA+PVNF RSWDHA NITF   + GLLPY+I+
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
              T+++LKPLE+KL+R+DNLG  + KE  +   Y D+HDAER FY+SLR YM EKA  LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1019 KIRKAKGLKTLLDEPA-PELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYH 1077
            +IR  +GL  +        +++++ + Q       +V+Q+ KI+K  V  FL IA+ KYH
Sbjct: 1021 QIRNTRGLLEMTQNGGDTSMEVVSSELQ------ASVDQVYKITKKNVNAFLTIALHKYH 1074

Query: 1078 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137
            RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134

Query: 1138 IINAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLE 1197
            IINAVLVN+GDERAARVVKGRIEKT+LSD+ +YIQDVY+ N+S+++ +VDL TIEKLQLE
Sbjct: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194

Query: 1198 LTIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYR 1257
            LT+EDIAVA++RA KLKI T D+ I+G++KI++NV+PEG KAKSISTSAKEPSEN VFY+
Sbjct: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254

Query: 1258 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317
            MQ LRR+LP +VVKGLPDISRAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+
Sbjct: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314

Query: 1318 LEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377
            LE+ +VLGIEAAR SIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374

Query: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEE 1437
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK   +SE 
Sbjct: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434

Query: 1438 DLKPKHTLFESLCNDVALKTH 1458
            DLK + TLFESL ++ A+K +
Sbjct: 1435 DLKVRPTLFESLASETAIKAN 1455

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2495 bits (6466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1198/1451 (82%), Positives = 1308/1451 (90%), Gaps = 4/1451 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVV+   PK+I GLEFSALS SDI+AQSEVEISTRDLFDLENGR P  GGALD KMGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS  ECSTCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQILQGVCK+C++ILL+D DK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELR+P +DNL+RM  LKKILDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKK+ PEK+KW+GDW QVL +NPELE+++KRC DDLNPLKTLNLFKQ+K EDCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS V SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGG-KTKPIRGFCQRLKGKQ 359
            AGLEKGISINNMME WDYLQL+VAMYINSDSVN  +MPG++GG K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGSNGGTKAKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+ VAKVLTYPEKVTRYNK KLQ+LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLVM 420

Query: 420  NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGPN+HPGANYLLK N++ARRNLRYG+R KLAK L+ GD+VERH+EDGD+VLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKNN 538
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKNN
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSD N++FD+PPPA+ KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFKP 600

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
              LWTGKQ+FSLLI+PNK+SPV+IN+DAKNKV++PP++K  P+EMS NDG+V+IRGSEIL
Sbjct: 601  QCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGPQE+A+AMNRMAKLCARYLGNRGFSIGISDVTPG
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTPG 720

Query: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             +LK KKED VE AY KCDELI Q+NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  EELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFF+GL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958
            DNT+RTSSNGIVQFTYGGDGLDPLDMEGNA+PVNF R+WDHA+NITF     GLLPYQII
Sbjct: 901  DNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQII 960

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018
            + TN IL+PLE  LVR++N+G  L+K+D  K EY+DQ DA+R+FY S+R+YM EKA  LA
Sbjct: 961  KQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQLA 1020

Query: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
            KIRKA+ LK L+ EPA EL+ ++ DE  P  +   V++LCKIS+  V+ FL IAISKYHR
Sbjct: 1021 KIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYHR 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTPI 1140

Query: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198
            I AVLVND D RAARVVKGRIEKT+LSDV YYI+DVY+DN +FI+ K+DL TIEKLQLEL
Sbjct: 1141 IKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLEL 1200

Query: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258
            TIEDIA+AI++A KLKI ++++ IVG +KI I+VF E   +KSISTS KE SEN VFY+M
Sbjct: 1201 TIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEA--SKSISTSLKESSENTVFYKM 1258

Query: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRRALP +VVKGL DISRAVINI+DD K ELLVEGYGLRDVM TDGVIG+KT TNHIL
Sbjct: 1259 QTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHIL 1318

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            EIFNVLGIEAAR+SIVGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKMR
Sbjct: 1319 EIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMR 1378

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438
            DSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTMSIGTGSF VVK T +S E 
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPEQ 1438

Query: 1439 LKPKHTLFESL 1449
            +KPK TLFESL
Sbjct: 1439 VKPKRTLFESL 1449

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 2107 bits (5460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 995/1144 (86%), Positives = 1066/1144 (93%), Gaps = 1/1144 (0%)

Query: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60
            MKEVVVDIAPK+IKGLEFSALSASDIV QS+VEISTRDLFDLENGR PK GGALDT+MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120
            SSS AECSTCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ +CK+CA++LLS++DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL+ELRRPG+DNLRRMG LKK++DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWVGKKSAPEK+KWVGDWK VL HNPELERY+K+CMDDLNPLKTLNLFKQV PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDS VKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS-GGKTKPIRGFCQRLKGKQ 359
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPG S GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYNK KLQQLVI
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420

Query: 420  NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGPN HPGANYLLKK+++ARRNLRYGDR+KLAKNLQYGD+VERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPH 599
            LTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMMSDGNMQFD+PPPA+MKP+
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600

Query: 600  YLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILS 659
            Y+WTGKQVFSLLIRPNKKS V+IN+DAKNKV++PPKHK LPNEMS+NDGFVVIRGS+ILS
Sbjct: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGA 719
            GVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCARYLGNRGFSIGI+DVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720

Query: 720  DLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
            +LK KKE  VE+AYAKCD+LIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            I+ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIE 959
            NT+RTSSNGIVQFTYGGDGLDP+DMEGNAQPVNF RSWDHANNITF H D  LLPYQI++
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960

Query: 960  NTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAK 1019
             TNSIL+PLE+KLVR+DNLG  L+   +++ E+IDQ DAERNFY+SLR+Y+  KA+HLAK
Sbjct: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020

Query: 1020 IRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRA 1079
            IR  KGLK  LDEPAPEL+ ++LDE  P  +L +V+QLCKIS  LV  FL IAI KYH+A
Sbjct: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            KVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVL 1143
            NAVL
Sbjct: 1141 NAVL 1144

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1509 (34%), Positives = 781/1509 (51%), Gaps = 160/1509 (10%)

Query: 9    AP-KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAEC 67
            AP + IK ++F   S  ++ A S  +I   +  D E     KVGG  D ++G    + +C
Sbjct: 9    APLRTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKC 67

Query: 68   STCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAEL 127
             TC   +  C GHFGHI+LA PVFH+G+     ++ + VC +C  +LL +        EL
Sbjct: 68   QTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNEL 121

Query: 128  RRPGV---DNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFR 184
             R  +   D  RR   +  +   CK +  C                     +    D  +
Sbjct: 122  MRQAIKIKDPKRRFNAVWSL---CKSKMVC------------------DTEVPSEDDPSK 160

Query: 185  WVGK----KSAPEKEK----WVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKP 236
            ++ +     + P   K     VG WK+  +++ + ++  KR    L+  + LN+FK + P
Sbjct: 161  YISRGGCGNAQPSIRKDGLSLVGTWKKD-KNSEDSDQPEKRI---LSAEEILNVFKHITP 216

Query: 237  EDCELLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
            ED   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217  EDSLRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297  SLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
              ++     G   + + E    LQ  VA Y+++D    A  P A     +PI+    RLK
Sbjct: 274  INVQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGRPIKSIRARLK 330

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
            GK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L Q
Sbjct: 331  GKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQ 390

Query: 417  LVINGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQP 476
            LV NGPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQP
Sbjct: 391  LVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQP 448

Query: 477  SLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVK 536
            SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V 
Sbjct: 449  SLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP 508

Query: 537  NNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVM 596
              +++P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    +P P ++
Sbjct: 509  QQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPKPTIL 566

Query: 597  KPHYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSE 656
            KP  LW+GKQ+ S+ I PN    + +    +   ++ PK          ++G ++I G +
Sbjct: 567  KPKPLWSGKQLLSMAI-PNG---IHLQRFDEGTTYLSPK----------DNGMLIIDG-Q 611

Query: 657  ILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVT 716
            I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFSIGI D  
Sbjct: 612  IIFGVVDKKTVG-SSSGGLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGIGDTI 670

Query: 717  PGADLKQKKE--DKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 774
              AD K  +E  + +  A  +  E+  +     L  + G    ++ E  +   L++ R++
Sbjct: 671  --ADEKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 775  VGEVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 834
             G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRSAELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFS 788

Query: 835  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 894
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 895  SCQYDNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPV--NFNRSWDHANNITFTHKDFGL 952
               YD T R S   I+QF YG DG+D   +E  +       + +++    I   + ++GL
Sbjct: 849  MVHYDGTTRNSLGNIIQFVYGEDGMDASHIEKQSIDTIPGSDLAFEKRYRIDLLNPEYGL 908

Query: 953  LPYQIIENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIE--------YID-QHDAE---- 999
             P  ++E+   I+  L+        L N L++E ++ ++        ++D +H+      
Sbjct: 909  DP-SLLESATEIMGDLK--------LQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVN 959

Query: 1000 -----RNFYQSLRDYMTEKATHLAKIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAV 1054
                 +N  Q+ R   T K T L       G++ L D         N+ ++  E  +T  
Sbjct: 960  IRRIIQNAQQTFR-IDTTKPTDLTIKDVVLGVRKLQDNLLVLRGSSNILKEAQENAVTLF 1018

Query: 1055 NQLC-------------KISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQ 1101
              L              +++K   +  L    +++ R+ V PG  VG + AQSIGEP TQ
Sbjct: 1019 CSLVRSRLATRRVLTEYRLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQ 1078

Query: 1102 MTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--GDERAARVVKGRI 1159
            MTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  D   D+  A++++  I
Sbjct: 1079 MTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSAI 1138

Query: 1160 EKTILSDV-----VYYIQD----VYKDNLSFIQAKVDLGTIEK-----------LQLEL- 1198
            E T L  V     +YY  D    V +++   IQ    L   E            L+LEL 
Sbjct: 1139 EHTTLKSVTVSSEIYYDPDPSSTVIEEDEEIIQLHFSLMDEETENSLKHQSPWLLRLELD 1198

Query: 1199 ----TIEDIAVAITRASKLKISTADVSIVGR--NKININVFPEGYKAKSISTSAKEPSEN 1252
                  +D+ +        +    D+ ++    N  N+ +     +      +  E  E+
Sbjct: 1199 RAAMNDKDLTMGQVGEKIKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLDAEAEAEED 1258

Query: 1253 AVFYRMQHLRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRD 1300
             +  ++++    L  I ++G+ DI+R V+   D       G+        L  +G  L +
Sbjct: 1259 HMLKKIENT--MLESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVNLSE 1316

Query: 1301 VMTTDGVIGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVM 1360
            VMT  GV  ++  TN  ++I NVLGIEA R ++  E+   +++ G  V+ RH+ LL DVM
Sbjct: 1317 VMTVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVM 1376

Query: 1361 TYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS 1420
            T +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   
Sbjct: 1377 TSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMAP 1436

Query: 1421 IGTGSFKVV 1429
            IGTG+F V+
Sbjct: 1437 IGTGAFDVM 1445

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1502 (34%), Positives = 772/1502 (51%), Gaps = 131/1502 (8%)

Query: 9    AP-KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAEC 67
            AP + +K ++F   S  +I A S  +I   +  D    R  K+GG  D ++G      +C
Sbjct: 9    APLRTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRSLKC 67

Query: 68   STCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAEL 127
             TC   +  C GHFGHI+LA PVFH+G+     ++ + VC +C  +LL D+   Q    +
Sbjct: 68   QTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLL-DEHNEQMRQAI 126

Query: 128  RRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
            +    D+ +R   +  +   CK +   + C                        T R  G
Sbjct: 127  KIK--DSKKRFNAVWSL---CKAK---MICDTDVPSDEDPTQLISRGGCGNAQPTIRRDG 178

Query: 188  KKSAPEKEKWVGDWKQVLEH--NPELERYMKRCMDDLNPLKTLNLFKQVKPEDCELLGID 245
             K        VG WK+      N E E+ +      LN  + LN+FK + PED   LG +
Sbjct: 179  LK-------LVGSWKKDKNSGDNEEPEQRV------LNMEEILNIFKHISPEDSWKLGFN 225

Query: 246  SAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEK 305
                  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226  EEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306  GISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFRGN 365
            G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+GR RGN
Sbjct: 283  GAPHHTIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEGRIRGN 339

Query: 366  LSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPNIH 425
            L GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV NGPN H
Sbjct: 340  LMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVRNGPNEH 399

Query: 426  PGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHRLSILS 485
            PGA Y+++ N D R +LRY  R    + LQYG  VERH+ D D VLFNRQPSLH++S+++
Sbjct: 400  PGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLHKMSMMA 457

Query: 486  HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 545
            H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S 
Sbjct: 458  HKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSPQSN 517

Query: 546  EPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHYLWTGK 605
            +P +   QD + G   ++ +D+F +   +  +L  + D +    +P PA++KP  LWTGK
Sbjct: 518  KPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPDWDGV--IPTPAILKPKPLWTGK 575

Query: 606  QVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSGVMD 663
            Q+ S+ I      P  I++    +    + PK          ++G +VI G +I+ GV+D
Sbjct: 576  QLLSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-QIIFGVVD 618

Query: 664  KSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGADLKQ 723
            K  +G      + + + R+ GPQ  A+  + + K+   +  + GFS GI D        +
Sbjct: 619  KKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIADGQTMR 677

Query: 724  KKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIREL 783
            +  + + EA  K +++  +     L  + G    ++ E  +   L++ R++ G +    L
Sbjct: 678  QITEAIAEAKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRLAEVNL 737

Query: 784  DNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSK 843
            ++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SK
Sbjct: 738  NDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESK 797

Query: 844  GFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVR 903
            GFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R
Sbjct: 798  GFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTR 857

Query: 904  TSSNGIVQFTYGGDGLDPLDMEGNAQPV--NFNRSWDHANNITFTHKDFGLLPYQIIENT 961
             S   I+QF YG DG+D   +E  A       +R+++    I   + D+ L P  ++E+ 
Sbjct: 858  NSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLNPDYSLDP-SLLESG 916

Query: 962  NSILKPL---------------EQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFY--- 1003
            + I+  L               ++K +R   +  ++N      I  I Q +A++ F    
Sbjct: 917  SEIIGDLKLQSLLDEEYKQLVEDRKFLRRIFVDGEVNWPLPVNIRRIIQ-NAQQTFRIDR 975

Query: 1004 -----QSLRDYMTEKATHLAKIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLC 1058
                  ++RD +        ++   +G   ++ E   +   L             V Q  
Sbjct: 976  SKPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLMRSRLASRRVIQEY 1035

Query: 1059 KISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1118
            +++K   E  L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1036 RLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1095

Query: 1119 LGVPRIKEIINASKVISTPIINAVLVND--GDERAARVVKGRIEKTILSDV-----VYYI 1171
             GVPR+KEI+N +K + TP + A L  D   D+  A++++  IE T L  V     +YY 
Sbjct: 1096 SGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKSVTVASEIYYD 1155

Query: 1172 QD-----------VYKDNLSFIQAKVDLGTIEK----LQLEL-----TIEDIAVAITRAS 1211
             D           + + + S +  + +    ++    L+LEL       +D+ +      
Sbjct: 1156 PDPRSTAIPEDEEIIQLHFSLLDDETEKSLAQQSPWLLRLELDRAAMNDKDLTMGQVGEK 1215

Query: 1212 KLKISTADVSIVGR--NKININVFPEGYKAKSISTSAKEPSENAVFYRMQHLRRALPGIV 1269
              +    D+ ++    N   + +     + KS+     E  E+ +  ++++    L  I 
Sbjct: 1216 IKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLET-EAEEDHMLKKIENT--MLENIT 1272

Query: 1270 VKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTKTNHI 1317
            ++G+ +I R V+   D       G+ +      L  +G  L +VMT  GV  S+  TN  
Sbjct: 1273 LRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEVMTVPGVDASRIYTNSF 1332

Query: 1318 LEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377
            ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++ 
Sbjct: 1333 IDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRS 1392

Query: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEE 1437
                L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+    I EE
Sbjct: 1393 NTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM----IDEE 1448

Query: 1438 DL 1439
             L
Sbjct: 1449 SL 1450

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL140C
            (RPO21)
          Length = 1745

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1513 (34%), Positives = 777/1513 (51%), Gaps = 173/1513 (11%)

Query: 11   KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
            + IK ++F   S  ++ A S  +I   +  D E     KVGG  D ++G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNFKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ + VC +C  +LL +        EL R 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNELMRQ 124

Query: 131  GV---DNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
             +   D  RR   +  +   CK +  C                     +    D  +++ 
Sbjct: 125  AIKIKDPKRRFNAVWSL---CKAKMVC------------------DTEVPSEDDPSKYIS 163

Query: 188  K----KSAPEKEK----WVGDWKQVLEHNPE-LERYMKRCMDDLNPLKTLNLFKQVKPED 238
            +     + P   K     VG WK+  + N E  ++  KR    ++  + LN+FK + PED
Sbjct: 164  RGGCGNAQPSIRKDGLSLVGTWKK--DKNAEDADQPEKRI---ISAEEILNVFKHISPED 218

Query: 239  CELLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  SWRLGFNEDFS--RPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANIN 275

Query: 299  IKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGK 358
            ++     G   + + E    LQ  VA Y+++D    A  P A     +PI+    RLKGK
Sbjct: 276  VQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGRPIKSIRARLKGK 332

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLV 392

Query: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
             NGPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
            +++P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    +P P ++KP
Sbjct: 511  IVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTPTILKP 568

Query: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
              LW+GKQ+ S+ I     S + +    +   ++ PK          ++G ++I G +I+
Sbjct: 569  KPLWSGKQLLSMAI----PSGIHLQRFDEGTTYLSPK----------DNGMLIIDG-QII 613

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
             GV+DK  +G      + + + R+ GP+  A     + K+   +L + GFSIGI D    
Sbjct: 614  FGVVDKKTVG-SSSGGLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIGDTI-- 670

Query: 719  ADLKQKKE--DKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG 776
            AD K  +E  D +  A  K +E+  +     L  + G    ++ E  +   L++ R++ G
Sbjct: 671  ADEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAG 730

Query: 777  EVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 836
                  L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731  RSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKD 790

Query: 837  SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 896
              +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791  DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 897  QYDNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPV--NFNRSWDHANNITFTHKDFGLLP 954
             YD T R S   I+QF YG DG+D   +E  +       + +++    I   + ++ L P
Sbjct: 851  HYDGTTRNSLGNIIQFVYGEDGMDAAHIEKQSIDTIPGSDLAFEKRYRIDLLNPNYALDP 910

Query: 955  YQIIENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQH-------DAERNF----- 1002
              ++E+   I+  L+        L N L++E ++ ++  D+H       D E N+     
Sbjct: 911  -NLLESGTEIVGDLK--------LQNLLDEEYKQLVQ--DRHFLRKIFMDGEHNWPLPVN 959

Query: 1003 --------YQSLRDYMTEKATHLAKIRKAKGLKTLLDEPAPELKILNLDEQ-YPEYILTA 1053
                     Q+ R   T K T L+     +G++ L +     L +L    Q   E    A
Sbjct: 960  IRRIIQNAQQTFRIDST-KPTDLSIQDVVQGVRGLQE----RLLVLRGKSQILQEAQENA 1014

Query: 1054 VNQLC----------------KISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGE 1097
            +   C                +++K   E  L    +++ R+ V PG  VG + AQSIGE
Sbjct: 1015 ITLFCCLLRSRLATRRVITEYRLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGE 1074

Query: 1098 PGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--GDERAARVV 1155
            P TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L      D+  A+++
Sbjct: 1075 PATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLI 1134

Query: 1156 KGRIEKTILSDV-----VYYIQD----VYKDNLSFIQAKVDLGTIEK-----------LQ 1195
            +  IE T L  V     +YY  D    V +++   IQ    L   E            L+
Sbjct: 1135 RSAIEHTTLKSVPVASEIYYDPDPSSTVIEEDEEIIQLHFSLMDEETEASLKHQSPWLLR 1194

Query: 1196 LEL-----TIEDIAVAITRASKLKISTADVSIVGR--NKININVFPEGYKAKSISTSAKE 1248
            LEL     T +D+ +        +    D+ ++    N   + +     +      +  E
Sbjct: 1195 LELDRVAMTDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAE 1254

Query: 1249 PSENAVFYRMQHLRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGY 1296
              E+ +  ++++    L  I ++G+ DI+R V+   D       G+        L  +G 
Sbjct: 1255 AEEDHMLKKIENT--MLESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGV 1312

Query: 1297 GLRDVMTTDGVIGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLL 1356
             L +VM+  GV  ++  TN  ++I NVLGIEA R ++  E+   +++ G  V+ RH+ LL
Sbjct: 1313 NLSEVMSVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALL 1372

Query: 1357 GDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILG 1416
             DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILG
Sbjct: 1373 VDVMTSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILG 1432

Query: 1417 QTMSIGTGSFKVV 1429
            Q   IGTGSF V+
Sbjct: 1433 QMAPIGTGSFDVM 1445

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1491 (34%), Positives = 778/1491 (52%), Gaps = 129/1491 (8%)

Query: 11   KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
            + IK ++F   S  ++   S  +I   +  D E+    K+GG  D ++G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRGISVAKIEFPETMD-ESQMKAKIGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLA-ELRR 129
               +A C GHFGHI+LA PVFH+G+     ++ + VC +C  +LL + +++   A +++ 
Sbjct: 71   GEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDEYNEQMRQAIKIKD 130

Query: 130  PGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGKK 189
            P     RR   +  +   CK +   + C                     I  + R  G  
Sbjct: 131  PK----RRFNAVWTL---CKAK---MVCETEVPSPDDPTVFLSRGGCGHIQPSIRKDGLS 180

Query: 190  SAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCELLGIDSAVK 249
                    VG WK+  ++  + ++  KR    ++  + LN+FK + PED   LG +    
Sbjct: 181  -------LVGTWKKD-KNADDSDQPEKRI---ISAEEILNVFKHISPEDGWRLGFNEDFS 229

Query: 250  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGISI 309
              RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G   
Sbjct: 230  --RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQKLEINGSPQ 286

Query: 310  NNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFRGNLSGK 369
            + + E    LQ  VA Y+++D    A  P A     +PI+    RLKGK+GR RGNL GK
Sbjct: 287  HVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGRPIKSIRARLKGKEGRIRGNLMGK 343

Query: 370  RVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPNIHPGAN 429
            RVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGPN HPGA 
Sbjct: 344  RVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAK 403

Query: 430  YLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSHYAK 489
            Y+++++ D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH++S+++H  K
Sbjct: 404  YVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHKMSMMAHRVK 461

Query: 490  IRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPII 549
            + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P +
Sbjct: 462  VMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCM 521

Query: 550  AATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHYLWTGKQVFS 609
               QD + G   ++ +D+F +   +  +L  + D +    +P PA++KP  LW+GKQV S
Sbjct: 522  GIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGI--IPTPAILKPVPLWSGKQVLS 579

Query: 610  LLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGD 669
            + I PN    + +        F+ PK          ++G ++I G +I+ GV+DK  +G 
Sbjct: 580  MAI-PNG---IHLQRFDDGTTFLSPK----------DNGMLIIDG-KIIFGVVDKKTVG- 623

Query: 670  GKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGADLKQKKE--D 727
                 + + + R+ GP+  A   + + K+   +L + GFSIGI D    AD K  +E  +
Sbjct: 624  SSSGGLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFSIGIGDTI--ADEKTMREITE 681

Query: 728  KVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLN 787
             +  A  K +++  +     L  + G    ++ E  +   L++ R++ G      L +LN
Sbjct: 682  AIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVNLKDLN 741

Query: 788  APLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVR 847
                M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGFV 
Sbjct: 742  NVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKGFVE 801

Query: 848  NSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSN 907
            NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R S  
Sbjct: 802  NSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSLG 861

Query: 908  GIVQFTYGGDGLDPLDMEGNAQPV--NFNRSWDHANNITFTHKDFGLLPYQIIENTNSIL 965
             ++QF YG DG+D   +E  +       + +++    I   ++++ L P  ++E+ + I+
Sbjct: 862  NVIQFIYGEDGMDAAHIEKQSIDTIPGSDSAFERRYRIDLLNEEYALDP-SLLESGSEII 920

Query: 966  KPLEQKLVRFDNLGNKLNKEDEEKIEYID-QHDAE---------RNFYQSLRDYMTEKAT 1015
               + +L+  D     ++     +  ++D +H+           +N  Q+ R   T K T
Sbjct: 921  GDSKLQLLLNDEYKQLVDDRQILRRVFVDGEHNWPLPVNIKRIIQNSQQTFRIDQT-KPT 979

Query: 1016 HLAKIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLC----------------K 1059
             L       G++ L ++    L +    +   E    A+   C                +
Sbjct: 980  DLTIEDVISGVRKLQEKL---LVVRGKSDILKEAQQNAITLFCCLLRSRLATRRVIEEYR 1036

Query: 1060 ISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTL 1119
            +++   +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT 
Sbjct: 1037 LNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTS 1096

Query: 1120 GVPRIKEIINASKVISTPIINAVLVND--GDERAARVVKGRIEKTILSDV-----VYYIQ 1172
            GVPR+KEI+N +K + TP +   L  +   D+  A+ ++  IE T L  V     +YY  
Sbjct: 1097 GVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKEIRSAIEHTTLKSVTVASEIYYDP 1156

Query: 1173 D----VYKDNLSFIQAKVDLGTIEK-----------LQLEL-----TIEDIAVAITRASK 1212
            D    V +D+   IQ    L   E            L+LEL     T +D+ +       
Sbjct: 1157 DPRSTVIEDDEEIIQLHFSLMDEETEKSLDYQSPWLLRLELDRAAMTDKDLTMGQVGEKI 1216

Query: 1213 LKISTADVSIVGR--NKININVFPEGYKAKSISTSAKEPSENAVFYRMQHLRRALPGIVV 1270
             +    D+ ++    N   + +     +      +  E  E+ +  ++++    L  I +
Sbjct: 1217 KETFKNDLFVIWSEDNAEKLIIRCRVIRDPKTLDADVEAEEDHMLKKIEN--SMLEKITL 1274

Query: 1271 KGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            +G+ DI+R V+   D       G+        L  +G  L +VMT  GV GS+  TN  +
Sbjct: 1275 RGVEDITRVVMMKYDRKVPSETGEYHKVPEWVLETDGVNLSEVMTVSGVDGSRIYTNSFI 1334

Query: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378
            +I NVLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G ++  
Sbjct: 1335 DIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRAD 1394

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
               L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1395 TGALMRCSFEETVEILFEAGAAAELDDCRGVSENVILGQMAPIGTGAFDVM 1445

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1528 (34%), Positives = 785/1528 (51%), Gaps = 166/1528 (10%)

Query: 1    MKEVVVDIAP-KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMG 59
            M E     AP + +K ++F   S  ++ A S  +I   +  D E     KVGG  D ++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLG 59

Query: 60   VSSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDD 119
                + +C TC   +  C GHFGHI+LA PVFH+GY     ++ + VC +C  +LL +  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  KRQFLAELRRPGV---DNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXL 176
                 +EL R  +   D  RR   +  +   CK +  C                     +
Sbjct: 119  -----SELMRQAIKIKDPKRRFNAVWSL---CKAKMVC------------------ETEV 152

Query: 177  KIIHDTFRWVGK----KSAPEKEK----WVGDWKQ--VLEHNPELERYMKRCMDDLNPLK 226
               +D  ++V +     + P   K     VG WK+    +   + ER +      ++  +
Sbjct: 153  PSDNDPAQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRV------ISADE 206

Query: 227  TLNLFKQVKPEDCELLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK + PED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTK 346
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D    A  P A     +
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGR 320

Query: 347  PIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKV 406
            PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE V
Sbjct: 321  PIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVV 380

Query: 407  TRYNKHKLQQLVINGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIED 466
            T YN  +L QLV NGPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D
Sbjct: 381  TPYNIDRLTQLVRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIID 438

Query: 467  GDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEAR 526
             D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE R
Sbjct: 439  EDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETR 498

Query: 527  AEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNM 586
            AE   L  V   +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D + 
Sbjct: 499  AELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPDWDG 558

Query: 587  QFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVN 646
               +P P ++KP  LW+GKQ+ S+ I     S + +    +    + PK          +
Sbjct: 559  V--IPTPIILKPKPLWSGKQILSIAI----PSGIHLQRFDEGTTLLSPK----------D 602

Query: 647  DGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNR 706
            +G ++I G +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + 
Sbjct: 603  NGMLIIDG-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPKICARLFSNLQKVVNFWLLHN 660

Query: 707  GFSIGISDVTPGADLKQKKE--DKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKI 764
            GFSIGI D    AD K  +E  + +  A  K +E+  +     L  + G    ++ E  +
Sbjct: 661  GFSIGIGDTI--ADEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDSV 718

Query: 765  GGLLSKVREEVGEVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDG 824
               L++ R++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  G
Sbjct: 719  VRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFG 778

Query: 825  FQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMS 884
            F DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ 
Sbjct: 779  FADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQ 838

Query: 885  RRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANN-- 942
            RRL+K+LED+   YD T R S   ++QF YG DG+D   +E   Q ++   S D A    
Sbjct: 839  RRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIASSDAAFERR 896

Query: 943  --ITFTHKDFGLLPYQIIENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAER 1000
              I   +    L P  ++E+ + I+  L+ + +  +     +  ED E +  I   D E+
Sbjct: 897  FRIDLLNPRHALDP-SLLESGSEIIGDLKLQALLDEEFKQLV--EDREFLRKIFV-DGEQ 952

Query: 1001 NF-------------YQSLRDYMTEKATHLAKIRKAKGLKTLLDEPA---PELKILNLDE 1044
            N+              Q+ R   T K T L       G+K L ++      + KIL   +
Sbjct: 953  NWPLPVNIRRIIQNAQQTFRIDQT-KPTDLTIRDVVYGVKELQEKLLVLRGKSKILQEAQ 1011

Query: 1045 QYPEYILTA----------VNQLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQS 1094
            Q    +             V Q  +++K   E  L    S++ R+ V PG  VG + AQS
Sbjct: 1012 QNAVTLFCCLLRSRLATRRVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLAAQS 1071

Query: 1095 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--GDERAA 1152
            IGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  D   D+  A
Sbjct: 1072 IGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQEKA 1131

Query: 1153 RVVKGRIEKTILSDV-----VYYIQD----VYKDNLSFIQAKVDLGTIEKLQLELTIEDI 1203
            ++++  IE T L  +     +YY  D    V +++   IQ    L   E+ +  L  +  
Sbjct: 1132 KLIRSAIEHTTLKSITVASEIYYDPDPRSTVIEEDEEIIQLHFSLMD-EETEQSLDYQSP 1190

Query: 1204 AVAITRASKLKISTADVSI--VG-------RNKININVFPEGYKAKSIS----------- 1243
             +      +  ++  D+++  VG       +N + + ++ E    K I            
Sbjct: 1191 WLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFV-IWSEDNAEKLIIRCRVVRDPKTL 1249

Query: 1244 TSAKEPSENAVFYRMQHLRRALPGIVVKGLPDISRAVINIRD------DGKRE------L 1291
             +  E  E+ +  R+++    L  I ++G+ DI+R V+   D       G+        L
Sbjct: 1250 DAEAEAEEDHMLKRIENT--MLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEWVL 1307

Query: 1292 LVEGYGLRDVMTTDGVIGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPR 1351
              +G  L +VM   GV  ++  TN  ++I NVLGIEA R ++  E+   +++ G  V+ R
Sbjct: 1308 ETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYR 1367

Query: 1352 HIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSE 1411
            H+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE
Sbjct: 1368 HMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSE 1427

Query: 1412 CIILGQTMSIGTGSFKVVKGTSISEEDL 1439
             ++LGQ   IGTG+F V+    I EE L
Sbjct: 1428 NVLLGQVAPIGTGAFDVM----IDEESL 1451

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1504 (34%), Positives = 775/1504 (51%), Gaps = 155/1504 (10%)

Query: 11   KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
            + IK ++F   S  ++ A S  +I   +  D E     KVGG  D ++G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ + VC +C  +LL + +++   A   + 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHNEQMKQAIKIKD 130

Query: 131  GVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK-- 188
                   + TL K+   C+ +                        +    D  +++ +  
Sbjct: 131  PKRRFNAVWTLSKVKMICETE------------------------VPSEDDPTKYISRGG 166

Query: 189  --KSAPEKEK----WVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCELL 242
               + P   K     VG WK+  ++  + ++  KR    ++  + LN+FK + PED   L
Sbjct: 167  CGNTQPSIRKDGLSLVGTWKKD-KNADDADQPEKRI---ISAEEVLNVFKHICPEDSWRL 222

Query: 243  GIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G +      RPE  +   LP PP  +RPS+   ++    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEDF--ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINVQRL 279

Query: 303  LEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  VA Y+++D    A  P A     +PI+    RLKGK+GR 
Sbjct: 280  EINGSPQHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGRPIKSIRARLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423  NIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHRLS 482
            N HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 542
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHYLW 602
            +S +P +   QD + G   ++ +D+F +   +  +L  + D +    +P P ++KP  LW
Sbjct: 515  QSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWVPDWDGV--IPTPTILKPKPLW 572

Query: 603  TGKQVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660
            +GKQ+ S+ I      P  I++    +    + PK          ++G +++ G +I+ G
Sbjct: 573  SGKQILSMAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIVDG-QIIFG 615

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720
            V+DK  +G      + + + R+ GPQ  A   + + K+   +L + GFSIGI D    AD
Sbjct: 616  VVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIGDTI--AD 672

Query: 721  LKQKKE--DKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             K  +E  + +  A  K + +  +     L  + G    ++ E  +   L++ R++ G  
Sbjct: 673  QKTMREITEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRS 732

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
                L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733  AEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDY 792

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNA--QPVNFNRSWDHANNITFTHKDFGLLPYQ 956
            D T R S   I+QF YG DG+D   +E  +       +R+++    I   + D  L P  
Sbjct: 853  DGTTRNSLGNIIQFIYGEDGMDAAHIEKQSIDTIAGSDRAFERRYRIDLLNPDNALDP-S 911

Query: 957  IIENTNSILKPLE---------QKLVRFDNLGNKLNKEDEEKIEY-IDQHDAERNFYQSL 1006
            ++E+ + ++  L+         ++LV       K+  + E+     ++     +N  Q+ 
Sbjct: 912  LLESGSEMMGDLKLQASLDEEYRQLVEDRRFLRKIFVDGEQNWPLPVNIRRIIQNAQQTF 971

Query: 1007 RDYMTEKATHLAKIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLC-------- 1058
            R   T K T L       G+K L ++    L +    E   E    AV   C        
Sbjct: 972  RIDHT-KPTDLTIHDVIYGVKDLQEKL---LVLRGKSEMLQEAQTNAVTLFCCLLRSRLA 1027

Query: 1059 --------KISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1110
                    K++K   +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFA
Sbjct: 1028 SRRVIEEYKLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1111 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--GDERAARVVKGRIEKTILSDV- 1167
            GVAS  VT GVPR+KEI+N +K + TP +   L ++   D+  A++++  IE T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAIEHTTLKSVT 1147

Query: 1168 ----VYYIQD----VYKDNLSFIQAKVDLGTIEK-----------LQLELTIEDIAVAIT 1208
                +YY  D    V +D+   IQ    L   E            L+LEL   D A    
Sbjct: 1148 VASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDHQSPWLLRLEL---DRAAMND 1204

Query: 1209 RASKLKISTADVSIVGRNKININVFPEGYKAKSIS-----------TSAKEPSENAVFYR 1257
            +   +      +    +N + + ++ E    K I             +  E  E+ +  +
Sbjct: 1205 KDLTMGQVGEKIKETFKNDLFV-IWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKK 1263

Query: 1258 MQHLRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTD 1305
            +++    L  I ++G+ DI+R V+   D       G+ +      L  +G  L +VM+  
Sbjct: 1264 IENT--MLESITLRGVEDITRVVMMKYDRKTPSATGEYQKVPEWVLETDGVNLAEVMSVP 1321

Query: 1306 GVIGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE 1365
            GV  ++  TN  ++I NVLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1322 GVDSTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGF 1381

Query: 1366 VLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGS 1425
            ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+
Sbjct: 1382 LMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENVILGQMAPIGTGA 1441

Query: 1426 FKVV 1429
            F V+
Sbjct: 1442 FDVM 1445

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/1530 (34%), Positives = 784/1530 (51%), Gaps = 170/1530 (11%)

Query: 1    MKEVVVDIAP-KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMG 59
            M E     AP + +K ++F   S  ++ A S  +I   +  D E     KVGG  D ++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLG 59

Query: 60   VSSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDD 119
                + +C TC   +  C GHFGHI+LA PVFH+GY     ++ + VC +C  +LL +  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  KRQFLAELRRPGV---DNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXL 176
                 +EL +  +   D  RR   +  +   CK +  C                     +
Sbjct: 119  -----SELMKQAIKIKDPKRRFNAVWSL---CKVKMVC------------------ETEV 152

Query: 177  KIIHDTFRWVGK----KSAPEKEK----WVGDWKQ--VLEHNPELERYMKRCMDDLNPLK 226
               +D  ++V +     + P   K     VG WK+    +   + ER +      ++  +
Sbjct: 153  PSDNDPSQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRI------ISADE 206

Query: 227  TLNLFKQVKPEDCELLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK + PED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTK 346
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D    A  P A     +
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDI---AGQPQALQKSGR 320

Query: 347  PIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKV 406
            PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE V
Sbjct: 321  PIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVV 380

Query: 407  TRYNKHKLQQLVINGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIED 466
            T YN  +L QLV NGPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D
Sbjct: 381  TPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIID 438

Query: 467  GDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEAR 526
             D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE R
Sbjct: 439  EDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETR 498

Query: 527  AEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNM 586
            AE   L  V   +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D + 
Sbjct: 499  AELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELEQVLNMLYWIPDWDG 558

Query: 587  QFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMS 644
               +P P ++KP  LW+GKQ+ S+ I      P  I++    +    + PK         
Sbjct: 559  V--IPTPIILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPK--------- 601

Query: 645  VNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLG 704
             ++G ++I G +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L 
Sbjct: 602  -DNGMLIIDG-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPKICARLFSNLQKVVNYWLL 658

Query: 705  NRGFSIGISDVTPGADLKQKKE--DKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEA 762
            + GFSIGI D    AD K  +E  D +  A  K +E+  +     L  + G    ++ E 
Sbjct: 659  HNGFSIGIGDTI--ADEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTLRESFED 716

Query: 763  KIGGLLSKVREEVGEVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVP 822
             +   L++ R++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+ 
Sbjct: 717  NVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIA 776

Query: 823  DGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGY 882
             GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY
Sbjct: 777  FGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGY 836

Query: 883  MSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLDMEGNA--QPVNFNRSWDHA 940
            + RRL+K+LED+   YD T R S   ++QF YG DG+D   +E  A       + +++  
Sbjct: 837  IQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQAIDTIACSDAAFERR 896

Query: 941  NNITFTHKDFGLLPYQIIENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAER 1000
              I   +    L P  ++E+ + I+  L+ + +  D    +L+ ED + +  I   D E+
Sbjct: 897  FKIDLLNPKHALDP-SLLESGSEIIGDLKLQAL-LDEEFKQLS-EDRQFLRKIFV-DGEQ 952

Query: 1001 NF-------------YQSLRDYMTEKATHLAKIRKAKGLKTLLDEPAPELKILNLDEQYP 1047
            N+              Q+ R   T K T L+      G+K L ++    L +    +   
Sbjct: 953  NWPLPVNIRRIIQNAQQTFRIDHT-KPTDLSIRDVIYGVKELQEKL---LVLRGKSKILQ 1008

Query: 1048 EYILTAVNQLC----------------KISKNLVETFLGIAISKYHRAKVEPGTAVGAIG 1091
            E  + AV   C                +++K   E  L    +++ R+ V PG  VG + 
Sbjct: 1009 EAQVNAVTLFCCLLRSRLASRRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLA 1068

Query: 1092 AQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--GDE 1149
            AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  +   D+
Sbjct: 1069 AQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQ 1128

Query: 1150 RAARVVKGRIEKTILSDV-----VYYIQD----VYKDNLSFIQAKVDLGTIEKLQLELTI 1200
              A++++  IE T L  +     +YY  D    V +D+   IQ    L   E+ +  L  
Sbjct: 1129 EKAKLIRSAIEHTTLKSITVASEIYYDPDPRSTVIEDDEEIIQLHFSLMD-EETEQSLDY 1187

Query: 1201 EDIAVAITRASKLKISTADVSI--VGRN-----KININVFPEGYKAKSISTSAK------ 1247
            +   +      +  ++  D+++  VG       K ++ V      A+ +    +      
Sbjct: 1188 QSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLVIRCRVVRDPK 1247

Query: 1248 ------EPSENAVFYRMQHLRRALPGIVVKGLPDISRAVINIRDDG------------KR 1289
                  E  E+ +  R+++    L  I ++G+ DI+R V+   D              + 
Sbjct: 1248 TLDAEAEAEEDHMLKRIENT--MLESITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPEW 1305

Query: 1290 ELLVEGYGLRDVMTTDGVIGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVD 1349
             L  +G  L +VM   GV  ++  TN  ++I NVLGIEA R ++  E+   +++ G  V+
Sbjct: 1306 VLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVN 1365

Query: 1350 PRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGV 1409
             RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GV
Sbjct: 1366 YRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGV 1425

Query: 1410 SECIILGQTMSIGTGSFKVVKGTSISEEDL 1439
            SE ++LGQ   IGTG+F V+    I EE L
Sbjct: 1426 SENVLLGQVAPIGTGAFDVM----IDEESL 1451

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
            YDL140C (REAL)
          Length = 1726

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1516 (33%), Positives = 770/1516 (50%), Gaps = 164/1516 (10%)

Query: 11   KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
            + +K ++F   S  ++ A S  +I   +  D    R  K+GG  D ++G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK--RQFLAELR 128
               +  C GHFGHI LA PVFHVG+     ++ + VC +C  +LL + ++  RQ LA   
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHNELMRQALAI-- 128

Query: 129  RPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
                D+ +R   +  +   CK +  C                     +   +D  + V +
Sbjct: 129  ---KDSKKRFAAIWTL---CKTKMVC------------------ETDVPSENDPTQLVSR 164

Query: 189  KSAPEKE--------KWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
                  +        K VG WK+        E  ++     L+  + LN+FK +  ED  
Sbjct: 165  GGCGNTQPTVRKDGLKLVGSWKKDRASGDADEPELRV----LSTEEILNIFKHISVEDFT 220

Query: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
             LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221  SLGFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360
                 G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+G
Sbjct: 278  TLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEG 334

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRN 394

Query: 421  GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480
            GPN HPGA Y+++ + D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
            +S+++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600
            +P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    +P PA++KP  
Sbjct: 513  SPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 601  LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660
            LW+GKQV S  I     S + +    +    + PK          ++G ++I G +I+ G
Sbjct: 571  LWSGKQVLSAAI----PSGIHLQRFDEGTTLLSPK----------DNGMLIIDG-QIVFG 615

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720
            V++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D      
Sbjct: 616  VVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGP 674

Query: 721  LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
              ++  + + EA  K  ++  +     L  + G    ++ E  +   L++ R++ G +  
Sbjct: 675  TMREITETIAEAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE 734

Query: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
              L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735  VNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSP 794

Query: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
            +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YDN
Sbjct: 795  ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDN 854

Query: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPV--NFNRSWDHANNITFTHKDFGLLPYQII 958
            T R S   ++QF YG DG+D   +E  +       +++++    I   + +  L P  ++
Sbjct: 855  TTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDKAFEKRYRIDLLNPEHILDP-SLL 913

Query: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYM--TEKATH 1016
            E+ + IL  L+ +++  D    +L K+ +   E     +A      ++R  +   ++  H
Sbjct: 914  ESGSEILGDLKLQVL-LDEEYKQLVKDRKFLREVFVDGEANWPMPVNIRRIIQNAQQTFH 972

Query: 1017 LAKIRKAK--------GLKTLLDEPAPELKILNLDEQYPEYILTAVNQLC---------- 1058
            +   R +         G+K L +     L +   +E        AV   C          
Sbjct: 973  IDHTRPSDLTIKEIVIGVKDLQEN---LLVLRGKNEIIQNAQQDAVTLFCCLFRSRLATR 1029

Query: 1059 ------KISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGV 1112
                  +++K   E  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGV
Sbjct: 1030 RILQEYRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGV 1089

Query: 1113 ASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDGDERAARVVKGRIEKTILSDV--- 1167
            AS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V   
Sbjct: 1090 ASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIA 1149

Query: 1168 --VYYIQD----VYKDNLSFIQAKVDLGTIE-------------KLQL--------ELTI 1200
              +YY  D    V  ++   IQ    L   E             +L+L        +LT+
Sbjct: 1150 SEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1201 EDIAVAITRASKLKI-----STADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVF 1255
              +   I +  K  +        D  ++ R ++   V P+   A++      E  E+ + 
Sbjct: 1210 GQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRV---VRPKSLDAET------EAEEDHML 1260

Query: 1256 YRMQHLRRALPGIVVKGLPDISRAVINIRD------------DGKRELLVEGYGLRDVMT 1303
             ++++    L  I ++G+ +I R V+   D            + +  L  +G  L +VMT
Sbjct: 1261 KKIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMT 1318

Query: 1304 TDGVIGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYK 1363
              G+  ++  TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +
Sbjct: 1319 VPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQ 1378

Query: 1364 GEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGT 1423
            G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGT
Sbjct: 1379 GGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGT 1438

Query: 1424 GSFKVVKGTSISEEDL 1439
            G+F V+    I EE L
Sbjct: 1439 GAFDVM----IDEESL 1450

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1512 (32%), Positives = 757/1512 (50%), Gaps = 156/1512 (10%)

Query: 11   KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
            + +K ++F   S  ++ A S  +I   +  D    R  K+GG  D ++G    + +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK--RQFLAELR 128
               +  C GHFGHI LA PVFHVG+     ++ + VC +C  +LL + ++  RQ LA   
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAI-- 128

Query: 129  RPGVDNLRRMGTLKKILDQCKKQRRCLH--CGMLNXXXXXXXXXXXXXXLKIIHDTFRWV 186
                D+ +R   +  +   CK +  C        +                I  D  + V
Sbjct: 129  ---KDSKKRFAAIWTL---CKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLV 182

Query: 187  GKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCELLGIDS 246
            G   + +K++  GD  +     PEL          L+  + LN+FK +  +D   LG + 
Sbjct: 183  G---SWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISVKDFTSLGFNE 226

Query: 247  AVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKG 306
                 RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G
Sbjct: 227  VFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNG 283

Query: 307  ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFRGNL 366
               + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+GR RGNL
Sbjct: 284  APHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEGRIRGNL 340

Query: 367  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPNIHP 426
             GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGPN HP
Sbjct: 341  MGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP 400

Query: 427  GANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSH 486
            GA Y+++ + D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH++S+++H
Sbjct: 401  GAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAH 458

Query: 487  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 546
              K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +
Sbjct: 459  RVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNK 518

Query: 547  PIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHYLWTGKQ 606
            P +   QD + G   ++ +D+F +   +  +L  + D +    +P PA++KP  LW+GKQ
Sbjct: 519  PCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLWSGKQ 576

Query: 607  VFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSGVMDKSV 666
            + S+ I PN    + +    +    + PK          ++G ++I G +I+ GV++K  
Sbjct: 577  ILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIFGVVEKKT 621

Query: 667  LGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGADLKQKKE 726
            +G      + + + R+ GPQ  A     + K+   +L + GFS GI D        ++  
Sbjct: 622  VGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREIT 680

Query: 727  DKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNL 786
            + + EA  K  ++  +     L  + G    ++ E  +   L++ R++ G +    L +L
Sbjct: 681  ETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDL 740

Query: 787  NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFV 846
            N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGFV
Sbjct: 741  NNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV 800

Query: 847  RNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSS 906
             NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YDNT R S 
Sbjct: 801  ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSL 860

Query: 907  NGIVQFTYGGDGLDPLDMEGNAQPV--NFNRSWDHANNITFTHKDFGLLPYQIIENTNSI 964
              ++QF YG DG+D   +E  +       + +++    +   + D  L P  ++E+ + I
Sbjct: 861  GNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDP-SLLESGSEI 919

Query: 965  LKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYM--TEKATHLAKIRK 1022
            L  L+ +++  D    +L K+ +   E     +A      ++R  +   ++  H+   + 
Sbjct: 920  LGDLKLQVL-LDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKP 978

Query: 1023 AK--------GLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAIS 1074
            +         G+K L +     L +   +E        AV   C + ++ + T     + 
Sbjct: 979  SDLTIKDIVLGVKDLQEN---LLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRR--VLQ 1033

Query: 1075 KYHRAKVEPGTAVGAIGAQ---SIGEPGTQMTLKTFHFAGVASMNVTL------------ 1119
            +Y   K      +  I AQ   S+  PG  + +      G  +  +TL            
Sbjct: 1034 EYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKK 1093

Query: 1120 ---GVPRIKEIINASKVISTPIINAVLV--NDGDERAARVVKGRIEKTILSDV-----VY 1169
               GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V     +Y
Sbjct: 1094 VTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIY 1153

Query: 1170 YIQD----VYKDNLSFIQAKVDLGTIE-------------KLQL--------ELTIEDIA 1204
            Y  D    V  ++   IQ    L   E             +L+L        +LT+  + 
Sbjct: 1154 YDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVG 1213

Query: 1205 VAITRASKLKI-----STADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQ 1259
              I +  K  +        D  ++ R ++   V P+   A++      E  E+ +  +++
Sbjct: 1214 ERIKQTFKNDLFVIWSEDNDEKLIIRCRV---VRPKSLDAET------EAEEDHMLKKIE 1264

Query: 1260 HLRRALPGIVVKGLPDISRAVINIRD------------DGKRELLVEGYGLRDVMTTDGV 1307
            +    L  I ++G+ +I R V+   D            + +  L  +G  L +VMT  G+
Sbjct: 1265 NT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGI 1322

Query: 1308 IGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVL 1367
              ++  TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1323 DPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLT 1382

Query: 1368 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFK 1427
             +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F 
Sbjct: 1383 SVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFD 1442

Query: 1428 VVKGTSISEEDL 1439
            V+    I EE L
Sbjct: 1443 VM----IDEESL 1450

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/315 (86%), Positives = 296/315 (93%), Gaps = 1/315 (0%)

Query: 1143 LVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELTIED 1202
            LVN  DERAARVVKGRIEKT+LSDV +YIQDVYKDNLSF+Q K+DLGTIEKLQLELTIED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1203 IAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQHLR 1262
            IAVAITRASKLKI+  DVSI+G++K+NINV+PEG K KSISTSAKEP EN +FYR+QHLR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1263 RALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEIFN 1322
            R+LPGIVVKGLPDI+RAVINI+ DG RELLVEGYGLRDVMTTDGV+G KTKTNHILE+ +
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1323 VLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1382
            VLGIEAARTSIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGEVLGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1383 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDLKPK 1442
            QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT++S E+LKPK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1443 HTLFESLC-NDVALK 1456
             TLFESLC N  ALK
Sbjct: 304  ATLFESLCGNTAALK 318

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1721

 Score =  576 bits (1485), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 353/921 (38%), Positives = 515/921 (55%), Gaps = 70/921 (7%)

Query: 11  KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
           + +K ++F   S  ++ A S  +I   +  D    R  K+GG  D ++G    + +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK--RQFLAELR 128
              ++ C GHFGHI LA PVFHVG+     ++ + VC +C  +LL ++++  RQ +A ++
Sbjct: 71  QEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQVMA-IK 129

Query: 129 RPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
            P     +R      +   CK +  C                     +   +D  + V +
Sbjct: 130 DPK----KRFNATWAL---CKTKMVC------------------ETDVPSENDPTKLVSR 164

Query: 189 KSAPEKE--------KWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
                 +        K VG WK+  +   E E   +R    L+  + LN+FK +  ED  
Sbjct: 165 GGCGNTQPTVRKDGLKLVGSWKR--KKTIEGEEPEQRV---LSTEEILNIFKHISTEDFI 219

Query: 241 LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 220 RLGFNEEFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 276

Query: 301 AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360
                G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+G
Sbjct: 277 TLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEG 333

Query: 361 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV N
Sbjct: 334 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRN 393

Query: 421 GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480
           GPN HPGA Y++++N D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH+
Sbjct: 394 GPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 451

Query: 481 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 452 MSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 511

Query: 541 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600
           +P+S +P +   QD + G  +++ +D+F +   +  +L  + D +    +P PA++KP  
Sbjct: 512 SPQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPDWDGV--IPTPAILKPKP 569

Query: 601 LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660
           LWTGKQ+ S+ I PN    + +    +    + PK          ++G ++I G +I+ G
Sbjct: 570 LWTGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIFG 614

Query: 661 VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISD-VTPGA 719
           V+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D +  GA
Sbjct: 615 VVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDTIADGA 673

Query: 720 DLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
            +K+  E  + EA  K +E+  +     L  + G    ++ E  +   L++ R++ G + 
Sbjct: 674 TIKEITE-TIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 732

Query: 780 IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
              L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 733 EVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYS 792

Query: 840 PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
           P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 793 PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 852

Query: 900 NTVRTSSNGIVQFTYGGDGLD 920
           NT R S   ++QF YG DG+D
Sbjct: 853 NTTRNSLGNVIQFIYGEDGID 873

 Score =  177 bits (449), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 135/422 (31%), Positives = 213/422 (50%), Gaps = 48/422 (11%)

Query: 1059 KISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1118
            +++K      L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1035 RLTKEAFNWVLNNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1094

Query: 1119 LGVPRIKEIINASKVISTPIINAVLVND--GDERAARVVKGRIEKTILSDV-----VYYI 1171
             GVPR+KEI+N +K + TP +   L +D   D+  A++++  IE T L  V     +YY 
Sbjct: 1095 SGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVTVASEIYYD 1154

Query: 1172 QD----VYKDNLSFIQ-----------AKVDLGTIEKLQLEL-----TIEDIAVAITRAS 1211
             D    V +++   IQ           + +D  +   L+LEL       +D+ +      
Sbjct: 1155 PDPRSTVIEEDEEIIQLHFSLLDDEMESSLDQQSPWLLRLELDRAAMNDKDLTMGQVGER 1214

Query: 1212 KLKISTADVSIVGR--NKININVFPEGYKAKSISTSAKEPSENAVFYRMQHLRRALPGIV 1269
              +    D+ ++    N   + +     + KS+     E  E+ +  ++++    L  I 
Sbjct: 1215 IKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAET-EAEEDHMLKKIENT--MLENIT 1271

Query: 1270 VKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTKTNHI 1317
            ++G+ +I R V+   D       G+ +      L  +G  L +VM   GV  ++  TN  
Sbjct: 1272 LRGVENIERVVMMKYDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPGVDATRIYTNSF 1331

Query: 1318 LEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377
            ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++ 
Sbjct: 1332 IDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRS 1391

Query: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEE 1437
                L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+    I EE
Sbjct: 1392 NTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAFDVM----IDEE 1447

Query: 1438 DL 1439
             L
Sbjct: 1448 SL 1449

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1685

 Score =  572 bits (1475), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 350/929 (37%), Positives = 509/929 (54%), Gaps = 75/929 (8%)

Query: 11  KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
           + +K ++F   S  ++ A S  ++   +  D    R  K+GG  D ++G    + +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK--RQFLAELR 128
              +  C GHFGHI LA PVFHVG+     ++ + VC +C  +LL + ++  RQ L +++
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQVL-KIK 129

Query: 129 RPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
            P     +R   +  +   CK +  C                     +   +D  + + +
Sbjct: 130 DPK----KRFNAVWSL---CKTKMIC------------------ETDVPSENDPTQLISR 164

Query: 189 KSAPEKE--------KWVGDWKQ--VLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPED 238
                 +        K VG WK+        E E+ +      L   + LN+FK + PED
Sbjct: 165 GGCGNAQPTVRKDGLKLVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHISPED 218

Query: 239 CELLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
              LG D      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219 STKLGFDEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299 IKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGK 358
           ++     G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK
Sbjct: 276 LETLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGK 332

Query: 359 QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
           +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV
Sbjct: 333 EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV 392

Query: 419 INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478
            NGPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQPSL
Sbjct: 393 RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 479 HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
           H++S++SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451 HKMSMMSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 539 LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598
           +++P+S +P +   QD + G  +++ KD+F +   +  +L  + D +    +P PA++KP
Sbjct: 511 IVSPQSNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPDWDGI--IPTPAILKP 568

Query: 599 HYLWTGKQVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMSVNDGFVVIRGSE 656
             LWTGKQ+ S  I      P  I++    +    + PK          ++G ++I G +
Sbjct: 569 KPLWTGKQILSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG-Q 611

Query: 657 ILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVT 716
           I+ GV+DK  +G      + + + R+ GPQ  +     + K+   +L + GFS GI D  
Sbjct: 612 IIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGDTI 670

Query: 717 PGADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG 776
              +  ++  + + EA  K +E+  +     L  + G    ++ E  +   L++ R++ G
Sbjct: 671 ANGETIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAG 730

Query: 777 EVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 836
            +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731 RLAEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKD 790

Query: 837 SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 896
             +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791 DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 897 QYDNTVRTSSNGIVQFTYGGDGLDPLDME 925
            YD T R S   I+QF YG DG+D   +E
Sbjct: 851 HYDGTTRNSLGNIIQFIYGEDGIDASHIE 879

 Score =  180 bits (457), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 144/435 (33%), Positives = 218/435 (50%), Gaps = 64/435 (14%)

Query: 1054 VNQLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1113
            V Q  +++K   +  +    S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VIQEYRLTKESFDWVINNIESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1114 SMNVTLGVPRIKEIINASKVISTPIINAVLVND--GDERAARVVKGRIEKTILSDV---- 1167
            S  VT GVPR+KEI+N +K + TP +   L      D+  A+ ++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSVTVAS 1150

Query: 1168 -VYYIQD----VYKDNLSFIQ-----------AKVDLGTIEKLQLEL----------TIE 1201
             +YY  D    V +D+   IQ           A +D  +   L+LEL          T+ 
Sbjct: 1151 EIYYDPDPRSTVIEDDEEIIQLHFSLLDEEMEASLDQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1202 DIAVAITRASK---LKISTADVS--IVGRNKININVFPEGYKAKSISTSAKEPSENAVFY 1256
             +   I    K     I + D +  ++ R ++   V P+G  A++      E  E+ +  
Sbjct: 1211 QVGERIKETFKKDLFVIWSEDNAEKLIIRCRV---VRPKGLDAET------EAEEDHMLK 1261

Query: 1257 RMQHLRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTT 1304
            ++++    L  I ++G+ +I R V+   D       G+ +      L  +G  L +VMT 
Sbjct: 1262 KIENT--MLENITLRGVENIERVVMMKYDRKVPSKTGEFQKVPEWVLETDGVNLAEVMTI 1319

Query: 1305 DGVIGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKG 1364
             GV  ++  TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGVDTTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTCQG 1379

Query: 1365 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1424
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRANTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTG 1439

Query: 1425 SFKVVKGTSISEEDL 1439
            +F    G  I EE L
Sbjct: 1440 AF----GVMIDEESL 1450

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1727

 Score =  566 bits (1460), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 351/930 (37%), Positives = 506/930 (54%), Gaps = 66/930 (7%)

Query: 9   AP-KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAEC 67
           AP + +K ++F   S  ++ A S  +I   +  D    R  K+GG  D ++G    + +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAEL 127
            TC   +  C GHFGHI LA PVFH+G+     ++ + VC +C  +LL D +++   A  
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNEQMRQACK 127

Query: 128 RRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
            +        + TL      CK +  C                      K+I    R   
Sbjct: 128 IKDSKKRFNAIWTL------CKTKMIC-----------ESDVPSEEDPTKLIS---RGGC 167

Query: 188 KKSAP----EKEKWVGDWKQVLEHN---PELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
             + P    +  K VG WK+  E N   PE        M+++     LN+FK +  ED  
Sbjct: 168 GNAQPTVRKDGLKLVGSWKK--EKNTGDPEEPEQRILTMEEI-----LNIFKHISKEDSN 220

Query: 241 LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221 RLGFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301 AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360
                G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+G
Sbjct: 278 TLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEG 334

Query: 361 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVRN 394

Query: 421 GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480
           GPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 481 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 541 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600
           +P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    +P PA++KP  
Sbjct: 513 SPQSNKPCMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 601 LWTGKQVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
           LWTGKQ+ S+ I      P  I++    +    + PK          ++G ++I G +I+
Sbjct: 571 LWTGKQILSIAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG-KII 613

Query: 659 SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI D    
Sbjct: 614 FGVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGDTIAD 672

Query: 719 ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
               ++  + + +A  K +++  +     L  + G    ++ E  +   L++ R++ G +
Sbjct: 673 GQTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 779 CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
               L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 839 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 899 DNTVRTSSNGIVQFTYGGDGLDPLDMEGNA 928
           D+T R S   ++QF YG DG+D   +E  A
Sbjct: 853 DSTTRNSLGNVIQFVYGEDGMDASHIEKQA 882

 Score =  155 bits (391), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 127/406 (31%), Positives = 197/406 (48%), Gaps = 39/406 (9%)

Query: 1059 KISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1118
            +++K   E  L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1036 RLTKQAFEWVLNNIEIQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1095

Query: 1119 LGVPRIKEIINASKVISTPIINAVLVN---------DGDERAARVVKGRIEKTILSDVVY 1169
             GVPR+      +K I + I +  L +         D D R+  + +   ++ I+     
Sbjct: 1096 SGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAE---DEEIIQLHFS 1152

Query: 1170 YIQDVYKDNLSFIQAKVDLGTIEKLQLELTIEDIAVAITRASKLKISTADVSIV----GR 1225
             + D  + +L   Q    L  +E  +  +  +D+ +        +    D+ ++      
Sbjct: 1153 LLDDETEKSLD--QQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSEDNA 1210

Query: 1226 NKININVFPEGYKAKSISTSAKEPSENAVFYRMQHLRRALPGIVVKGLPDISRAVINIRD 1285
             K+ I       K+  I T A+E   + +  ++++    L  I ++G+ +I R V+   D
Sbjct: 1211 EKLIIRCRVVRPKSMDIETEAEE---DHMLKKIENT--MLENITLRGVENIERVVMMKYD 1265

Query: 1286 ------DGKRE------LLVEGYGLRDVMTTDGVIGSKTKTNHILEIFNVLGIEAARTSI 1333
                   G+        L  +G  L +VMT  GV   +  TN  ++I  VLGIEA R ++
Sbjct: 1266 RKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIMEVLGIEAGRAAL 1325

Query: 1334 VGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDH 1393
              E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T + 
Sbjct: 1326 YKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGALMRCSFEETVEI 1385

Query: 1394 LFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDL 1439
            LF+A    + D   GVSE +ILGQ   IGTGSF V+    I EE L
Sbjct: 1386 LFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM----IDEESL 1427

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
           YDL140C
          Length = 1726

 Score =  566 bits (1458), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 345/927 (37%), Positives = 511/927 (55%), Gaps = 71/927 (7%)

Query: 11  KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
           + IK ++F   S  +I A S  +I   +  D    R  K+GG  D ++G    + +C TC
Sbjct: 12  RTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK--RQFLAELR 128
              +  C GHFGHI LA PVFH+G+     ++ + +C +C  +LL + ++  RQ L +++
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQMRQIL-KIK 129

Query: 129 RPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
               D+ +R   +  +   CK +  C                     +   HD  + V +
Sbjct: 130 ----DSKKRFNAIWSL---CKTKMIC------------------DTDVPSEHDPTQLVSR 164

Query: 189 KSAPEKE--------KWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
                 +        K VG WK+  ++  + +   +R    L+  + LN+FK + PED  
Sbjct: 165 GGCGNAQPTVRKDGLKLVGSWKKE-KNTSDGDEPEQRI---LSTEEILNIFKHISPEDSI 220

Query: 241 LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            +G +      RPE      LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221 AMGFNEEFS--RPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301 AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360
                G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+G
Sbjct: 278 TLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEG 334

Query: 361 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTHLVRN 394

Query: 421 GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480
           GPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 481 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
           +S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 541 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600
           + +S +P +   QD + G   ++ +D+F +   +  LL  + D +    +P PA++KP  
Sbjct: 513 SAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPDWDGV--IPTPAILKPKP 570

Query: 601 LWTGKQVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658
           LW+GKQ+ S+ I      P  I++    +   F+ PK          ++G ++I G +I+
Sbjct: 571 LWSGKQILSIAI------PKGIHLQRFDEGTTFLSPK----------DNGMLIIDG-QII 613

Query: 659 SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718
            GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D    
Sbjct: 614 FGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIGDTIAD 672

Query: 719 ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
            +  ++    + EA  K +E+  +     L  + G    ++ E  +   L++ R++ G +
Sbjct: 673 GETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 779 CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
               L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 839 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 899 DNTVRTSSNGIVQFTYGGDGLDPLDME 925
           D+T R S   ++QF YG DG+D   +E
Sbjct: 853 DSTTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  184 bits (466), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 144/428 (33%), Positives = 215/428 (50%), Gaps = 50/428 (11%)

Query: 1054 VNQLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1113
            V Q  K++K   +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1114 SMNVTLGVPRIKEIINASKVISTPIINAVL--VNDGDERAARVVKGRIEKTILSDVVYYI 1171
            S  VT GVPR+KEI+N +K + TP + A L      D+  A++++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLKSVTV-A 1149

Query: 1172 QDVYKDNLSFIQAKVDLGTIEKLQLELTIEDIAVAITRAS----KLKISTA-----DVSI 1222
             ++Y D         +   I +L   L  E+   ++ + S    +L++  A     D+++
Sbjct: 1150 SEIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1223 --VG-------RNKININVFPEGYKAKSIS----------TSAKEPSENAVFYRMQHLRR 1263
              VG       RN + + ++ E    K I            +  E  E+ +  ++++   
Sbjct: 1210 GQVGEKIRETFRNDLFV-IWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLKKIENT-- 1266

Query: 1264 ALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSK 1311
             L  I ++G+ +I R V+   D       G  E      L  +G  L +VMT  GV  S+
Sbjct: 1267 MLENITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEVMTVPGVDASR 1326

Query: 1312 TKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITR 1371
              TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT  G +  +TR
Sbjct: 1327 IYTNSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTNGSLTSVTR 1386

Query: 1372 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKG 1431
             G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF V+  
Sbjct: 1387 HGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGSFDVM-- 1444

Query: 1432 TSISEEDL 1439
              I EE L
Sbjct: 1445 --IDEESL 1450

>Suva_4.104 Chr4
           complement(193257..193711,193754..193782,194161..198878)
           [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  566 bits (1458), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 347/925 (37%), Positives = 505/925 (54%), Gaps = 67/925 (7%)

Query: 11  KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
           + +K ++F   S  ++ A S  +I   +  D    R  K+GG  D ++G    + +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK--RQFLAELR 128
              +  C GHFGHI LA PVFHVG+     ++ + VC +C  +LL + ++  RQ LA   
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAI-- 128

Query: 129 RPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
               D  +R G +  +   CK +  C                     +   +D  + V +
Sbjct: 129 ---KDTKKRFGAIWTL---CKTKMVC------------------ETDVPSENDPTQLVSR 164

Query: 189 KSAPEKE--------KWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
                 +        K VG WK+        E  ++     L+  + LN+FK +  +D  
Sbjct: 165 GGCGNTQPTVRKDGLKLVGSWKKDRATGDADEPELRV----LSTEEILNIFKHISAKDSS 220

Query: 241 LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221 SLGFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301 AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360
                G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+G
Sbjct: 278 TLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEG 334

Query: 361 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRN 394

Query: 421 GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480
           GPN HPGA Y+++ + D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 481 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 541 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600
           +P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    +P PA++KP  
Sbjct: 513 SPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 601 LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660
           LW+GKQV S+ I PN    + +    +    + PK          ++G ++I G +I+ G
Sbjct: 571 LWSGKQVLSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIVFG 615

Query: 661 VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720
           V++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D      
Sbjct: 616 VVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGP 674

Query: 721 LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
             ++  + + +A  K  ++  +     L  + G    ++ E  +   L++ R++ G +  
Sbjct: 675 TMREITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE 734

Query: 781 RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
             L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 VNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDDYSP 794

Query: 841 QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
           +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YDN
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDN 854

Query: 901 TVRTSSNGIVQFTYGGDGLDPLDME 925
           T R S   ++QF YG DG+D   +E
Sbjct: 855 TTRNSLGNVIQFIYGEDGMDASHIE 879

 Score =  180 bits (457), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 141/435 (32%), Positives = 215/435 (49%), Gaps = 64/435 (14%)

Query: 1054 VNQLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1113
            V Q  K++K   E  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1114 SMNVTLGVPRIKEIINASKVISTPIINAVLV--NDGDERAARVVKGRIEKTILSDV---- 1167
            S  VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTLKSVTIAS 1150

Query: 1168 -VYYIQD----VYKDNLSFIQAKVDLGTIE-------------KLQLE--------LTIE 1201
             +YY  D    V  ++   IQ    L   E             +L+L+        LT+ 
Sbjct: 1151 EIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1202 DIAVAITRASKLKI-----STADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFY 1256
             +   I +  K  +        D  ++ R ++   V P+   A++      E  E+ +  
Sbjct: 1211 QVGERIKQTFKNDLFVIWSEDNDEKLIIRCRV---VRPKSLDAET------EAEEDHMLK 1261

Query: 1257 RMQHLRRALPGIVVKGLPDISRAVINIRD------------DGKRELLVEGYGLRDVMTT 1304
            ++++    L  I ++G+ +I R V+   D            + +  L  +G  L +VMT 
Sbjct: 1262 KIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTV 1319

Query: 1305 DGVIGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKG 1364
             G+  ++  TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1365 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1424
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1425 SFKVVKGTSISEEDL 1439
            +F V+    I EE L
Sbjct: 1440 AFDVM----IDEESL 1450

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  564 bits (1454), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 346/917 (37%), Positives = 504/917 (54%), Gaps = 61/917 (6%)

Query: 11  KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
           + +K ++F   S  +I A S  +I   +  D    R  K+GG  D ++G    + +C TC
Sbjct: 12  RTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLA-ELRR 129
              +  C GHFGHI LA PVFH+G+     ++ + +C +C  +LL + +++   A +++ 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHNEQMRQAIQIKD 130

Query: 130 PGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGKK 189
           P     +R   +  +   CK +  C                      K+I    R     
Sbjct: 131 PK----KRFNAVWSL---CKTKMVC-----------ETDVPSEDDPTKLIS---RGGCGN 169

Query: 190 SAP----EKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCELLGID 245
           + P    +  K VG WK+  +   + +   +R    L+  + LN+FK + PED   LG +
Sbjct: 170 TQPTIRKDGLKLVGSWKKD-KSTGDADEPEQRV---LSTEEILNIFKHISPEDSYRLGFN 225

Query: 246 SAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEK 305
                 RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226 EEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306 GISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFRGN 365
           G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+GR RGN
Sbjct: 283 GAPHHAVEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEGRIRGN 339

Query: 366 LSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPNIH 425
           L GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NGPN H
Sbjct: 340 LMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRNGPNEH 399

Query: 426 PGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHRLSILS 485
           PGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH++S+++
Sbjct: 400 PGAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSMMA 457

Query: 486 HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 545
           H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S 
Sbjct: 458 HRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSN 517

Query: 546 EPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHYLWTGK 605
           +P +   QD + G   ++ +D+F +   +  +L  + D +    +P PA++KP  LW+GK
Sbjct: 518 KPCMGIVQDTLCGIRKLTLRDTFLEFDQVLNMLYWVPDWDGV--IPTPAIIKPKPLWSGK 575

Query: 606 QVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSGVMD 663
           Q+ S+ I      P  I++    +    + PK          ++G +VI G EI+ GV+D
Sbjct: 576 QILSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-EIIFGVVD 618

Query: 664 KSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGADLKQ 723
           K  +G      + + + R+ GP   A     + K+   +L + GFS GI D        +
Sbjct: 619 KKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDTVADGQTMR 677

Query: 724 KKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIREL 783
           +  + + EA  K + +  +     L  + G    ++ E  +   L++ R+  G +    L
Sbjct: 678 EISETIAEAKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDRAGRLAEMNL 737

Query: 784 DNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSK 843
            +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SK
Sbjct: 738 KDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSPESK 797

Query: 844 GFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVR 903
           GFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R
Sbjct: 798 GFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTR 857

Query: 904 TSSNGIVQFTYGGDGLD 920
            S   ++QF YG DG+D
Sbjct: 858 NSLGNVIQFIYGEDGMD 874

 Score =  179 bits (455), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 141/426 (33%), Positives = 212/426 (49%), Gaps = 46/426 (10%)

Query: 1054 VNQLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1113
            V Q  +++K   E  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1114 SMNVTLGVPRIKEIINASKVISTPIINAVLVND--GDERAARVVKGRIEKTILSDV---- 1167
            S  VT GVPR+KEI+N +K + TP +   L  +   D+  A++V+  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTTLKSVTVAS 1150

Query: 1168 -VYYIQD----VYKDNLSFIQAKVDL--GTIEKLQLELTIEDIAVAITRAS----KLKIS 1216
             +YY  D    V  ++   IQ    L     EKL  + +   + + + RA+     L + 
Sbjct: 1151 EIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1217 TADVSIVGRNKININVFPEGYKAKSISTSAK-----------EPSENAVFYRMQHLRRAL 1265
                 I    K ++ V      A+ +    +           E  E+ +  ++++    L
Sbjct: 1211 QVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLKKIENT--ML 1268

Query: 1266 PGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTK 1313
              I ++G+  I R V+   D       G+ +      L  +G  L +VMT  GV  ++  
Sbjct: 1269 ENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVPGVDPTRIY 1328

Query: 1314 TNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1373
            TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G
Sbjct: 1329 TNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHG 1388

Query: 1374 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTS 1433
             ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+    
Sbjct: 1389 FNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM---- 1444

Query: 1434 ISEEDL 1439
            I EE L
Sbjct: 1445 IDEESL 1450

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
           YDL140C (REAL)
          Length = 1719

 Score =  563 bits (1451), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 346/925 (37%), Positives = 504/925 (54%), Gaps = 67/925 (7%)

Query: 11  KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
           + +K ++F   S  ++ A S  +I   +  D    R  K+GG  D ++G    + +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK--RQFLAELR 128
              +  C GHFGHI LA PVFHVG+     ++ + VC +C  +LL + ++  RQ LA   
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAI-- 128

Query: 129 RPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
               D+ +R   +  +   CK +  C                     +    D  + V +
Sbjct: 129 ---KDSKKRFAAIWTL---CKTKMVC------------------ETDVPSEDDPTQLVSR 164

Query: 189 KSAPEKE--------KWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240
                 +        K VG WK+        E  ++     L+  + LN+FK +  +D  
Sbjct: 165 GGCGNTQPTVRKDGLKLVGSWKKDRASGDAEEPELRV----LSTEEILNIFKHISVKDFT 220

Query: 241 LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221 SLGFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301 AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360
                G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+G
Sbjct: 278 TLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEG 334

Query: 361 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRN 394

Query: 421 GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480
           GPN HPGA Y+++ + D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 481 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
           +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 541 TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600
           +P+S +P +   QD + G   ++ +D+F +   +  +L  + D +    +P PA++KP  
Sbjct: 513 SPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKP 570

Query: 601 LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660
           LW+GKQ+ S+ I PN    + +    +    + PK          ++G ++I G +I+ G
Sbjct: 571 LWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIFG 615

Query: 661 VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720
           V++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D      
Sbjct: 616 VVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGP 674

Query: 721 LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
             ++  + + EA  K  ++  +     L  + G    ++ E  +   L++ R++ G +  
Sbjct: 675 TMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE 734

Query: 781 RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
             L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 VNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSP 794

Query: 841 QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
           +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YDN
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDN 854

Query: 901 TVRTSSNGIVQFTYGGDGLDPLDME 925
           T R S   ++QF YG DG+D   +E
Sbjct: 855 TTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  179 bits (455), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 139/435 (31%), Positives = 216/435 (49%), Gaps = 64/435 (14%)

Query: 1054 VNQLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1113
            V Q  +++K   +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1114 SMNVTLGVPRIKEIINASKVISTPIINAVLV--NDGDERAARVVKGRIEKTILSDV---- 1167
            S  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIAS 1150

Query: 1168 -VYYIQD----VYKDNLSFIQAKVDLGTIE-------------KLQLE--------LTIE 1201
             +YY  D    V  ++   IQ    L   E             +L+L+        LT+ 
Sbjct: 1151 EIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1202 DIAVAITRASKLKI-----STADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFY 1256
             +   I +  K  +        D  ++ R ++   V P+   A++      E  E+ +  
Sbjct: 1211 QVGERIKQTFKNDLFVIWSEDNDEKLIIRCRV---VRPKSLDAET------EAEEDHMLK 1261

Query: 1257 RMQHLRRALPGIVVKGLPDISRAVINIRD------------DGKRELLVEGYGLRDVMTT 1304
            ++++    L  I ++G+ +I R V+   D            + +  L  +G  L +VMT 
Sbjct: 1262 KIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTV 1319

Query: 1305 DGVIGSKTKTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKG 1364
             G+  ++  TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1365 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1424
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1425 SFKVVKGTSISEEDL 1439
            +F V+    I EE L
Sbjct: 1440 AFDVM----IDEESL 1450

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
           Anc_7.314
          Length = 1729

 Score =  563 bits (1451), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 351/923 (38%), Positives = 508/923 (55%), Gaps = 58/923 (6%)

Query: 9   AP-KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAEC 67
           AP + +K ++F   S  ++ A S  +I   +  D    R  K+GG  D ++G    + +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK--RQFLA 125
            TC   +  C GHFGHI LA PV HVG+     ++ + VC +C  +LL + ++  RQ +A
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHNEQMRQAIA 127

Query: 126 ELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRW 185
                  D+ +R      + + CK +   + C                        T R 
Sbjct: 128 I-----KDSKKR---FNAVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPTVRK 176

Query: 186 VGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCELLGID 245
            G K        VG WK+    N   E   +     L+  + LN+FK + PED   LG +
Sbjct: 177 DGLK-------LVGSWKKEKNTNDGDEPEQRV----LSTEEILNIFKHISPEDSTRLGFN 225

Query: 246 SAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEK 305
                 RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226 EEF--ARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306 GISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFRGN 365
           G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+GR RGN
Sbjct: 283 GAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKEGRIRGN 339

Query: 366 LSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPNIH 425
           L GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NGPN H
Sbjct: 340 LMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEH 399

Query: 426 PGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHRLSILS 485
           PGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH++S+++
Sbjct: 400 PGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHKMSMMA 457

Query: 486 HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 545
           H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +S 
Sbjct: 458 HRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQSN 517

Query: 546 EPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHYLWTGK 605
           +P +   QD + G   ++ +D+F +   +  +L  + D +    +P PA++KP  LW+GK
Sbjct: 518 KPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPDWDGV--IPTPAIIKPKPLWSGK 575

Query: 606 QVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSGVMD 663
           QV S+ I      P  I++    +    + PK          ++G +V+ G +I+ GV+D
Sbjct: 576 QVLSIAI------PRGIHLQRFDEGTTLLSPK----------DNGMLVVDG-QIIFGVVD 618

Query: 664 KSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISD-VTPGADLK 722
           K  +G      + + + R+ GP   A     + K+   +L + GFS GI D +  G+ +K
Sbjct: 619 KKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGSTIK 677

Query: 723 QKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRE 782
           +  E  + +A  K +++  +     L  + G    ++ E  +   L++ R++ G +    
Sbjct: 678 EITE-TIADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEMN 736

Query: 783 LDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQS 842
           L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+S
Sbjct: 737 LNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDYSPES 796

Query: 843 KGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTV 902
           KGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T 
Sbjct: 797 KGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTA 856

Query: 903 RTSSNGIVQFTYGGDGLDPLDME 925
           R S   ++QF YG DG+D   +E
Sbjct: 857 RNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  182 bits (463), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 143/427 (33%), Positives = 221/427 (51%), Gaps = 52/427 (12%)

Query: 1056 QLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  +++K   E  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLVND--GDERAARVVKGRIEKTILSDVVYYIQD 1173
             VT GVPR+KEI+N +K + TP +   L +D   D+  A+ ++  IE T L  +    + 
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTLKSITVASEI 1152

Query: 1174 VYK-DNLSFIQAKVDLGTIEKLQLELTIEDIAVAITRAS----KLKISTA-----DVSI- 1222
             Y  D  S +  + D   I +L   L  ++   ++ R S    +L++  A     D+++ 
Sbjct: 1153 YYDPDPRSTVIPEDD--EIIQLHFSLLDDETEQSLDRQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1223 -VG-------RNKININVFPEGYKAKSI---------STSAK-EPSENAVFYRMQHLRRA 1264
             VG       RN + + ++ E    K I         S  A+ E  E+ +  ++++    
Sbjct: 1211 QVGERIKETFRNDLFV-IWSEDNAEKLIIRCRVVRPKSMDAETEAEEDHMLKKIENT--M 1267

Query: 1265 LPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKT 1312
            L  I ++G+ +I R V+   D       G+ +      L  +G  L +VMT  GV  ++ 
Sbjct: 1268 LENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVMTVPGVDATRI 1327

Query: 1313 KTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRF 1372
             TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  ITR 
Sbjct: 1328 YTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGALTSITRH 1387

Query: 1373 GLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT 1432
            G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+   
Sbjct: 1388 GFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFDVM--- 1444

Query: 1433 SISEEDL 1439
             I EE L
Sbjct: 1445 -IDEESL 1450

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1719

 Score =  562 bits (1448), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 346/931 (37%), Positives = 511/931 (54%), Gaps = 74/931 (7%)

Query: 9   AP-KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAEC 67
           AP + +K ++F   S  ++ + S  +I   +  D    R  K+GG  D ++G    + +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK--RQFLA 125
            TC   +  C GHFGHI LA PVFH+G+     ++ + +C +C  +LL ++++  RQ ++
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQVMS 127

Query: 126 ELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRW 185
                  D+ +R   +  +   CK +  C                     +    D  + 
Sbjct: 128 I-----KDSKKRFNAIWTL---CKTKTVC------------------ETDVPSEDDPTQL 161

Query: 186 VGKKSAPEKE--------KWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPE 237
           + +      +        K VG WK+    N   E   +     LN  + LN+FK +   
Sbjct: 162 ISRGGCGNAQPTIRKDGLKLVGSWKKDKATNDGDEPEQRV----LNTEEILNIFKHISVH 217

Query: 238 DCELLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSS 297
           D   LG +   +  RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  + 
Sbjct: 218 DSNTLGFNE--QFARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANI 274

Query: 298 LIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKG 357
            ++     G   + + E    LQ  +A Y+++D    A  P A     +P++    RLKG
Sbjct: 275 SLETLEHNGAPHHAIEEAESLLQFHIATYMDNDI---AGQPQALQKSGRPVKSIRARLKG 331

Query: 358 KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQL 417
           K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QL
Sbjct: 332 KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQL 391

Query: 418 VINGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPS 477
           V NGPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQPS
Sbjct: 392 VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPS 449

Query: 478 LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 537
           LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450 LHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVPL 509

Query: 538 NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMK 597
            +++P+S +P +   QD + G   ++ +D F +   L  +L  + D +    +P PA++K
Sbjct: 510 QIVSPQSNKPCMGIVQDTLCGIRKLTLRDCFIELDQLLNMLYWVPDWDGI--IPTPAIIK 567

Query: 598 PHYLWTGKQVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMSVNDGFVVIRGS 655
           P  LW+GKQ+ S+ I      P  I++    +    + PK          ++G ++I G 
Sbjct: 568 PVPLWSGKQILSIAI------PKGIHLQRFDEGTTMLSPK----------DNGMLIIDG- 610

Query: 656 EILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISD- 714
           +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI D 
Sbjct: 611 QIIFGVVDKKTVG-SSNGGLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTGIGDT 669

Query: 715 VTPGADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 774
           +  G  +K+  E  + +A  K +E+  +     L  + G    ++ E  +   L++ R++
Sbjct: 670 IADGGTMKEITE-TIADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 775 VGEVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 834
            G +    L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729 AGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFS 788

Query: 835 KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 894
           K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789 KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 895 SCQYDNTVRTSSNGIVQFTYGGDGLDPLDME 925
              YD+T R S   ++QF YG DG+D   +E
Sbjct: 849 MVHYDSTTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  185 bits (469), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 218/427 (51%), Gaps = 48/427 (11%)

Query: 1054 VNQLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1113
            V Q  +++K   +  L    S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1114 SMNVTLGVPRIKEIINASKVISTPIINAVLVND--GDERAARVVKGRIEKTILSDV---- 1167
            S  VT GVPR+KEI+N +K + TP     L  +   D+  A++++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAIEHTTLKSVTVAS 1150

Query: 1168 -VYYIQD----VYKDNLSFIQAKVDLGTIEK-----------LQLEL---TIEDIAVAIT 1208
             +YY  D    V  ++   IQ    L   E            L+LEL    + D  + + 
Sbjct: 1151 EIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDRAAMNDKDLTMV 1210

Query: 1209 R-ASKLKIS-TADVSIVGR--NKININVFPEGYKAKSISTSAKEPSENAVFYRMQHLRRA 1264
            +   K+K +   D+S++    N   + +     + KS+     E  E+ +  ++++    
Sbjct: 1211 QVGEKIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDAET-EAEEDHMLKKIENT--M 1267

Query: 1265 LPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKT 1312
            L  I ++G+ DI R V+   D       G+ +      L  +G  L +VMT  GV GS+ 
Sbjct: 1268 LESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGVNLMEVMTVPGVDGSRI 1327

Query: 1313 KTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRF 1372
             TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR 
Sbjct: 1328 YTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRH 1387

Query: 1373 GLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT 1432
            G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+   
Sbjct: 1388 GFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM--- 1444

Query: 1433 SISEEDL 1439
             I EE L
Sbjct: 1445 -IDEESL 1450

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON}
           Anc_7.314
          Length = 1716

 Score =  560 bits (1442), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 346/928 (37%), Positives = 502/928 (54%), Gaps = 68/928 (7%)

Query: 9   AP-KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAEC 67
           AP + +K ++F   S  ++   S  +I   +  D    R  K+GG  D ++G    + +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKC 67

Query: 68  STCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAEL 127
            TC   +  C GHFGHI LA PVFHVG+     ++ + VC +C  +LL + +++   A  
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNEQMRQAMA 127

Query: 128 RRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
            +        + TL      CK +  C                     +    D    + 
Sbjct: 128 IKDSKKRFNAVWTL------CKTKMIC------------------ETDVPSDDDPTTLIS 163

Query: 188 KKSAPEKE--------KWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDC 239
           +      +        K VG WK+  ++  + +   +R    L+  + LN+FK + PED 
Sbjct: 164 RGGCGNAQPSIRKDGLKLVGSWKKE-KNTSDGDEPEQRV---LSTEEILNIFKHISPEDS 219

Query: 240 ELLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
             +G        RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +
Sbjct: 220 TRMGFSEEF--ARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISL 276

Query: 300 KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQ 359
           +     G   + + E    LQ  VA Y+++D    A  P A     +P++    RLKGK+
Sbjct: 277 ETLEHNGAPHHAIEEAESLLQFHVATYMDNDI---AGQPQALQKSGRPVKSIRARLKGKE 333

Query: 360 GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419
           GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVR 393

Query: 420 NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479
           NGPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLH 451

Query: 480 RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
           ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 540 LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPH 599
           ++ +S +P +   QD + G   ++ +D+F +   +  +L  + D +    +P PAV+KP 
Sbjct: 512 VSAQSNKPCMGIVQDTLCGIRKLTLRDTFIEFDQVLNMLYWVPDWDGV--IPTPAVLKPK 569

Query: 600 YLWTGKQVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEMSVNDGFVVIRGSEI 657
            LWTGKQV S  I      P  I++    +    + PK          ++G +VI G +I
Sbjct: 570 PLWTGKQVLSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-QI 612

Query: 658 LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 717
           + GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D   
Sbjct: 613 IFGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTGIGDTIA 671

Query: 718 GADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                ++  + + EA  K +++  +     L  + G    ++ E  +   L++ R++ G 
Sbjct: 672 DGQTIKEITETIAEAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 778 VCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 837
           +    L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732 LAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDD 791

Query: 838 KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 897
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792 YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898 YDNTVRTSSNGIVQFTYGGDGLDPLDME 925
           YD T R S   ++QF YG DG+D   +E
Sbjct: 852 YDGTTRNSLGNVIQFIYGEDGIDAAHIE 879

 Score =  181 bits (458), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 140/426 (32%), Positives = 213/426 (50%), Gaps = 50/426 (11%)

Query: 1056 QLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  K++K   +  L    S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLVNDG---DERAARVVKGRIEKTILSDV----- 1167
             VT GVPR+KEI+N +K + TP +  V + DG   D+  A+ ++  IE T L  +     
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSL-TVYLKDGYSSDQEKAKFIRSAIEHTTLKSITVASE 1151

Query: 1168 VYYIQD----VYKDNLSFIQAKVDLGTIEK-----------LQLEL-----TIEDIAVAI 1207
            +YY  D    V  ++   IQ    L   E            L+LEL       +D+ +  
Sbjct: 1152 IYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1208 TRASKLKISTADVSIVGR--NKININVFPEGYKAKSISTSAKEPSENAVFYRMQHLRRAL 1265
                  +    D+ ++    N   + +     + KS+     E  E+ +  ++++    L
Sbjct: 1212 VGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAET-EAEEDHMLKKIENT--ML 1268

Query: 1266 PGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTK 1313
              I ++G+ +I R V+   D       G+ E      L  +G  L +VMT  G+  ++  
Sbjct: 1269 ENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEVMTVPGIDATRIY 1328

Query: 1314 TNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1373
            TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G
Sbjct: 1329 TNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHG 1388

Query: 1374 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTS 1433
             ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+    
Sbjct: 1389 FNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFDVM---- 1444

Query: 1434 ISEEDL 1439
            I EE L
Sbjct: 1445 IDEESL 1450

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
           complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  490 bits (1262), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 257/577 (44%), Positives = 359/577 (62%), Gaps = 24/577 (4%)

Query: 346 KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEK 405
           +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE 
Sbjct: 2   RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 406 VTRYNKHKLQQLVINGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIE 465
           VT YN  +L QLV NGPN HPGA Y+++ N D R +LRY  R    + LQYG  VERHI 
Sbjct: 62  VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 466 DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 525
           D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120 DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 526 RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGN 585
           RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +   +  +L  + D +
Sbjct: 180 RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIEFDQVLNMLYWVPDWD 239

Query: 586 MQFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVIINVDA--KNKVFMPPKHKGLPNEM 643
               +P PA++KP  LWTGKQ+ S+ I      P  I++    +    + PK        
Sbjct: 240 GV--IPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPK-------- 283

Query: 644 SVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYL 703
             ++G +VI G +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L
Sbjct: 284 --DNGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKVVNFWL 339

Query: 704 GNRGFSIGISDVTPGADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAK 763
            + GFS GI D     +  ++  + + EA  K +E+  +     L  + G    ++ E  
Sbjct: 340 LHNGFSTGIGDTIADGETMKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDN 399

Query: 764 IGGLLSKVREEVGEVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPD 823
           +   L++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  
Sbjct: 400 VVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAF 459

Query: 824 GFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYM 883
           GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+
Sbjct: 460 GFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYI 519

Query: 884 SRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLD 920
            RRL+K+LED+   YD+T R S   ++QF YG DG+D
Sbjct: 520 QRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGID 556

 Score =  178 bits (452), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 143/427 (33%), Positives = 214/427 (50%), Gaps = 58/427 (13%)

Query: 1059 KISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1118
            +++K   +  L    S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 718  RLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 777

Query: 1119 LGVPRIKEIINASKVISTPIINAVLVNDG--DERAARVVKGRIEKTILSDV-----VYYI 1171
             GVPR+KEI+N +K + TP     L  +   D+  A+ ++  IE T L  V     +YY 
Sbjct: 778  SGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEKAKFIRSAIEHTTLKSVTVASEIYYD 837

Query: 1172 QD----VYKDNLSFIQAKVDLGTIEK-----------LQLEL---TIEDIAVAITR-ASK 1212
             D    V  D+   IQ    L   E            L+LEL    + D  + + +   K
Sbjct: 838  PDPRSTVIPDDEEIIQLHFSLLDDETEKALDNQSPWLLRLELDRAAMNDKDLTMGQVGEK 897

Query: 1213 LKISTADVSIVGRNKININ--------VFPEGYKAKSISTSAKEPSENAVFYRMQHLRRA 1264
            +K +  +   V  ++ N +        V P+   A++      E  E+ +  ++++    
Sbjct: 898  IKETFKNDLFVIWSEDNADKLIIRCRVVRPKSLDAET------EAEEDHMLKKIENT--M 949

Query: 1265 LPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKT 1312
            L  I ++G+ DI R V+   D      +G  E      L  +G  L +VMT  GV  ++ 
Sbjct: 950  LESITLRGVEDIERVVMMKYDRKMPSENGAYEKVPEWVLETDGVNLLEVMTVTGVDPTRI 1009

Query: 1313 KTNHILEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRF 1372
             TN  ++I  VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR 
Sbjct: 1010 YTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGSLTSVTRH 1069

Query: 1373 GLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT 1432
            G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F V+   
Sbjct: 1070 GFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPVGTGAFDVM--- 1126

Query: 1433 SISEEDL 1439
             I EE L
Sbjct: 1127 -IDEESL 1132

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  448 bits (1152), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 319/991 (32%), Positives = 501/991 (50%), Gaps = 148/991 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
              K  LE + I  + +M  +  +Q  V  +I+S         G +GGK  PI G  Q L+
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTKAQ-----GNTGGKV-PIPGVKQALE 447

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 448  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 507

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNLQ----------YGDVVER 462
             +INGP+  PGA+ +  +N+D        +    R  LA  L               V R
Sbjct: 508  AIINGPDKWPGASQI--QNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKVYR 565

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 566  HIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 625

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R    Q +   
Sbjct: 626  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGC 685

Query: 582  ---SDGNM---QFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVI--INVDAKNKVFMP 633
                DG+    +    PPA+ KP  LWTGKQ+ + ++  N   P +  IN+ + NK+   
Sbjct: 686  IRPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLL-NVTPPDMPGINLKSSNKI--- 741

Query: 634  PKHKGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMN 693
             K++        ND  V+ +  ++L G++DKS  G   K+ + +++   YGP+ AA  ++
Sbjct: 742  -KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVLS 797

Query: 694  RMAKLCARYLGNRGFSIGISDVTPGADLKQKKEDKVEEA--------------------- 732
             + +L   Y+ N  F+ G+ D+   +D  + + D ++E+                     
Sbjct: 798  VLGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLDKDTPSN 857

Query: 733  ----YAKCDELIDQFNKGKLETQPGCNEEQTLEAKI------GGLLSKVREEVGEVCIRE 782
                  + +E++   NK  +       +  T+ +K+      GG + K  E         
Sbjct: 858  DPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPE--------- 908

Query: 783  LDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQS 842
                N+   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        +
Sbjct: 909  ----NSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMA 964

Query: 843  KGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTV 902
             G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+V
Sbjct: 965  GGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSV 1024

Query: 903  RTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTN 962
            R +   ++QF YGGD +D +  E +    NF                        ++N +
Sbjct: 1025 RDADGTLIQFLYGGDAVDVIK-ESHMTEFNF-----------------------CLDNYD 1060

Query: 963  SILKPLE-QKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIR 1021
            ++LK      LV   ++   L K  ++ ++   +H  E+++ Q+L+         L+K  
Sbjct: 1061 ALLKKYNPSALVEHVDVETAL-KYSKKTLKNRKKHKDEKHYKQTLK-----YDPVLSKYN 1114

Query: 1022 KAKGLKTLLDEPAPELKILNLDEQ---YPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078
             AK L  + +    +L++  LD+    + EY   ++N+         + F  +   KY R
Sbjct: 1115 PAKYLGAVSENFQDKLELF-LDKSSKTFKEY--ESINE---------KKFRALMQLKYMR 1162

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1137
            + + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1163 SLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTP 1222

Query: 1138 IINAVLVNDGDERAARVVKGRIEKTILSDVV 1168
             +   + ND  +  A      I K ILS+V+
Sbjct: 1223 QMTLPIWNDVSDETADTFCKSISKVILSEVI 1253

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 89/166 (53%), Gaps = 2/166 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            +++ +P I R +    ++GKR L+ EG   + +   +  I      +N I  +    G+E
Sbjct: 1478 IIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGVE 1537

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1538 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1596

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTS 1433
            E T   L  A    +++ +E  S  I+LG+  ++GTG+F ++   S
Sbjct: 1597 ETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDILSKVS 1642

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  L+++DI   S   I+   + D  N   P  GG  D  +G    +  C TC 
Sbjct: 10  EISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   D  ++  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  447 bits (1151), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 324/980 (33%), Positives = 493/980 (50%), Gaps = 126/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G + GK  PI G  Q L+
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PIPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNL----------QYGDVVER 462
             VINGP+  PGA  +  +N+D        +    R  LA  L               V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKVYR 579

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 582  ---SDGNM---QFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVI--INVDAKNKVFMP 633
                DG+    +    PP + KP+ LWTGKQ+ + ++  N   P +  IN+ +KNK+   
Sbjct: 700  IRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIKNE 758

Query: 634  PKHKG-LPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAM 692
               KG L NE+   DG        +L G++DKS  G   K+ + +++   YGP+ AA  +
Sbjct: 759  YWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVL 810

Query: 693  NRMAKLCARYLGNRGFSIGISDVTPGA-------DLKQKKEDKVEEAYAKCDELID---- 741
            + + +L   Y+    F+ G+ D+   A       D+ +   D   EA A+   L      
Sbjct: 811  SVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPA 870

Query: 742  ---QFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMAT 794
               +  K   E     N+   L+A     ++ +  +V   C+ +      P      MA 
Sbjct: 871  DDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMAL 930

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+
Sbjct: 931  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGI 990

Query: 855  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 914
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF Y
Sbjct: 991  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMY 1050

Query: 915  GGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLL----PYQIIENTNSILKPLEQ 970
            GGD +D   +   +    F    D+          + LL    P  +IE+ +     +E 
Sbjct: 1051 GGDAID---ITKESHMTQFEFCLDNY---------YALLKKYNPSALIEHLD-----VES 1093

Query: 971  KLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLL 1030
             L           K  ++ ++Y  +H  E ++ QS++         LAK   AK L ++ 
Sbjct: 1094 AL-----------KYSKKTLKYRKKHSKEPHYKQSVK-----YDPVLAKYNPAKYLGSVS 1137

Query: 1031 DEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVET-FLGIAISKYHRAKVEPGTAVGA 1089
            +    +L          E  L   ++L K S  + E  F  +   KY R+ + PG AVG 
Sbjct: 1138 ENFQDKL----------ESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGI 1187

Query: 1090 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGD 1148
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ND  
Sbjct: 1188 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVS 1247

Query: 1149 ERAARVVKGRIEKTILSDVV 1168
            +  A      I K +LS+V+
Sbjct: 1248 DEQADTFCKSISKVLLSEVI 1267

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            +++ +P I R V    ++GKR L+ EG   + +   +  I      +N +  +    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  L+A +I   S  +I+   + D  N   P  GG  D  +G    +  CSTC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  445 bits (1145), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 319/978 (32%), Positives = 496/978 (50%), Gaps = 145/978 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS + ++   ++++ L   L++I+ TS LI+      + L+K         I 
Sbjct: 362  PPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKDKVSVDDRRII 418

Query: 309  INNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFRGNLSG 368
             + +M  +  +Q  V  +I+S         G + GK  P+ G  Q L+ K+G FR ++ G
Sbjct: 419  FSRLMNAFVTIQNDVNAFIDSTKAQ-----GNTSGKV-PVPGVKQALEKKEGLFRKHMMG 472

Query: 369  KRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPNIHPGA 428
            KRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT +N  +L+Q VINGP+  PGA
Sbjct: 473  KRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQAVINGPDKWPGA 532

Query: 429  NYLLKKNDDARR----NLRYGDRMKLAKNLQ-----------YGDVVERHIEDGDVVLFN 473
              +  +N+D        +    R  LA  L                V RHI++ D+V+ N
Sbjct: 533  TQI--QNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHIKNRDIVIMN 590

Query: 474  RQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 532
            RQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL
Sbjct: 591  RQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNL 650

Query: 533  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM---SDGN---M 586
                +  LTP SG P+    QD I+    +++KDSFF R    Q +       DG+    
Sbjct: 651  ANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHATRA 710

Query: 587  QFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVI--INVDAKNKVFMPPKHKGLPNEMS 644
            +    PPAVMKP  LWTGKQ+ + ++  N   P +  IN+ + NK+      KG      
Sbjct: 711  KLATVPPAVMKPVPLWTGKQIITTVLL-NITPPDMPGINLKSSNKIKNDYWGKG------ 763

Query: 645  VNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLG 704
             N+  V+ +  E+L G++DKS  G   K+ + + +   YGP  +A A++ + +L   Y+ 
Sbjct: 764  SNENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLGRLFTNYIT 822

Query: 705  NRGFSIGISDVTPGAD-LKQKKE------DKVEEAYA------------------KCDEL 739
               F+ G+ D+    +  K +KE      D   EA A                  + +E+
Sbjct: 823  ATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPELLKRLEEI 882

Query: 740  IDQFNKGKLETQPGCNEEQTLEAKI------GGLLSKVREEVGEVCIRELDNLNAPLIMA 793
            I   NK  +      ++  T+ +K+      GG + K  E             N+   MA
Sbjct: 883  IRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPE-------------NSMQSMA 929

Query: 794  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 853
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSG 989

Query: 854  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 913
            + P E+ FH ++GREGL+DTAVKTA +GY+ R L K LE +   YDN++R +   ++Q  
Sbjct: 990  IRPQEYYFHCMAGREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQML 1049

Query: 914  YGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLE-QKL 972
            YGGD +D +  E +    NF                        +EN +++LK      L
Sbjct: 1050 YGGDAID-VTKESHLTKFNF-----------------------CLENYDALLKKYNPSAL 1085

Query: 973  VRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLLDE 1032
            +   ++   L K  ++ ++Y  +H  E ++ Q+++         L+K   AK L ++ + 
Sbjct: 1086 IEHLDVETAL-KYSKKSLKYRKKHAKEAHYQQTVK-----YDPILSKYNPAKYLGSVSE- 1138

Query: 1033 PAPELKILNLDEQYPEYILTAVNQLCKISKNLVE-TFLGIAISKYHRAKVEPGTAVGAIG 1091
                    N  +Q  E  L   ++L K  +++ E  F  +   KY R+ + PG AVG I 
Sbjct: 1139 --------NFQDQL-ENFLHDNSKLLKSHEDVNEKKFRALMQLKYMRSLINPGEAVGIIA 1189

Query: 1092 AQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDER 1150
            +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  + 
Sbjct: 1190 SQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLPILDDVTDE 1249

Query: 1151 AARVVKGRIEKTILSDVV 1168
             A      I K +LS+V+
Sbjct: 1250 QADTFAKSISKVVLSEVI 1267

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 90/167 (53%), Gaps = 12/167 (7%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEG------YGLRDVMTTDGVIGSKTKTNHILEIFN 1322
            V++ +P I R V    ++GKR L+ EG      +   D +  DG+     ++N +  +  
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGI-----RSNDVSAVLK 1549

Query: 1323 VLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1382
              G+EAAR ++V EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S++
Sbjct: 1550 TYGVEAARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLM 1609

Query: 1383 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTGSF V+
Sbjct: 1610 KM-SYETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++FS L++ DI + S  +I    + D  N   P  GG  D  +G    +  C+TC 
Sbjct: 10  EITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +PV++  +F      L+  C  C    L   +  +F  +L+
Sbjct: 67  LDEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  443 bits (1139), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 315/979 (32%), Positives = 492/979 (50%), Gaps = 124/979 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
                +  +K +  N +M  +  +Q  V  +I+S         G++GGK  PI G  Q L+
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GSAGGKV-PIPGVKQALE 455

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 456  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 515

Query: 417  LVINGPNIHPGANYLLKKNDDARRNLRYG----DRMKLAKNL----------QYGDVVER 462
             VINGP+  PGA+ +  +N+D       G     R  LA  L               V R
Sbjct: 516  AVINGPDKWPGASQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKVYR 573

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 574  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 633

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +   
Sbjct: 634  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGC 693

Query: 582  ---SDGNM---QFDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFMPP 634
                DG+    +    PPAVMKP  LWTGKQ+ + +L+         IN+ +KNK+    
Sbjct: 694  IRPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI---- 749

Query: 635  KHKGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNR 694
            K+       + ND  V+ +  E+L G++DKS  G   K+ + +++   YGP  +A  ++ 
Sbjct: 750  KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVLSV 806

Query: 695  MAKLCARYLGNRGFSIGISDVTPG-------ADLKQKKEDKVEEAYAKCDELIDQFNKGK 747
            + +L   Y+    F+ G+ D+          +D+ +   D    A A+   L    +   
Sbjct: 807  LGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSAND 866

Query: 748  LETQPGCNEEQTLEAKIGGL-------LSKVREEVGEVCI-----RELDNLNAPLIMATC 795
             E      E    + K+G L       ++ +  +V   C+     ++  N N+   MA  
Sbjct: 867  TELLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAMALS 925

Query: 796  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLS 855
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ 
Sbjct: 926  GAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYSGIR 985

Query: 856  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYG 915
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YG
Sbjct: 986  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLYG 1045

Query: 916  GDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLEQKLVRF 975
            GD +D +  E +     F                         +N +++LK      +  
Sbjct: 1046 GDAVD-VTQESHMTEFKF-----------------------CADNYDALLKKYNPSAL-- 1079

Query: 976  DNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDY-MTEKATHLAKIRKAKGLKTLLDEPA 1034
                          IE++D   A +   ++L++    E+  H A+  K   + +  +   
Sbjct: 1080 --------------IEHLDVESALKYSKKALKNRKKNERVPHFAQKVKYDPVVSKFN--- 1122

Query: 1035 PELKILNLDEQYP---EYILTAVNQLCKISKNLVE-TFLGIAISKYHRAKVEPGTAVGAI 1090
            P   + ++ E +    E  + + N+L K   ++ E  F  +   KY R+ + PG AVG I
Sbjct: 1123 PSKYLGSVSENFQDKLESFIDSNNELFKSRDSVNEKKFRALMQLKYMRSLINPGEAVGII 1182

Query: 1091 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDE 1149
             +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  +
Sbjct: 1183 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVTD 1242

Query: 1150 RAARVVKGRIEKTILSDVV 1168
              A      I K +LS+VV
Sbjct: 1243 SQADTFCKSITKVMLSEVV 1261

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 91/168 (54%), Gaps = 2/168 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            V++ + +I R V    ++GKR L+ EG   +++   D  +  +   +N +  +    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSIS 1435
            E T   L  A    + + ++  S  ++LG+  ++GTG+F V+   S S
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVLAKVSAS 1653

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  ++A DI   S ++I+   + D  N   P  GG  D  +G    +  C+TC 
Sbjct: 10  EITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  441 bits (1135), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 319/980 (32%), Positives = 493/980 (50%), Gaps = 126/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G + GK  P+ G  Q L+
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PVPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNL----------QYGDVVER 462
             VINGP+  PGA  +  +N+D        +    R  LA  L               V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVYR 579

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 582  ---SDGNM---QFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVI--INVDAKNKVFMP 633
                DG+    +    PP + KP+ LWTGKQ+ + ++  N   P +  IN+ +KNK+   
Sbjct: 700  IRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLLSKNKIKNE 758

Query: 634  PKHKG-LPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAM 692
               KG L NE+   DG        +L G++DKS  G   K+ + +++   YGP+ AA  +
Sbjct: 759  YWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVL 810

Query: 693  NRMAKLCARYLGNRGFSIGISDVTPGA-------DLKQKKEDKVEEAYAKCDELID---- 741
            + + +L   Y+    F+ G+ D+   A       D+ +   D   +A A+   L      
Sbjct: 811  SVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKDTPA 870

Query: 742  ---QFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMAT 794
               +  K   E     N+   L+A     ++ +  +V   C+ +      P      MA 
Sbjct: 871  DDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMAL 930

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+
Sbjct: 931  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGI 990

Query: 855  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 914
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF Y
Sbjct: 991  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMY 1050

Query: 915  GGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLL----PYQIIENTNSILKPLEQ 970
            GGD +D   +   +    F    D+          + LL    P  +IE+ +     +E 
Sbjct: 1051 GGDAID---ITKESHMTQFEFCLDNY---------YALLKKYNPSALIEHLD-----VES 1093

Query: 971  KLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLL 1030
             L           K  ++ ++Y  +H  E ++ QS++         LAK   AK L ++ 
Sbjct: 1094 AL-----------KYSKKTLKYRKKHIKEPHYKQSIK-----YDPVLAKYNPAKYLGSVS 1137

Query: 1031 DEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVET-FLGIAISKYHRAKVEPGTAVGA 1089
            +    +L          E  L   ++L K +  + E  F  +   KY R+ + PG AVG 
Sbjct: 1138 ENFQDKL----------ESFLDKGSKLFKSADGVNEKKFRALMQLKYMRSLINPGEAVGI 1187

Query: 1090 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGD 1148
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +D  
Sbjct: 1188 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVS 1247

Query: 1149 ERAARVVKGRIEKTILSDVV 1168
            +  A      I K +LS+V+
Sbjct: 1248 DEQADTFCKSISKVLLSEVI 1267

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            +++ +P I R V    ++GKR L+ EG   + +   +  I      +N +  +    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  L+A +I   S  +I+   + D  N   P  GG  D  +G    +  CSTC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  441 bits (1135), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 321/985 (32%), Positives = 494/985 (50%), Gaps = 130/985 (13%)

Query: 249  KSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------A 301
            KS  P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+      +
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 302  GLEKG--------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQ 353
             L+K         +  + +M  +  +Q  V  +I+S         G++GGK  PI G  Q
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ-----GSTGGKV-PIPGVKQ 459

Query: 354  RLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHK 413
             L+ K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +
Sbjct: 460  ALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAE 519

Query: 414  LQQLVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNL----------QYGDV 459
            L+Q VINGP+  PGA  +  +N+D        +    R  LA  L               
Sbjct: 520  LRQAVINGPDKWPGATQI--QNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNKK 577

Query: 460  VERHIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLH 518
            V RHI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H
Sbjct: 578  VFRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMH 637

Query: 519  VPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLL 578
             PQ E AR+EA NL    +  LTP SG P+    QD I+    +++KDSFF R    Q +
Sbjct: 638  FPQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQYI 697

Query: 579  SMM---SDGNM---QFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVI-INVDAKNKVF 631
                   DG+    +    PPAVMKP  LWTGKQ+ + +I     + +  IN+ +KNK+ 
Sbjct: 698  YGCIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNKI- 756

Query: 632  MPPKHKGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASA 691
               K++      + N+  V+ +   +L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 757  ---KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKV 810

Query: 692  MNRMAKLCARYLGNRGFSIGISDVTPGA-------DLKQKKEDKVEEAYAKCD------- 737
            ++ + +L   ++ N  FS G+ D+   A       DL +   D   +A A+         
Sbjct: 811  LSVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTDTP 870

Query: 738  ----ELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPLIMA 793
                EL+ +  +   +       +    +K+  + SKV   V      +    N+   MA
Sbjct: 871  SNDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQAMA 930

Query: 794  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 853
              G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 931  LSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSG 990

Query: 854  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 913
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF 
Sbjct: 991  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQFL 1050

Query: 914  YGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLL-----PYQIIE--NTNSILK 966
            YGGD +D                  H     F  +++  L     P  ++E  +  S LK
Sbjct: 1051 YGGDAVD-------------TTKESHMTQFDFCLENYDALLRKYNPSALVEHLDVESALK 1097

Query: 967  PLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRK--AK 1024
              ++ L        K++KE   K    D++D   + Y          A +L  + +    
Sbjct: 1098 YSKKAL----KSRKKIDKEPHYKNS--DKYDPVLSKYNP--------AKYLGSVSEKFQD 1143

Query: 1025 GLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRAKVEPG 1084
             L+  LD  + +LK+            + +N+         + F  +   KY R+ V PG
Sbjct: 1144 KLEGFLDSHSKQLKLH-----------SGINE---------KKFRALMQLKYMRSLVNPG 1183

Query: 1085 TAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVL 1143
             AVG I AQS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++  +
Sbjct: 1184 EAVGIIAAQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPV 1243

Query: 1144 VNDGDERAARVVKGRIEKTILSDVV 1168
             N   +  A +    I K +LS+VV
Sbjct: 1244 WNHVSDDQASIFCKSITKVVLSEVV 1268

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 84/162 (51%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            V++ +P ISR +       +R L  EG   + +   +  I     ++N +  +    G+E
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRSNDVAAVLRTYGVE 1559

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1560 AARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFMKM-SY 1618

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A     ++ ++  S  I+LG+  ++GTG+F V+
Sbjct: 1619 ETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F+  SA +I   S  +I+   + D  N   P  GG  D  +G    +  C+TC 
Sbjct: 10  EISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  +F  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  441 bits (1133), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 319/980 (32%), Positives = 494/980 (50%), Gaps = 126/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G + GK  PI G  Q L+
Sbjct: 408  KDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PIPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNL----------QYGDVVER 462
             VINGP+  PGA  +  +N+D        + +  R  LA  L               V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNKKVYR 579

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 582  ---SDGNM---QFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVI--INVDAKNKVFMP 633
                DG+    +    PP + KP+ LWTGKQ+ + ++  N   P +  IN+ +KNK+   
Sbjct: 700  IRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIKNE 758

Query: 634  PKHKG-LPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAM 692
               KG L +E+   DG        +L G++DKS  G   K+ + +++   YGP+ AA  +
Sbjct: 759  YWGKGSLESEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVL 810

Query: 693  NRMAKLCARYLGNRGFSIGISDVTPGA-------DLKQKKEDKVEEAYAKCDELIDQ--- 742
            + + +L   Y+    F+ G+ D+   A       D+ +   D   +A A+   L  +   
Sbjct: 811  SVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKETPS 870

Query: 743  ----FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMAT 794
                  K   E     N+   L+A     ++ +  +V   C+ +      P      MA 
Sbjct: 871  DDPELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMAL 930

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+
Sbjct: 931  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGI 990

Query: 855  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 914
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF Y
Sbjct: 991  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQFMY 1050

Query: 915  GGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLL----PYQIIENTNSILKPLEQ 970
            GGD +D   +   +    F    D+          + LL    P  +IE+ +     +E 
Sbjct: 1051 GGDAVD---ITKESHMTQFEFCLDNY---------YALLKKYNPSALIEHLD-----VES 1093

Query: 971  KLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLL 1030
             L           K  ++ ++Y  +H  E ++ QS++         LAK   AK L ++ 
Sbjct: 1094 AL-----------KYSKKTLKYRKKHSKEPHYKQSMK-----YDPVLAKYSPAKYLGSVS 1137

Query: 1031 DEPAPELKILNLDEQYPEYILT-AVNQLCKISKNLVETFLGIAISKYHRAKVEPGTAVGA 1089
            +    +L+   LDE    +  T  VN+         + F  +   KY R+ + PG AVG 
Sbjct: 1138 ENFQDKLESF-LDENSKLFKSTDGVNE---------KKFRALMQLKYMRSLINPGEAVGI 1187

Query: 1090 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGD 1148
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +D  
Sbjct: 1188 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVS 1247

Query: 1149 ERAARVVKGRIEKTILSDVV 1168
            +  A      I K +LS+V+
Sbjct: 1248 DEQADTFCKSISKVLLSEVI 1267

 Score = 88.6 bits (218), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            +++ +P I R V    ++GKR L+ EG   + +   +  I      +N +  +    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  L+A +I   S  +I+   + D  N   P  GG  D  +G    +  CSTC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  441 bits (1133), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 316/967 (32%), Positives = 489/967 (50%), Gaps = 123/967 (12%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS M ++   ++++ L   L++I+ T+ LI+      + L+K         I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFRGNLSG 368
             + +M  +  +Q  V  +I+S         G++GG   P+ G  Q L+ K+G FR ++ G
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ-----GSTGGNV-PVPGVKQALEKKEGLFRKHMMG 477

Query: 369  KRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPNIHPGA 428
            KRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q VINGP+  PGA
Sbjct: 478  KRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPGA 537

Query: 429  NYLLKKNDDARR----NLRYGDRMKLAKNLQ-----------YGDVVERHIEDGDVVLFN 473
              L  +N+D        +    R  LA  L                V RHI++ D+V+ N
Sbjct: 538  --LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVIMN 595

Query: 474  RQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 532
            RQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL
Sbjct: 596  RQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNL 655

Query: 533  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM---SDGNM--- 586
                +  LTP SG P+    QD I+    ++ KDSFF R    Q +       DG+    
Sbjct: 656  ANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRP 715

Query: 587  QFDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEM-- 643
            +    PPAV KP  LWTGKQ+ + +L+         IN+ + NK+          NE   
Sbjct: 716  KLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI---------KNEYWG 766

Query: 644  -SVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARY 702
             S  +  V+ +  E+L G++DK+  G   K+ + +++   YGP  AA  ++ + +L   Y
Sbjct: 767  KSSEENEVLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNY 825

Query: 703  LGNRGFSIGISDVTPGA-------DLKQKKEDKVEEAYAKCDELID-------QFNKGKL 748
            +    F+ G+ D+   A       D+ +   D   EA A+   L         +  K   
Sbjct: 826  IMATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQ 885

Query: 749  ETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCGSKGSTLNV 804
            E     N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +NV
Sbjct: 886  EVLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNV 945

Query: 805  SQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAI 864
            SQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH +
Sbjct: 946  SQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCM 1005

Query: 865  SGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLDM 924
            +GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D +  
Sbjct: 1006 AGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD-VTK 1064

Query: 925  EGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLE-QKLVRFDNLGNKLN 983
            E +    +F                        +EN +++LK      L+   ++ + L 
Sbjct: 1065 ESHMTKFDF-----------------------CLENYDALLKKYNPSALIEHLDVESAL- 1100

Query: 984  KEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLLDEPAPELKILNLD 1043
            K  ++ ++Y  +H  E ++ QS +         LAK   AK L ++ ++   +L      
Sbjct: 1101 KYSKKSLKYRKKHAKEAHYKQSPK-----YDPVLAKYNPAKYLGSVSEKFQDKL------ 1149

Query: 1044 EQYPEYILTAVNQLCKISKNLVE-TFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQM 1102
                E  +   ++L K + ++ E  F  +   KY R+ + PG AVG I +QS+GEP TQM
Sbjct: 1150 ----ETFIDKNSKLFKHNDDISEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQM 1205

Query: 1103 TLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDERAARVVKGRIEK 1161
            TL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  ++ A      I K
Sbjct: 1206 TLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSKSISK 1265

Query: 1162 TILSDVV 1168
             +LS+V+
Sbjct: 1266 VLLSEVI 1272

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 88/167 (52%), Gaps = 12/167 (7%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLR------DVMTTDGVIGSKTKTNHILEIFN 1322
            ++  +P I R V    ++GKR L+ EG   +      D +  DG+      +N +  +  
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGIT-----SNDVSAVLK 1555

Query: 1323 VLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1382
            V G+EAAR +IV EI      + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1556 VYGVEAARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLM 1615

Query: 1383 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            ++ S+E T   L  A    +++ ++  S  I++G+  ++GTGSF ++
Sbjct: 1616 KM-SYETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F   SA ++ A S  +I+   + D  N   P  GG  D  +G    +  C++C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALGAFLRNM-CASCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  439 bits (1129), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 339/1086 (31%), Positives = 534/1086 (49%), Gaps = 158/1086 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLEKGIS 308
            PP   R PS +  +   ++++ L   L++I+ TS LI+              A  ++ I 
Sbjct: 357  PPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDEISKLQKDKVALDDRRII 413

Query: 309  INNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFRGNLSG 368
             + +M  +  +Q  V  +I+S         G + GK  P+ G  Q L+ K+G FR ++ G
Sbjct: 414  FSRLMNAFVTIQNDVNSFIDSSKAQ-----GNNSGKL-PVPGVKQALEKKEGLFRKHMMG 467

Query: 369  KRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPNIHPGA 428
            KRV+++ R+VISPDPN+  DE+ VP   A  LTYPE VT YN  +L+Q VINGP+  PGA
Sbjct: 468  KRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPGA 527

Query: 429  NYLLKKNDDARR----NLRYGDRMKLAKNLQ----------YGDVVERHIEDGDVVLFNR 474
              +  +N+D        +    R  LA  L               V RHI++ DVV+ NR
Sbjct: 528  TQI--QNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNKKVYRHIKNRDVVIMNR 585

Query: 475  QPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 533
            QP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL 
Sbjct: 586  QPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLA 645

Query: 534  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM---SDG---NMQ 587
               +  LTP SG P+    QD I+    ++ KDS+F R    Q +       DG   N +
Sbjct: 646  NTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQYIYGCIRPEDGHSANNK 705

Query: 588  FDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVI---INVDAKNKVFMPPKHKGLPNEMS 644
                PPA++KP  LWTGKQ+ + ++     SPV    IN+ +KNK+    ++ G  +E  
Sbjct: 706  LLTIPPAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLKSKNKI--KDEYWGQHSE-- 759

Query: 645  VNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLG 704
              +  V+ +   +L G++DKS  G   K+ + + +   YGP+ AA  ++ + +L   Y+ 
Sbjct: 760  --ENEVLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAAKVLSVLGRLFTNYIT 816

Query: 705  NRGFSIGISDVTPG-------ADLKQKKEDKVEEAYAKCDEL-------IDQFNKGKLET 750
            N  F+ G+ D+           D+ +   D+  +A  +   L         +  K   E 
Sbjct: 817  NTAFTCGMDDLRLTDEGNKWRTDILKTSVDRGRQAAVEVTNLEKDTSADDSELLKRLEEI 876

Query: 751  QPGCNEEQTLEAKIGGLLSKVREEVGEVCI----RELDNLNAPLIMATCGSKGSTLNVSQ 806
                N+   L+A     ++ +  +V   C+     +    N+   MA  G+KGS +NVSQ
Sbjct: 877  LRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPENSMQSMALSGAKGSNVNVSQ 936

Query: 807  MVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISG 866
            ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ FH ++G
Sbjct: 937  IMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKPQEYYFHCMAG 996

Query: 867  REGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLDMEG 926
            REGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F YGGD +D      
Sbjct: 997  REGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIEFLYGGDAVDVT---- 1052

Query: 927  NAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLE-QKLVRFDNLGNKLNKE 985
                        + N   F            ++N +S+LK      L+ F ++ + L K 
Sbjct: 1053 ---------KESYMNQFDF-----------CLDNYDSLLKRYNPAALIDFLDVDSAL-KY 1091

Query: 986  DEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLLDEPAPELKILNLDEQ 1045
             ++ +++  ++    ++ Q+++         LAK   AK L ++ ++   +L        
Sbjct: 1092 SKKTLKHRKKNKNVPHYLQNIK-----YDPVLAKYNPAKYLGSVSEKFQDKL-------- 1138

Query: 1046 YPEYILTAVNQLCKISKNLVET-FLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTL 1104
              E  L + +QL K  K++ E  F  +   KY R+ + PG AVG I +QS+GEP TQMTL
Sbjct: 1139 --ENFLDSNSQLFKSHKSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTL 1196

Query: 1105 KTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDERAARVVKGRIEKTI 1163
             TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +  A +    I K I
Sbjct: 1197 NTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTDDQADIFAKSISKVI 1256

Query: 1164 LSDVV---------------------YYIQDVY-------KDNLSFIQAKVDLGTIE--- 1192
            LS+V+                     +Y QD Y       K+ L  + A   L ++E   
Sbjct: 1257 LSEVIDSVSVTETTTSQSRSYVISMKFYEQDEYNEEYDISKEELQNVVANNFLTSLEIAI 1316

Query: 1193 ----KLQLELTIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKE 1248
                K Q + T  D+ +AI +A   +++ A V  +    +  N   +  K    + S  E
Sbjct: 1317 HKEIKKQKKTTASDVGIAIPKA---QLALAAVEGLSSKVMEDNDEEQSRKKTKQAVSYDE 1373

Query: 1249 PSENAV 1254
            P E+ +
Sbjct: 1374 PDEDEI 1379

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 91/171 (53%), Gaps = 12/171 (7%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLR------DVMTTDGVIGSKTKTNHILEIFN 1322
            VV+ +P+I R V    ++GKR L+ EG   +      D +  DG+      +N +  +  
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGIT-----SNDVSSVLK 1535

Query: 1323 VLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1382
              G+EAAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1536 TYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLM 1595

Query: 1383 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTS 1433
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTG+F V+   S
Sbjct: 1596 KM-SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVLAKAS 1645

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++FS LSA +I   S  +I+   + D  N   P  GG  D  +G    +  CSTC 
Sbjct: 10  EITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLK 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  438 bits (1127), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 317/976 (32%), Positives = 493/976 (50%), Gaps = 114/976 (11%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGK 358
              +  ++ +  N +M  +  +Q  V  +I+S          +S G   PI G  Q L+ K
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTKAQ------SSSGNKVPIPGLKQALEKK 463

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418
            +G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q V
Sbjct: 464  EGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQAV 523

Query: 419  INGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNL---QYGDV-------VERHI 464
            INGP+  PGA  +  +N+D        +    R  LA  L      DV       V RHI
Sbjct: 524  INGPDKWPGATQI--QNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYRHI 581

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTE 523
            ++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E
Sbjct: 582  KNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 641

Query: 524  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM-- 581
             A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +     
Sbjct: 642  NAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIR 701

Query: 582  -SDGNM---QFDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFMPPKH 636
              DG+    +    PPAVMKP  LWTGKQ+ + +L+     +   IN+++KNK+    ++
Sbjct: 702  PEDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI--KNEY 759

Query: 637  KGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMA 696
             G  +E    +  VV +  ++L G++DKS  G   K  + +++   YGP  AA  ++ + 
Sbjct: 760  WGKSSE----ENNVVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSVLG 814

Query: 697  KLCARYLGNRGFSIGISDVTPGA-------DLKQKKEDKVEEAYAKCDELIDQF--NKGK 747
            +L   Y+    F+ G+ D+   A       D+ Q   D    A A+   L      + G+
Sbjct: 815  RLFTNYITATAFTCGMDDLRLTAEGNKWRNDILQTSVDIGRVAAAEVTNLDKDVKSDDGE 874

Query: 748  L-----ETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCGSK 798
            L     E     N+   L+A     ++ +  +V   C+ +      P      MA  G+K
Sbjct: 875  LLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALSGAK 934

Query: 799  GSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPE 858
            GS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P E
Sbjct: 935  GSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIRPQE 994

Query: 859  FLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDG 918
            + FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD 
Sbjct: 995  YYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLYGGDA 1054

Query: 919  LDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLEQKLVRFDNL 978
            +D   +   +    F    D+ + +   +    L+ +  +E   S LK  ++ L      
Sbjct: 1055 VD---ITKESHMTEFKFCVDNYDALLKKYNPSALVDHLDVE---SALKYSKKTLK----- 1103

Query: 979  GNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLLDEPAPELK 1038
                N++   K+     H A+ + Y  +          L+K   +K L  + +       
Sbjct: 1104 ----NRKKNSKLP----HYAQTSKYDPV----------LSKFNPSKYLGAVSE------- 1138

Query: 1039 ILNLDEQYPEYILTAVNQLCKISKNLVET-FLGIAISKYHRAKVEPGTAVGAIGAQSIGE 1097
              N  ++  ++I T  +   K  +N+ E  F  +   KY R+ + PG AVG I +QS+GE
Sbjct: 1139 --NFQDKLEKFISTN-DDFFKKDENVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGE 1195

Query: 1098 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDERAARVVK 1156
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D  +  A    
Sbjct: 1196 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTMPIRDDVSDELADTFC 1255

Query: 1157 GRIEKTILSDVVYYIQ 1172
              I K +LS+V+  +Q
Sbjct: 1256 KNITKVMLSEVIDKVQ 1271

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            +++ +P I R V    ++GKR L+ EG   + +   D  I  +  ++N +  +    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    + + ++  S  I++G+   +GTGSF ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 12/134 (8%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++FS L++ +I   S  +++   + D  N   P  GG  D  +G    +  C+TC 
Sbjct: 10  EITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR--- 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR   
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQ 126

Query: 129 ------RPGVDNLR 136
                 R  +DN+R
Sbjct: 127 YALIDERYQIDNIR 140

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  438 bits (1126), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 318/980 (32%), Positives = 492/980 (50%), Gaps = 126/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G + GK  PI G  Q L+
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PIPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNL----------QYGDVVER 462
             VINGP+  PGA  +  +N+D        +    R  LA  L               V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVYR 579

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 582  ---SDGNMQFD---LPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVI--INVDAKNKVFMP 633
                DG+   +     PPA+ KP+ LWTGKQ+ + ++  N   P +  IN+ + NK+   
Sbjct: 700  IRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISTNKIKNE 758

Query: 634  PKHKG-LPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAM 692
               KG L NE+   DG        +L G++DKS  G   K+ + +++   YGP+ AA  +
Sbjct: 759  YWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVL 810

Query: 693  NRMAKLCARYLGNRGFSIGISDVTPGA-------DLKQKKEDKVEEAYAKCDELID---- 741
            + + +L   Y+    F+ G+ D+   A       D+ +   D   +A A+   L      
Sbjct: 811  SVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLNKDTPA 870

Query: 742  ---QFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMAT 794
               +  K   E     N+   L+A     ++ +  +V   C+ +      P      MA 
Sbjct: 871  DDAELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMAL 930

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+
Sbjct: 931  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGI 990

Query: 855  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 914
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF Y
Sbjct: 991  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMY 1050

Query: 915  GGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLL----PYQIIENTNSILKPLEQ 970
            GGD +D   +   +    F    D+          + LL    P  +IE+ +     +E 
Sbjct: 1051 GGDAVD---ITKESHMTQFEFCLDNY---------YALLKKYNPSALIEHLD-----VES 1093

Query: 971  KLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLL 1030
             L           K  ++ ++Y  +H  E ++ Q+++         LAK   AK L ++ 
Sbjct: 1094 AL-----------KYSKKTLKYRKKHSKEPHYKQAVK-----YDPVLAKYNPAKYLGSVS 1137

Query: 1031 DEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVET-FLGIAISKYHRAKVEPGTAVGA 1089
            +    +L          E  L   ++L K +  + E  F  +   KY R+ + PG AVG 
Sbjct: 1138 ENFQDKL----------ESFLDKNSKLFKSADGVNEKKFRALMQLKYMRSLINPGEAVGI 1187

Query: 1090 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGD 1148
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +D  
Sbjct: 1188 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMTLPIWDDVS 1247

Query: 1149 ERAARVVKGRIEKTILSDVV 1168
            +  A      I K +LS+V+
Sbjct: 1248 DEQADTFCKSISKVLLSEVI 1267

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            +++ +P I R V    ++GKR L+ EG   + +   +  I      +N +  +    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR ++V EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  L+A +I   S  +I+   + D  N   P  GG  D  +G    +  CSTC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  436 bits (1122), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 317/979 (32%), Positives = 488/979 (49%), Gaps = 124/979 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI           
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
              K  +E K +  N +M  +  +Q  V  +I+S         G +GGK  PI G  Q L+
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GNTGGKV-PIPGVKQALE 456

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 457  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 516

Query: 417  LVINGPNIHPGANYLLKKNDDARRNLRYG----DRMKLAKNL----------QYGDVVER 462
             VINGP+  PGA  +  +N+D       G     R  LA  L               V R
Sbjct: 517  AVINGPDKWPGATQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKVYR 574

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 575  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 634

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R    Q +   
Sbjct: 635  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIYGC 694

Query: 582  ---SDGNM---QFDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFMPP 634
                DG+    +    PPAV KP  LWTGKQ+ + +L+         IN+ +KNK+    
Sbjct: 695  IRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI---- 750

Query: 635  KHKGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNR 694
            K++      + ND  VV +  E+L G++DKS  G   K+ + +++   YGP  +A  ++ 
Sbjct: 751  KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVLSV 807

Query: 695  MAKLCARYLGNRGFSIGISDVTPG-------ADLKQKKEDKVEEAYAKCDELIDQFNKGK 747
            + +L   Y+    F+ G+ D+          +D+ +   D    A A+   L    +   
Sbjct: 808  LGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSAND 867

Query: 748  LETQPGCNEEQTLEAKIGGL-------LSKVREEVGEVCI-----RELDNLNAPLIMATC 795
             E      E    + K+G L       ++ +  +V   C+     ++  N N+   MA  
Sbjct: 868  SELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSMQAMALS 926

Query: 796  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLS 855
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ 
Sbjct: 927  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIK 986

Query: 856  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYG 915
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YG
Sbjct: 987  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLYG 1046

Query: 916  GDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLEQKLVRF 975
            GD +D +  E +     F                         +N +++LK      +  
Sbjct: 1047 GDAVD-VTQESHMTQFKF-----------------------CADNYDALLKKYNPAAL-- 1080

Query: 976  DNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDY-MTEKATHLAKIRKAKGLKTLLDEPA 1034
                          IE++D   A +   ++L+    TEK  H ++  K   + +  +   
Sbjct: 1081 --------------IEHLDVESALKYSKKALKHRKKTEKVPHYSQKVKYDPVVSKFN--- 1123

Query: 1035 PELKILNLDEQYP---EYILTAVNQLCKISKNLVE-TFLGIAISKYHRAKVEPGTAVGAI 1090
            P   + ++ E +    E  + + N L K    + E  F  +   KY R+ + PG AVG I
Sbjct: 1124 PSKYLGSVSENFQDKLESFIDSNNDLFKSRDTVSEKKFRALMQLKYMRSLINPGEAVGII 1183

Query: 1091 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDE 1149
             +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  +
Sbjct: 1184 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVTD 1243

Query: 1150 RAARVVKGRIEKTILSDVV 1168
              A      + K +LS+VV
Sbjct: 1244 PQADTFCKSVTKVMLSEVV 1262

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            V++ + +I R V    ++GKR L+ EG   +++   D  I  +   +N +  +    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 13/139 (9%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  ++A DI   S ++I+   + D  N   P  GG  D  +G    +  C+TC 
Sbjct: 10  EITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELRRPG 131
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +L+   
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK--- 123

Query: 132 VDNLRRMGTLKKILDQCKK 150
              L + G    ++D+C K
Sbjct: 124 ---LLQYG----LIDECYK 135

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  434 bits (1117), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 305/974 (31%), Positives = 488/974 (50%), Gaps = 114/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 305  KG--------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
            K         +  + +M  +  +Q  V  +I+S         G +GGK  PI G  Q L+
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GNTGGKV-PIPGVKQALE 456

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 457  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 516

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNLQ----------YGDVVER 462
             VINGP+  PGA+ +  +N+D        +    R  LA  L               V R
Sbjct: 517  AVINGPDKWPGASQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLNKKVYR 574

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 575  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 634

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLL--- 578
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +   
Sbjct: 635  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 694

Query: 579  ---SMMSDGNMQFDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFMPP 634
                       +    PPAV KP  LWTGKQ+ + +L+         IN+++ NK+    
Sbjct: 695  IRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI---- 750

Query: 635  KHKGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNR 694
            K++   N  + ND  V+ +  E+L G++DKS  G   K+ + +++   YGP  AA  ++ 
Sbjct: 751  KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVLSV 807

Query: 695  MAKLCARYLGNRGFSIGISDVTPGADLKQKKEDKVEEAY-----AKCD------------ 737
            + +L   Y+    F+ G+ D+    +  + ++D ++ +      A C+            
Sbjct: 808  LGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACEVTNLEKETASDD 867

Query: 738  -ELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPLIMATCG 796
             EL+ +  +   +       +    +K+  + SKV  +       +    N+   MA  G
Sbjct: 868  SELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSG 927

Query: 797  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P
Sbjct: 928  AKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKP 987

Query: 857  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGG 916
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGG
Sbjct: 988  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLYGG 1047

Query: 917  DGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLEQKLVRFD 976
            D +D                  H     F  +++  L  +   N +++++ L+ +     
Sbjct: 1048 DSVDVT-------------KESHLTQFEFCLENYDSLLKKY--NPSALIEHLDVETALKY 1092

Query: 977  NLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLLDEPAPE 1036
            +     +++   K+ + +Q+               +    LAK   AK L  + ++   +
Sbjct: 1093 SKKASKSRKKNRKVPHYEQN--------------IKYDPALAKFNPAKYLGAVSEKFQDK 1138

Query: 1037 LKILNLDEQYPEYILTAVNQLCKISKNLVET-FLGIAISKYHRAKVEPGTAVGAIGAQSI 1095
            L          E  L +   L +  K++ E  F  +   KY R+ + PG +VG I +QS+
Sbjct: 1139 L----------ELFLDSNASLFESDKSVNEKKFRALMQLKYMRSLINPGESVGIIASQSV 1188

Query: 1096 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDERAARV 1154
            GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +  A V
Sbjct: 1189 GEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDDQADV 1248

Query: 1155 VKGRIEKTILSDVV 1168
                I K +LS+V+
Sbjct: 1249 FSKSISKVLLSEVI 1262

 Score = 89.0 bits (219), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            V++ +P I R V    ++GKR L+ EG   + +   +  IG     +N +  +    G+E
Sbjct: 1489 VIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGVE 1548

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1549 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1607

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1608 ETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++FS L+A +I   S  +I+   + D  N   P  GG  D  +G    +  CSTC 
Sbjct: 10  EITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  434 bits (1117), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 318/968 (32%), Positives = 482/968 (49%), Gaps = 126/968 (13%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG-ISINN---- 311
            PP   R PS +  +   ++++ L   L++I+ T+ LI+      + L+K  +S+++    
Sbjct: 366  PPTRFRLPSKLGDEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRVI 422

Query: 312  ---MMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFRGNLSG 368
               +M  +  +Q  V  +I+S         G +GGK  PI G  Q L+ K+G FR ++ G
Sbjct: 423  FSRLMNAFVTIQNDVNAFIDSTKAQ-----GTTGGKV-PIPGVKQALEKKEGLFRKHMMG 476

Query: 369  KRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPNIHPGA 428
            KRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q VINGP+  PGA
Sbjct: 477  KRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPGA 536

Query: 429  NYLLKKNDDARR----NLRYGDRMKLAKNLQ----------YGDVVERHIEDGDVVLFNR 474
              +  +N+D        +    R  LA  L               V RHI++ D+V+ NR
Sbjct: 537  AQI--QNEDGSLVSLVGMSAEQRKALANQLMTPSSNVGTHTLNKKVYRHIKNRDIVIMNR 594

Query: 475  QPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 533
            QP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL 
Sbjct: 595  QPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLA 654

Query: 534  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM---SDGNM---Q 587
               +  LTP SG P+    QD I+    ++ KDSFF R    Q +       DG+    +
Sbjct: 655  NTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRPK 714

Query: 588  FDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEM--- 643
                PP + KP  LWTGKQ+ S +L+         IN+ + NK+          NE    
Sbjct: 715  LITLPPTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI---------KNEYWGK 765

Query: 644  SVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYL 703
            S N+  V+ +  E+L G++DKS  G   K  + +++   YGP  AA  ++ + +L   Y+
Sbjct: 766  SSNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSVLGRLFTNYI 824

Query: 704  GNRGFSIGISDVTPG-------ADLKQKKEDKVEEAYAKCDELID-------QFNKGKLE 749
             +  F+ G+ D+          +D+ +   D   EA A+   L         +  K   E
Sbjct: 825  MSTAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTAADDAELLKRLEE 884

Query: 750  TQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCGSKGSTLNVS 805
                 N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +NVS
Sbjct: 885  ILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKGSNVNVS 944

Query: 806  QMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAIS 865
            Q++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ FH ++
Sbjct: 945  QIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKPQEYYFHCMA 1004

Query: 866  GREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLDME 925
            GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D +  E
Sbjct: 1005 GREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD-VTKE 1063

Query: 926  GNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLEQKLVRFDNLGNKLNKE 985
             +                  T  DF L  Y                    D L NK N  
Sbjct: 1064 SH-----------------MTEFDFCLDNY--------------------DALLNKYNP- 1085

Query: 986  DEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLLDEPAPELKILNLDEQ 1045
                IE++D   A +   ++L++   +K    A  + A     +L +  P   + ++ E+
Sbjct: 1086 -SALIEHLDVETALKYSKKTLKN--RKKHAKEAHHKNATKYDPVLSKFNPAKYLGSVSEK 1142

Query: 1046 YP---EYILTAVNQLCKISKNLVE-TFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQ 1101
            +    E  L   ++L K   N+ E  F  +   KY R+ + PG AVG I +QS+GEP TQ
Sbjct: 1143 FQDKLESYLDKNSKLFKSHDNVSEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQ 1202

Query: 1102 MTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDERAARVVKGRIE 1160
            MTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +  D  +  A      I 
Sbjct: 1203 MTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWQDVSDEQADTFCKSIS 1262

Query: 1161 KTILSDVV 1168
            K +LS+V+
Sbjct: 1263 KVVLSEVI 1270

 Score = 89.4 bits (220), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            +++ +P I R V    ++GKR L+ EG     +   +  I      +N +  +    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  L++ +I   S  +I+   + D  N   P  GG  D  +G    +  CS+C 
Sbjct: 10  EITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C  + L   +  +F  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  432 bits (1111), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 309/978 (31%), Positives = 490/978 (50%), Gaps = 122/978 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+      + ++
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 305  KG-ISINN-------MMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
            K  +S+++       +M  +  +Q  V  +I+S         G++  K  P+ G  Q L+
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GSASSKI-PVPGVKQALE 460

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 461  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQ 520

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNLQ----------YGDVVER 462
             VINGP+  PGA+ +  +N+D        +    R  LA  L               V R
Sbjct: 521  AVINGPDKWPGASQI--QNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYR 578

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 579  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 638

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLL--- 578
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +   
Sbjct: 639  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGC 698

Query: 579  -----SMMSDGNMQFDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFM 632
                    S G +     PPAV+KP  LWTGKQ+ S +L+         IN+++ NK+  
Sbjct: 699  IRPEHGHASRGKIV--TMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI-- 754

Query: 633  PPKHKGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAM 692
              K++      + ND  V+ +  E++ G++DKS  G   K+ + +++   YGP+ AA  +
Sbjct: 755  --KNEYWGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVL 809

Query: 693  NRMAKLCARYLGNRGFSIGISDVTPGADLKQKKEDKVE-------EAYAKCDELID---- 741
            + + +L   Y+    F+ G+ D+   A+  + + + ++       +A A+   L      
Sbjct: 810  SVLGRLFTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPS 869

Query: 742  ---QFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMAT 794
               +  K   E     N+   L+A     ++ V  +V   C+ +      P      MA 
Sbjct: 870  DDVELLKRLEEILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMAL 929

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 930  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGI 989

Query: 855  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 914
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF Y
Sbjct: 990  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFLY 1049

Query: 915  GGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLEQKLVR 974
            GGD +D +  E +    +F R                       EN +++LK       +
Sbjct: 1050 GGDAVD-VTKESHMTQFDFCR-----------------------ENYDALLK-------K 1078

Query: 975  FDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATH---LAKIRKAKGLKTLLD 1031
            ++ +    + + E  ++Y  +    R        Y  +K  +   LAK   AK L ++ +
Sbjct: 1079 YNPVALAEHLDVETALQYSKKVSKNRKKNSKTAHY-EQKVKYDPVLAKYNPAKYLGSVSE 1137

Query: 1032 EPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIG 1091
            +           ++   Y+     +         + F  +   KY R+ + PG AVG I 
Sbjct: 1138 K---------FHDKLESYLEDKAKEFKSRESVSAKRFRALMQLKYMRSLINPGEAVGIIA 1188

Query: 1092 AQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDER 1150
            +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D  + 
Sbjct: 1189 SQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVSDE 1248

Query: 1151 AARVVKGRIEKTILSDVV 1168
             A +    I K +LS+VV
Sbjct: 1249 QADLFCKSISKVVLSEVV 1266

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKT-NHILEIFNVLGIE 1327
            V++ +P I R V +   + KR L+ EG   + +   +  I     T N +  +    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ +E  S  I+LG+  ++GTGSF ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  L+F+ L+  DI   S  +I+   + D  N   P  GG  D  +G    +  CSTC 
Sbjct: 10  EITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  432 bits (1110), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 300/912 (32%), Positives = 462/912 (50%), Gaps = 106/912 (11%)

Query: 304  EKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQGRFR 363
            ++ I  + +M  +  +Q  V  +I+S         G +GGK  PI G  Q L+ K+G FR
Sbjct: 423  DRRIIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GTAGGKL-PIPGVKQALEKKEGLFR 476

Query: 364  GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVINGPN 423
             ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q VINGP+
Sbjct: 477  KHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPD 536

Query: 424  IHPGANYLLKKNDDARR----NLRYGDRMKLAKNLQ----------YGDVVERHIEDGDV 469
              PGA  +  +N+D        +    R  LA  L               V RHI++ D+
Sbjct: 537  KWPGATQI--QNEDGSLVSLIGMSTEQRKALANQLMTPSSNITTHTLNKKVYRHIKNRDI 594

Query: 470  VLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAE 528
            V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAE
Sbjct: 595  VIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAE 654

Query: 529  AINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM---SDGN 585
            A NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +       DG+
Sbjct: 655  ASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGH 714

Query: 586  M---QFDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFMPPKHKGLPN 641
                +    PP + KP  LWTGKQ+ S +L+     +   IN+ + NK+    ++ G  +
Sbjct: 715  ATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITPANMPGINLKSSNKI--KNEYWGTGS 772

Query: 642  EMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCAR 701
            +    +  V+ +  E+L G++DKS  G   K  + +++   YGP  AA  ++ + +L   
Sbjct: 773  Q----ENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVAAKVLSVLGRLFTN 827

Query: 702  YLGNRGFSIGISDVTPG-------ADLKQKKEDKVEEAYAKCDELID-------QFNKGK 747
            Y+ +  F+ G+ D+          +D+ +   D   EA A+   L         +  K  
Sbjct: 828  YIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTPANDPELLKRL 887

Query: 748  LETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCGSKGSTLN 803
             E     N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +N
Sbjct: 888  QEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKGSNVN 947

Query: 804  VSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHA 863
            VSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH 
Sbjct: 948  VSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHC 1007

Query: 864  ISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLD 923
            ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YGGD +D + 
Sbjct: 1008 MAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLIQFLYGGDAVD-VT 1066

Query: 924  MEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLEQKLVRFDNLGNKLN 983
             E +                  T  DF L  Y                    D L NK N
Sbjct: 1067 KESH-----------------MTEFDFCLDNY--------------------DALLNKYN 1089

Query: 984  KEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLK--TLLDEPAPELKILN 1041
                  IE++D   A +   +SL++    +  H+ +    + +K   +L +  P   + +
Sbjct: 1090 P--SALIEHLDVESALKYSKKSLKN----RKKHIKEPHYKQNIKYDPVLSKFNPAKYLGS 1143

Query: 1042 LDEQYPEYILTAVNQLCKISKNL----VETFLGIAISKYHRAKVEPGTAVGAIGAQSIGE 1097
            + E++ + +   +++  K+ K+      + F  +   KY R+ + PG AVG I +QS+GE
Sbjct: 1144 VSEKFQDKLEGYLDKNSKLFKSHDSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGE 1203

Query: 1098 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDERAARVVK 1156
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ND  +  A    
Sbjct: 1204 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDEQADTFC 1263

Query: 1157 GRIEKTILSDVV 1168
              I K +LS+V+
Sbjct: 1264 KSISKVVLSEVI 1275

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            +++ +P I R +    ++GKR L+ EG     +   +  I      +N +  +    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  L++ +I   S  +I+   + D  N   P  GG  D  +G    +  CSTC 
Sbjct: 10  EITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  +F ++LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  426 bits (1096), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 308/975 (31%), Positives = 486/975 (49%), Gaps = 116/975 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G +GG    I G  Q L+
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ-----GNTGG-NDVIPGVKQALE 463

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 464  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAELRQ 523

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNLQ----------YGDVVER 462
             VINGP+  PGA  +  +N+D        +    R  LA  L               V R
Sbjct: 524  AVINGPDKWPGA--IQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKVYR 581

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 582  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 641

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E ARAE++ L    +  LTP SG P+    QD I+    +++KDSFF R    Q +   
Sbjct: 642  NENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGC 701

Query: 582  ---SDGNM---QFDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFMPP 634
                DG+    +    PP + KP  LWTGKQ+ + +L+         IN+ +KNK+    
Sbjct: 702  IRPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKNKIKNEY 761

Query: 635  KHKGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNR 694
              KG       N+  V+ +   +L G++DK+  G  K + + +++   YGP  AA  ++ 
Sbjct: 762  WGKG------SNENEVIFKDGALLCGILDKNQYGSSK-YGIVHSLHELYGPDVAAKVLSV 814

Query: 695  MAKLCARYLGNRGFSIGISDVTPG-------ADLKQKKEDKVEEAYAKCDELID------ 741
            + +L   Y+    F+ G+ D+           D+ +   D   +A A+   L        
Sbjct: 815  LGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSKDTPADD 874

Query: 742  -QFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI----RELDNLNAPLIMATCG 796
             +  K   E     N+   L+A     ++ +  +V   C+     +    N+   MA  G
Sbjct: 875  PELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQAMALSG 934

Query: 797  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P
Sbjct: 935  AKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKP 994

Query: 857  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGG 916
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F YGG
Sbjct: 995  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIEFLYGG 1054

Query: 917  DGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLE-QKLVRF 975
            D +D +  E       F                        +EN + ++K      L+  
Sbjct: 1055 DAVD-VTKESYMTQFKF-----------------------CLENYDGLVKKYNPSALIEH 1090

Query: 976  DNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLLDEPAP 1035
             N+ + L K  ++ ++Y  +H +  ++ Q+     ++    LAK   +K L ++ ++   
Sbjct: 1091 LNVESAL-KYSKKALKYRKKHSSVPHYLQN-----SKYDPVLAKYNPSKYLGSVSEKFQD 1144

Query: 1036 ELKILNLDEQYPEYILTAVNQLCKISKNLVET-FLGIAISKYHRAKVEPGTAVGAIGAQS 1094
            +L          E  L   ++L K ++ + E  F  +   KY R+ ++PG +VG I +QS
Sbjct: 1145 KL----------EEFLNENSKLVKSTEGVNEKKFRALMQLKYMRSLIDPGESVGIIASQS 1194

Query: 1095 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGDERAAR 1153
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +N  ++ND   + A 
Sbjct: 1195 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMNLPILNDVSNQQAE 1254

Query: 1154 VVKGRIEKTILSDVV 1168
                 I K +LS V 
Sbjct: 1255 TFCKSITKVLLSQVT 1269

 Score = 95.9 bits (237), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 88/166 (53%), Gaps = 2/166 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            V++ +P+I R V    ++G R L+ EG   + +   D  I   K  +N +  +    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EID   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTS 1433
            E T   L  A    + + +   S  I+LG+  ++GTGSF ++   S
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDILAKAS 1656

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++F  LS+  I   S  +I+   + D  N   P  GG  D  +G    +  CSTC 
Sbjct: 10  EITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   D   +  +L+
Sbjct: 67  QDEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  416 bits (1068), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 313/983 (31%), Positives = 485/983 (49%), Gaps = 132/983 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 305  KG--------ISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
            K         +  N +M  +  +Q  V  +I+          G +GGK  PI G  Q L+
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFIDVTKAQ-----GNTGGKV-PIPGVKQALE 450

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 451  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQ 510

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNLQYGDV----------VER 462
             VINGP+  PGA  +  +N+D        +    R  LA  L               V R
Sbjct: 511  AVINGPDKWPGATQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKVYR 568

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 569  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 628

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R    Q +   
Sbjct: 629  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 688

Query: 582  ---SDGNM---QFDLPPPAVMKPHYLWTGKQVFSLLIRPNKKSPVI--INVDAKNKVFMP 633
                DG+    +    PPAV+KP  LWTGKQ+ + ++  N   P +  IN+ +KNK+   
Sbjct: 689  IRPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLL-NSTPPEMPGINLISKNKIKNE 747

Query: 634  PKHKGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMN 693
               +G       N+  V+ +  E+L G++DKS  G   K  + +++   YGP  A   ++
Sbjct: 748  YWGEG------SNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKVLS 800

Query: 694  RMAKLCARYLGNRGFSIGISD--------------VTPGADLKQKKEDKVE--EAYAKCD 737
             + +L   Y+    F+ G+ D              +    D+ +    +V   E   K D
Sbjct: 801  VLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVKAD 860

Query: 738  --ELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----I 791
              EL+ +      E     N+   L+A     ++ +  +V   C+ +      P      
Sbjct: 861  DPELLKRLE----EILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQA 916

Query: 792  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 851
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+
Sbjct: 917  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFY 976

Query: 852  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQ 911
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++Q
Sbjct: 977  SGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQ 1036

Query: 912  FTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLEQK 971
            F YGGD +D +  E +     F                        ++N +++LK     
Sbjct: 1037 FLYGGDAVD-VTKESHMTEFKF-----------------------CVDNYDALLKKYNPS 1072

Query: 972  LVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDY-MTEKATHLAKIRKAKGLKTLL 1030
             +                IE++D   A +   +++++    EK  H A   K      +L
Sbjct: 1073 AL----------------IEHLDVESALKYSKKAMKNRKKNEKIPHYAHNIK---YDPVL 1113

Query: 1031 DEPAPELKILNLDEQYP---EYILTAVNQLCKISKNLVE-TFLGIAISKYHRAKVEPGTA 1086
             +  P   + ++ E +    E  + + ++L K   N+ E  F  +   KY R+ + PG A
Sbjct: 1114 SKYNPSKYLGSVSENFQDKLEKFIDSNSKLLKSKDNVNEKKFRALMQLKYMRSLINPGEA 1173

Query: 1087 VGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVN 1145
            VG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ 
Sbjct: 1174 VGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILP 1233

Query: 1146 DGDERAARVVKGRIEKTILSDVV 1168
            D  +  A      I K +LS+V+
Sbjct: 1234 DVTDDQADTFCKSITKVMLSEVI 1256

 Score = 89.0 bits (219), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            V+  +P+I R V    ++GKR L+ EG   + +   +  I  +   +N +  +    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ ++  S  I++G+   +GTGSF ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++FS L+A +I   S  +I+   + D  N   P  GG  D  +G    +  C+TC 
Sbjct: 10  EIISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  414 bits (1065), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 308/980 (31%), Positives = 485/980 (49%), Gaps = 126/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLK 356
              K  LE + I  N +M  +  +Q  V  +I+S         G++GGK  PI G  Q L+
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GSTGGKV-PIPGVKQALE 441

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +++Q
Sbjct: 442  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEMRQ 501

Query: 417  LVINGPNIHPGANYLLKKNDDARR----NLRYGDRMKLAKNLQ----YGDV------VER 462
             VINGP+  PGA  +  +N+D        +    R  LA  L     +G        V R
Sbjct: 502  AVINGPDKWPGATQI--QNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKVYR 559

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 560  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 619

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMM 581
             E AR+EA  L    +  LTP SG P+    QD I+    +++KDSFF R    Q +   
Sbjct: 620  NENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGC 679

Query: 582  ---SDGNM---QFDLPPPAVMKPHYLWTGKQVFS-LLIRPNKKSPVIINVDAKNKVFMPP 634
                DG+    +    PPAV+KP  LWTGKQ+ + +L+         IN+ +KNK+    
Sbjct: 680  IRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI---- 735

Query: 635  KHKGLPNEM---SVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAASA 691
                  NE    S  +  V+ +   +L G++DKS  G   K+ + +++   YGP  ++  
Sbjct: 736  -----KNEYWGKSSYENEVIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKV 789

Query: 692  MNRMAKLCARYLGNRGFSIGISDVTPG-------ADLKQKKEDKVEEAYAKCDELIDQFN 744
            ++ + +L   Y+ +  F+ G+ D+           D+ +K  D    A A+   L     
Sbjct: 790  LSILGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVR 849

Query: 745  KGKLETQPGCNEEQTLEAKIGGL----LSKVREEVGEVCIRELDN-------LNAPLIMA 793
                E      E    + K+G L     SKV     EV  + + +        N+   MA
Sbjct: 850  PDDAELLKRLEEILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMA 909

Query: 794  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 853
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG
Sbjct: 910  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSG 969

Query: 854  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 913
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF 
Sbjct: 970  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFL 1029

Query: 914  YGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIENTNSILKPLEQKLV 973
            YGGD +D +  E +     F                        ++N +++LK      +
Sbjct: 1030 YGGDAID-VTKESHMSEFKF-----------------------CVDNYDALLKRYNPSAL 1065

Query: 974  RFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLLDEP 1033
                            I+++D   A +   +++++   +K  +L    +      +L + 
Sbjct: 1066 ----------------IQHLDVESALKYSKKAMKN--RKKNLNLPHYARHDKYDPVLSKY 1107

Query: 1034 APELKILNLDEQYPEYILTAVNQLCKISKNLV----ETFLGIAISKYHRAKVEPGTAVGA 1089
             P   + ++ E + + + + ++    + K       + F  +   KY R+ + PG AVG 
Sbjct: 1108 NPSKFLGSVSENFQDKLESFIDSNASLFKGQATVNEKKFRALMQLKYMRSLINPGEAVGI 1167

Query: 1090 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDGD 1148
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  
Sbjct: 1168 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVT 1227

Query: 1149 ERAARVVKGRIEKTILSDVV 1168
            +  A +      K ILS+V+
Sbjct: 1228 DETADIFCKNTTKVILSEVI 1247

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1269 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEIFNVLGIE 1327
            V+K +P+I R V    ++GKR L+ EG   + +   +  I  +   +N +  +    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1328 AARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ ++  S  ++LG+  S+GTG+F ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTCH 71
           +I  ++FS +SA++I A S  +I+   + D  +   P  GG  D  +G    +  C+TC 
Sbjct: 10  EISSVDFSVMSAAEIRALSVKQITNPTVLD--HLGHPIRGGLYDLSLGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELR 128
            +   C GH GHI+L +P +   +F      L+  C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 121/283 (42%), Gaps = 24/283 (8%)

Query: 11  KKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGVSSSHAECSTC 70
           + IK ++F   S  ++ A S  +I   +  D    R  K+GG  D ++G    + +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNVKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDKRQFLAELRRP 130
              +  C GHFGHI LA PVFH+G+     ++ + VC +C  +LL + +++   A   + 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQMNQAIKIKD 130

Query: 131 GVDNLRRMGTLKKILDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGKKS 190
                  + TL      CK +   + C                        T R  G   
Sbjct: 131 PKKRFNAVWTL------CKTK---MICETDVPSEDDPTKLVSRGGCGNAQPTIRKDGL-- 179

Query: 191 APEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCELLGIDSAVKS 250
                K VG WK+    N   E   +     L+  + LN+FK +  ED   LG +     
Sbjct: 180 -----KLVGSWKKDKNTNDGDEPEQRV----LSTEEILNIFKHISSEDYIRLGFNEEF-- 228

Query: 251 GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIV 293
            RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+
Sbjct: 229 ARPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADIL 270

>KAFR0A01450 Chr1 (286034..289384) [3351 bp, 1116 aa] {ON} Anc_1.274
           YJL092W
          Length = 1116

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 9/99 (9%)

Query: 637 KGLPNEMSVNDGFVVIRGSEILSGVMDKSVLGDGKKHSVFYTIL--RDYGPQEAASAMNR 694
           K LPN  S ND  +++R    +  +    +     +H + Y I+  R +   +  SAM  
Sbjct: 373 KALPNLFSYNDFSILVRQRRQIKNIETALI-----EHRIPYKIVKGRAFWELKEISAMMH 427

Query: 695 MAKLCARYLGNRGFSIGISDVTPGADLKQKKEDKVEEAY 733
           + K CA Y  N  FSI  S + P   L Q   DK+++ +
Sbjct: 428 LIK-CA-YSDNEKFSILSSLLYPAKGLGQTSADKIKKIF 464

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 339 GASGGK-TKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAV 392
           G+SG K + PIR F  + K  QGRF  N++ + VD        P P   +D V V
Sbjct: 227 GSSGTKGSLPIRLFTAKGKSHQGRFAMNVTRRVVDLFSELFEIPYPLPKLDIVCV 281

>CAGL0F07381g Chr6 complement(719330..720934) [1605 bp, 534 aa] {ON}
            highly similar to uniprot|P53040 Saccharomyces cerevisiae
            YGL112c TAF60 TFIID and SAGA subunit
          Length = 534

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 14/105 (13%)

Query: 940  ANNITFTHKDFGLLP------YQIIENTNSILKPLEQKL-------VRFDNLGNKLNKED 986
            A  IT    D  LL       Y ++ NT+  L P    L       +    LG    K+D
Sbjct: 297  AEQITHNLSDLELLGTILEMMYSLLSNTSIFLDPYIHSLMPSVLTLLLTKRLGGTPEKDD 356

Query: 987  E-EKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLL 1030
            E   +E++++ +A R+F  SL D++  K   + K  K +  +TLL
Sbjct: 357  EASAVEFLEKTNAVRDFAASLLDHILRKFPQVYKSLKPRVTRTLL 401

>CAGL0F07249g Chr6 (705576..707186) [1611 bp, 536 aa] {ON} highly
            similar to uniprot|P53040 Saccharomyces cerevisiae
            YGL112c TAF60 TFIID and SAGA subunit
          Length = 536

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 14/105 (13%)

Query: 940  ANNITFTHKDFGLLP------YQIIENTNSILKPLEQKL-------VRFDNLGNKLNKED 986
            A  IT    D  LL       Y ++ NT+  L P    L       +    LG    K+D
Sbjct: 298  AEQITHNLSDLELLGTILEMMYSLLSNTSIFLDPYIHSLMPSVLTLLLAKRLGGTPEKDD 357

Query: 987  E-EKIEYIDQHDAERNFYQSLRDYMTEKATHLAKIRKAKGLKTLL 1030
            E   +E++++ +A R+F  SL D++  K   + K  K +  +TLL
Sbjct: 358  EASAVEFLEKTNAVRDFAASLLDHILRKFPQVYKSLKPRVTRTLL 402

>KLLA0E16369g Chr5 complement(1464299..1465279) [981 bp, 326 aa] {ON}
            similar to uniprot|P42941 Saccharomyces cerevisiae
            YGR208W SER2 phosphoserine phosphatase
          Length = 326

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 69/151 (45%), Gaps = 24/151 (15%)

Query: 999  ERNFYQSLRDYMTEKATHLAKIRKAKGLKT--LLDEPAPELKILNLDEQYPEYILTAVNQ 1056
            E +F QSLR+          +++  KG++T  L DE  P L++    +  PE      +Q
Sbjct: 143  EIDFCQSLRE----------RVKLLKGIQTRHLYDEIKPRLRVT---KGVPELSRALKSQ 189

Query: 1057 LCKISKNLVETFLGIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMN 1116
             CK++   V +   I  + Y + K+    A+       + + GT+         G A  +
Sbjct: 190  GCKLA---VLSGGFIPFANYIKEKLNFDFALANTLGVEVSDDGTE------QLNGEALGD 240

Query: 1117 VTLGVPRIKEIINASKVISTPIINAVLVNDG 1147
            +  GV + K ++  ++  ++PI + V+V DG
Sbjct: 241  IVDGVRKAKTLVALAEQYNSPIESTVMVGDG 271

>YOR236W Chr15 (780906..781541) [636 bp, 211 aa] {ON}
           DFR1Dihydrofolate reductase involved in tetrahydrofolate
           biosynthesis; required for respiratory metabolism
          Length = 211

 Score = 32.7 bits (73), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 66/165 (40%), Gaps = 26/165 (15%)

Query: 605 KQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSV------NDGFV------VI 652
           +QV SL   PNKK+ +I+       +  PPK + LPN M+V       D FV      ++
Sbjct: 39  RQVTSLTKDPNKKNALIMGRKTWESI--PPKFRPLPNRMNVIISRSFKDDFVHDKERSIV 96

Query: 653 RGSEILSGVMDKS-----------VLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCAR 701
           + + + + +M+             V+G G+ +S  ++I   +   +              
Sbjct: 97  QSNSLANAIMNLESNFKEHLERIYVIGGGEVYSQIFSITDHWLITKINPLDKNATPAMDT 156

Query: 702 YLGNRGFSIGISDVTPGADLKQKKEDKVEEAYAKCDELIDQFNKG 746
           +L  +      S+  P A LK+    KVE     CD+      KG
Sbjct: 157 FLDAKKLEEVFSEQDP-AQLKEFLPPKVELPETDCDQRYSLEEKG 200

>CAGL0J04928g Chr10 complement(468765..471962) [3198 bp, 1065 aa] {ON}
            highly similar to uniprot|P47047 Saccharomyces cerevisiae
            YJL050w MTR4
          Length = 1065

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 47/88 (53%), Gaps = 7/88 (7%)

Query: 951  GLLPYQIIENT-----NSILKP-LEQKLVRFDNLGNKLNKEDEEKI-EYIDQHDAERNFY 1003
            G+ P  ++EN+     N I  P +E+KL+ +    + ++ EDE  I EY +     + +Y
Sbjct: 590  GISPEFMLENSFFQFQNVIAVPVMEKKLIEYQQQYDNIHIEDESGIKEYYEVKQTLKGYY 649

Query: 1004 QSLRDYMTEKATHLAKIRKAKGLKTLLD 1031
            + +R  MT  A  L+ ++  + ++ ++D
Sbjct: 650  EDVRKVMTHPAHLLSFLQPGRLIEVVVD 677

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 152,762,205
Number of extensions: 6806255
Number of successful extensions: 19643
Number of sequences better than 10.0: 90
Number of HSP's gapped: 19832
Number of HSP's successfully gapped: 195
Length of query: 1458
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1336
Effective length of database: 39,492,147
Effective search space: 52761508392
Effective search space used: 52761508392
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)