Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02266g5.425ON48446421850.0
Kwal_55.214685.425ON4654675504e-64
YDR363W (ESC2)5.425ON4562715486e-64
Smik_4.6285.425ON4582695487e-64
Suva_2.5345.425ON4522805416e-63
Skud_4.6315.425ON4582695242e-60
ZYRO0F09812g5.425ON4162595194e-60
KAFR0E038705.425ON3962605097e-59
NDAI0B056005.425ON4572804902e-55
NCAS0F033105.425ON4422924796e-54
KLTH0F16280g5.425ON4732604711e-52
TBLA0A037105.425ON4612284589e-51
Ecym_55245.425ON4152624172e-45
TPHA0E018105.425ON4532824132e-44
Kpol_1027.265.425ON4432773921e-41
TDEL0E020005.425ON4362363711e-38
CAGL0A02706g5.425ON3692403345e-34
AER251W5.425ON4072653163e-31
KNAG0C049805.425ON3452513011e-29
KLLA0E21275g5.425ON3922562811e-26
KLLA0B14366g1.532ON490111800.33
Ecym_46837.392ON24383731.6
Kpol_304.1singletonON11188664.2
Kpol_389.1singletonON11188664.2
KNAG0J027304.52ON1537138706.5
YNL139C (THO2)2.125ON1597104697.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02266g
         (484 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   846   0.0  
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   216   4e-64
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   215   6e-64
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   215   7e-64
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   213   6e-63
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   206   2e-60
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   204   4e-60
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   200   7e-59
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   193   2e-55
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   189   6e-54
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   186   1e-52
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   181   9e-51
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   165   2e-45
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   163   2e-44
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   155   1e-41
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   147   1e-38
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   133   5e-34
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   126   3e-31
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...   120   1e-29
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...   112   1e-26
KLLA0B14366g Chr2 (1260726..1262198) [1473 bp, 490 aa] {ON} high...    35   0.33 
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    33   1.6  
Kpol_304.1 s304 complement(138..473) [336 bp, 111 aa] {ON} compl...    30   4.2  
Kpol_389.1 s389 complement(5037..5372) [336 bp, 111 aa] {ON} com...    30   4.2  
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...    32   6.5  
YNL139C Chr14 complement(360924..365717) [4794 bp, 1597 aa] {ON}...    31   7.7  

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/464 (90%), Positives = 422/464 (90%)

Query: 1   MSREQQSHVGLKGATVTENIEENLSFSEANKTIGGYADDSGPADGATQNVRNQLPRFSSN 60
           MSREQQSHVGLKGATVTENIEENLSFSEANKTIGGYADDSGPADGATQNVRNQLPRFSSN
Sbjct: 1   MSREQQSHVGLKGATVTENIEENLSFSEANKTIGGYADDSGPADGATQNVRNQLPRFSSN 60

Query: 61  IEYSAFGSRSELSENCDESPKRLQSVQETHLVLDGSEXXXXXXXXXXXXXXFFYGDYLTN 120
           IEYSAFGSRSELSENCDESPKRLQSVQETHLVLDGSE              FFYGDYLTN
Sbjct: 61  IEYSAFGSRSELSENCDESPKRLQSVQETHLVLDGSEDDVDADDDDDDDDDFFYGDYLTN 120

Query: 121 SNTQTDEKDIIVDSNTGARGRDAVELSIAANKNPELLPPTISNSSKDNDKRPGGLKRKLX 180
           SNTQTDEKDIIVDSNTGARGRDAVELSIAANKNPELLPPTISNSSKDNDKRPGGLKRKL 
Sbjct: 121 SNTQTDEKDIIVDSNTGARGRDAVELSIAANKNPELLPPTISNSSKDNDKRPGGLKRKLS 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXKRSAVISKPVVEEDDTDAFFTEITRNANRTSTV 240
                                      KRSAVISKPVVEEDDTDAFFTEITRNANRTSTV
Sbjct: 181 ISSSVQSSASRDSSPTRSITPPPSKRTKRSAVISKPVVEEDDTDAFFTEITRNANRTSTV 240

Query: 241 IRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAI 300
           IRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAI
Sbjct: 241 IRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAI 300

Query: 301 QNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEYEMKYEAEFKEM 360
           QNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEYEMKYEAEFKEM
Sbjct: 301 QNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEYEMKYEAEFKEM 360

Query: 361 VENELSGSSVDVKNVKKDDFATNEYELQLEKSESAEPSLLKSSENIRDGSFIKLALVGQD 420
           VENELSGSSVDVKNVKKDDFATNEYELQLEKSESAEPSLLKSSENIRDGSFIKLALVGQD
Sbjct: 361 VENELSGSSVDVKNVKKDDFATNEYELQLEKSESAEPSLLKSSENIRDGSFIKLALVGQD 420

Query: 421 NKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
           NKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL
Sbjct: 421 NKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  216 bits (550), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 150/467 (32%), Positives = 236/467 (50%), Gaps = 25/467 (5%)

Query: 1   MSREQQSHVGLKGATVTENIEENLSFSEANKTIGGYADDSGPADGATQNVRNQLPRFSSN 60
           M  E + H  LKGA +T +I+E +SFS+ANKTIGGY +    A  A Q  RN +P F+S+
Sbjct: 1   MVDEPRPHTALKGAKITGDIQEQISFSDANKTIGGYIEQEDVAADAVQVERNSMPIFTSS 60

Query: 61  IEYSAFGSRSELSENCDESPKRLQSVQETHLVLDGSEXXXXXXXXXXXXXXFFYGDYLTN 120
           I+     S +               V  T++ L+G +               +       
Sbjct: 61  IKEQRAASTASTG------------VSNTNVPLEGDQHIEDDTDDDDFFYGDYIS---AK 105

Query: 121 SNTQTDEKDIIVDSNTGARGRDAVELSIAANKNPELLPPTISNSSKDNDKRPGGLKRKLX 180
           S T   E  +IV+++   + + +++   +++ NPE+   T S++ +         KR++ 
Sbjct: 106 SVTTDRETSVIVNTSHSEQEKPSLK---SSDTNPEIQEITDSSADEKELDEKHTQKRRIS 162

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXKRSAVISKPVVEEDDTDA-FFTEITRNANRTST 239
                                      KRS   +  +  ED+ D  FF E+ R A RT++
Sbjct: 163 VTSIEDSPEKASPGGNHFTRSRTN---KRSITANISLAAEDNEDEKFFEELQREAGRTTS 219

Query: 240 VIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKA 299
            ++E SP   KR Y I F+S L+GS++ KI VK  GK  F++ILP  L  ++K Y++ K 
Sbjct: 220 TLKEGSPATAKRVYNIKFLSNLEGSLNDKINVKVKGKHAFSEILPIALKTLIKEYKVSKD 279

Query: 300 IQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEYEMKYEAEFKE 359
           ++  Y+ +NV+LY NG KILNFM CNSL IP NY  E++DV +TLVS++ E +Y  +  E
Sbjct: 280 LKPFYQPENVSLYRNGLKILNFMNCNSLHIPLNYEGEVSDVSMTLVSRDREQEY-VKTLE 338

Query: 360 MVENELSGSSVDVKNVKKDDFATNEYELQLEKSESAEPS--LLKSSENIRDGSFIKLALV 417
              +     S +  + K   F+  E+E  LE  ES E +  L  + +   +   IK+AL+
Sbjct: 339 QSRHATPDLSREETSPKIPGFSIEEFEKDLEGFESGESNNLLEDTPQTENNHGTIKIALM 398

Query: 418 GQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
            QDNKK++V  R +T    + ++Y+  KNL S  + K  FD+ +L L
Sbjct: 399 AQDNKKIYVNVRQTTTIAMLGEHYRTTKNLSSIERFKFVFDNEDLQL 445

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  215 bits (548), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 174/271 (64%), Gaps = 29/271 (10%)

Query: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280
           D+ D FF E+ + A +++T+ +ES+P+  KR Y I F+SKL+G+I+K ++VK  GK  F+
Sbjct: 168 DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 227

Query: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340
           KILP+ LD ++K+Y+IPK ++++YK++NVTLYWN AK+L FMTCNSL IPQ++ +E++D+
Sbjct: 228 KILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDI 287

Query: 341 DITLVSKEYEMKYEAEFKEMVENELSG----------SSVDVKNVKKDDFATNEYELQLE 390
           D+T+VSKEYE  +EA  +  ++ E +             ++ K  ++++    E+E +L+
Sbjct: 288 DVTIVSKEYEKNFEATLESKLKEEEAALLIKERQEMERKLEKKRNEQEESEYREFESELK 347

Query: 391 KSESAEPSLLKSSENIRDGSFI-----------------KLALVGQDNKKMFVKARSSTL 433
             E  E   +K ++ + +   +                 ++AL+GQDNKK++V  R ST 
Sbjct: 348 NVE--ETQEIKENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTP 405

Query: 434 FKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
           F KIA+YY+  K LP  T++KL FDH  L +
Sbjct: 406 FSKIAEYYRIQKQLPQKTRVKLLFDHDELDM 436

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  215 bits (548), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 108/269 (40%), Positives = 173/269 (64%), Gaps = 25/269 (9%)

Query: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280
           D+ D FF E+ + A +T++V +ES+P+  KR Y I F+SKL+G+I+K ++VK  GK  F+
Sbjct: 170 DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229

Query: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340
           +ILP+ LD + K+Y+IPK ++++YK++NVTLYW  AK+L+FMTCNSL IPQ++ +E++D+
Sbjct: 230 RILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDI 289

Query: 341 DITLVSKEYEMKYEAEFKEMV----------ENELSGSSVDVKNVKKDDFATNEYELQL- 389
           D+T+VSKEYE  +EA  +  +          E+E     ++ K  ++++    E+E +L 
Sbjct: 290 DVTIVSKEYEKNFEASLESKLKEEEAALLVKEHEEIERKLERKRNEQEESEYREFEFELR 349

Query: 390 ---EKSESAEPSLLKSSENIRDG-----------SFIKLALVGQDNKKMFVKARSSTLFK 435
              EK E  E   + + +N+++              +K+AL GQDNKK++V  R ST F 
Sbjct: 350 NVKEKQERTENETVINIKNLQEDDNLLENNSDSEKVMKIALRGQDNKKIYVNVRRSTPFS 409

Query: 436 KIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
           K+A+YY+  K LP   ++KL FDH  L +
Sbjct: 410 KVAEYYRIQKQLPQKARIKLLFDHDKLDM 438

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  213 bits (541), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 114/280 (40%), Positives = 174/280 (62%), Gaps = 47/280 (16%)

Query: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280
           D+ D FF E+ + A +T+++ +ES+P+  KR Y I F SKL+G+I+K ++VK  GK  F+
Sbjct: 164 DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFS 223

Query: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340
           +ILP+ LD ++K+Y+IPK ++++YK +NVTLYWN AK+L FMTCNSL IPQ++ +EI+D+
Sbjct: 224 RILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDI 283

Query: 341 DITLVSKEYEMKYEAEFKEMVENELSGSSVDVKNVKKDDFAT--NEYELQLEKSESA--- 395
           DIT+VSKEYE  +EA  +  ++ E +             FA    E E++LEK  +    
Sbjct: 284 DITIVSKEYEKNFEATLESKLKEEETAL-----------FAKERQEMEMKLEKKRNEREE 332

Query: 396 --------------EPSLLKSSE------NIRDGS-----------FIKLALVGQDNKKM 424
                         E   LK++E      ++R+G+            +K+AL+GQDNKK+
Sbjct: 333 SEFREFEFELRNVEETEELKANETFMNEHSLREGNSVKENNGGNEKVMKIALMGQDNKKI 392

Query: 425 FVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
           +V  R+ST F K+A+YY+  K LP   ++KL FDH  L+L
Sbjct: 393 YVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNL 432

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  206 bits (524), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 171/269 (63%), Gaps = 25/269 (9%)

Query: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280
           D+ D FF E+ + A + +T+ +E +PE  KR Y I F+SKL+G+I+K ++VK  GK  F+
Sbjct: 170 DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229

Query: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340
           +ILP+ LD +VK+Y+IPK + ++YK+ NVTLYWN AK+LNFMTCNSL I Q++ +EI+D+
Sbjct: 230 RILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDI 289

Query: 341 DITLVSKEYEMKYEAEFKEMVENELSG----------SSVDVKNVKKDDFATNEYELQL- 389
           D+T+VSKEYE  +EA  +  ++ + +             ++ K  ++++    E+E +L 
Sbjct: 290 DVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNEQEESEYREFEFELR 349

Query: 390 ---EKSESAEPSLLKSSENIRDGS-----------FIKLALVGQDNKKMFVKARSSTLFK 435
              E  E  E  ++ +++ ++  +            IKLAL+GQDNKK+ V  R+ST   
Sbjct: 350 NVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLF 409

Query: 436 KIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
           K+A+YY+  K LP   +++L FDH  L++
Sbjct: 410 KVAEYYRIQKRLPQKARIRLLFDHDELNM 438

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  204 bits (519), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 105/259 (40%), Positives = 161/259 (62%), Gaps = 11/259 (4%)

Query: 213 ISKPVVEEDDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVK 272
           I+   +E D+ D FF +I ++ N T    RE++PE  +R Y + F+SKL GSIDK +++K
Sbjct: 142 IANNFLEPDENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIK 201

Query: 273 AWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQN 332
             GK  F  +LPS L+  ++ Y+IP  ++ +Y  +NVTLYW  AK+LNFMTCNSL+IPQ 
Sbjct: 202 VLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQA 261

Query: 333 YGDEITDVDITLVSKEYEMKYEAEFKEMVENEL---SGSSVDVKNVKKDDFATNEYELQL 389
           + +EI+D+DIT++ KE     E EF++M+ + L     +  D       D    E+E +L
Sbjct: 262 FENEISDIDITVIPKE----KENEFEQMINSRLLEDEQNPPDTAETGNLDARVEEFEKEL 317

Query: 390 EKSESA----EPSLLKSSENIRDGSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVK 445
           +  +++    E + L   E+  D   +K+ALVG+DNKK+FV  R++T+  K+A+YY+  K
Sbjct: 318 KNVDNSTTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKK 377

Query: 446 NLPSFTKLKLTFDHVNLSL 464
            LP    +KL FDH  L+L
Sbjct: 378 KLPKDINIKLIFDHEELNL 396

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  200 bits (509), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 110/260 (42%), Positives = 159/260 (61%), Gaps = 3/260 (1%)

Query: 208 KRSAVISKPVVEEDDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDK 267
           ++ + IS+   + D+ D FF E+   A + S    ES+ +  KR Y I FISKL GSI+K
Sbjct: 117 RQKSFISETAEDSDENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSINK 176

Query: 268 KIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSL 327
            ++VK  GK PF+KILP+ L  ++ AY+IP  +  +Y ++NV LYWN AK+LNFMTC+SL
Sbjct: 177 SVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDSL 236

Query: 328 RIPQNYGDEITDVDITLVSKEYEMKYEA--EFKEMVENELSGSSVDVKNVKK-DDFATNE 384
            IP  + +EI++VDI +VSKE+  K E   + K + E        ++K+V + DDF   E
Sbjct: 237 SIPLAFENEISNVDILIVSKEFGEKLEKLDQMKTLQEEAKLERQEEIKDVDEGDDFVLKE 296

Query: 385 YELQLEKSESAEPSLLKSSENIRDGSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDV 444
           +E +L     +  +L   ++       +KLAL+GQDNKK++V  RSST   K+ +YYK  
Sbjct: 297 FEAELRDVAPSNANLSLDTDGEDSEPLMKLALMGQDNKKIYVNVRSSTQISKLVEYYKKQ 356

Query: 445 KNLPSFTKLKLTFDHVNLSL 464
           KNL    K+KL FDH  L L
Sbjct: 357 KNLARNVKVKLLFDHDELDL 376

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  193 bits (490), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 109/280 (38%), Positives = 157/280 (56%), Gaps = 37/280 (13%)

Query: 218 VEEDDTDAFFTEITRNANRTSTVIRESSPE-LDKRTYKISFISKLKGSIDKKIEVKAWGK 276
           +E D+ D FF EI + A +  ++ +ES+P+ L KR Y I FISKL G+++K ++VK  GK
Sbjct: 162 MEPDENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDGTMNKCVQVKVLGK 221

Query: 277 SPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDE 336
             F KILP+ L  ++KAY IP  +Q  Y +DNV+LYWN AK+L+FMTCNSL IPQ + +E
Sbjct: 222 FQFQKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMTCNSLNIPQAFENE 281

Query: 337 ITDVDITLVSKEYEMKYEAEFKEMVENELSGSSVDVKNVKKD------------------ 378
           +T+VDI L+SK+ E++ E    E +  +    S+ ++  KK+                  
Sbjct: 282 VTNVDIELISKDDEIENEKAITEKLLKDEREVSLKLEAAKKEKEIQEKLAKELAKEEKEN 341

Query: 379 --------------DFATNEYELQLEKSESAEPSLLKSSENIRDGSFIKLALVGQDNKKM 424
                         +  TN Y+        A    L+      +   +K+ALVGQDNKK+
Sbjct: 342 EVFEEFEHELENVSELKTNGYDADASTVNEANELALEEG----NADVMKIALVGQDNKKI 397

Query: 425 FVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
            V  R +T F K+A+YY+  K LP   K+KL FDH  LSL
Sbjct: 398 HVNVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEELSL 437

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  189 bits (479), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 174/292 (59%), Gaps = 37/292 (12%)

Query: 208 KRSAVISKPVVE--EDDTDAFFTEITRNANRTSTVI---RESSPELD-KRTYKISFISKL 261
           KR    S P++    D+ D FF EI + A +  ++    +E++P+   KR Y I F+S+L
Sbjct: 133 KRQKSTSTPILSLGPDENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQL 192

Query: 262 KGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNF 321
            G+I+K ++VK  GK  F KILP TL+ ++K+Y IP  +Q  YK+DNVTLYWN  K+LNF
Sbjct: 193 DGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNF 252

Query: 322 MTCNSLRIPQNYGDEITDVDITLVSKEYEMKYEAEFKE--MVENELSGSSVDV------- 372
           MTCNSL IPQ + +E+T+VDI ++SKE E++ E E ++  ++E + +   +D+       
Sbjct: 253 MTCNSLNIPQAFENEVTNVDIVIMSKEKEIENENELRKKLLLEEKAAQMKLDLEKEREKE 312

Query: 373 ------KNVKKDDF--ATNEYELQLEKSESAEPSLLKSSENIRDG------------SFI 412
                 K  K  ++  A  E+E +L+ +   + S +   EN  DG            S +
Sbjct: 313 GEKNKPKESKNTEYAKAIAEFEKELKDATELKDSQVHGGEN--DGNMNIDGSDNEKSSIM 370

Query: 413 KLALVGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
           K+ALVG DNKK++V  R+ST F K+A+YY+  K LP   K++L FDH  L+L
Sbjct: 371 KIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNL 422

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  186 bits (471), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 154/260 (59%), Gaps = 16/260 (6%)

Query: 214 SKPVVEEDDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKA 273
           S P  E+D+ D FF E+ R A+RT++ ++ESSP + +R Y I FIS L+GS  ++I VK 
Sbjct: 199 SLPQHEKDEDDKFFEELEREASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKV 258

Query: 274 WGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNY 333
            GK  F +ILP  L  I+K Y+IP A+  +Y+ D VTLY +G KILNFM CNSL+IP  +
Sbjct: 259 KGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEF 318

Query: 334 GDEITDVDITLVSKEYEMKYEAEFKE--MVENELSGSSVDVKNVKKDDFATNEYELQLEK 391
             E++DV +T++SK  E  +EA +++     +EL  + ++    +  DF   EYE +L  
Sbjct: 319 KGEVSDVCLTIISKGQEQNFEALYEQSKHSNHELVPAFIE-PGTETPDFTVEEYEKELRN 377

Query: 392 -------SESAEPSLLKSSENIRDGSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDV 444
                  S   +P      +NIR      +AL+ QDNKK+ V AR  T F  +A++Y+ +
Sbjct: 378 VDFNKNTSVQNQPPPQSVDDNIR------IALMSQDNKKIIVTARPETTFAALAEHYQKL 431

Query: 445 KNLPSFTKLKLTFDHVNLSL 464
            +LP   ++ L FD+  L L
Sbjct: 432 TSLPPQQQVLLFFDNEELHL 451

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 1/71 (1%)

Query: 1  MSREQQSHVGLKGATVTENIEENLSFSEANKTIGGYADDSGPADGATQNVRNQLPRFSSN 60
          MS E+Q+H GLKGATVT +I++ +SF++AN+T+GGY +D   A G     +  LPRFSS 
Sbjct: 3  MSEERQTHTGLKGATVTGDIQDQISFTDANRTVGGYIEDEQ-ATGIIHRGKAGLPRFSST 61

Query: 61 IEYSAFGSRSE 71
          +E +  GS +E
Sbjct: 62 VEVTKTGSSTE 72

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  181 bits (458), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 148/228 (64%), Gaps = 14/228 (6%)

Query: 250 KRTYKISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNV 309
           KR Y + FISK++G++DKK++VK  GK PF+KILP  L A  + Y+IP  ++  Y+++NV
Sbjct: 215 KRIYNVRFISKIEGTLDKKVQVKVLGKFPFSKILPPALKAFSEEYKIPNVLKQYYRVNNV 274

Query: 310 TLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEYEMKYE----AEFKEMVENEL 365
           TLYWN +K+LNFMTCNSL IPQ Y +EI+DV+I +++K  E  YE       K+ +E  L
Sbjct: 275 TLYWNDSKLLNFMTCNSLNIPQIYENEISDVEIIVITKTNEKSYEDKINMSLKQNIEQNL 334

Query: 366 SGSSVDVKNVKK---DDFATN---EYELQLEKSESAEPSLLKSSENIRD---GSFIKLAL 416
           +  S ++K ++K   + F  N   E+E +L K  S +    K + NI D    S IK+AL
Sbjct: 335 AQKSNEIKELRKLKVESFEHNSIQEFEKEL-KELSQDGVDTKQTANIDDIPNESHIKIAL 393

Query: 417 VGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
           + QDNKK++VK R+ST F ++ +Y+++ K L    ++KL FD+  L L
Sbjct: 394 LTQDNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKLIFDNEELDL 441

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  165 bits (417), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/262 (35%), Positives = 148/262 (56%), Gaps = 21/262 (8%)

Query: 219 EEDDTDAFFTEITRNANRTSTVIRESS--------PELDKRTYKISFISKLKGSIDKKIE 270
           EE DT+ F  EI + A R S++    S         E+    Y + FISKL+GS +K+I 
Sbjct: 129 EESDTNKFLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYNVGFISKLEGSTNKRIN 188

Query: 271 VKAWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIP 330
           V+  GK  F+  LP  L   VK Y+I  ++ + Y++DNV +Y  G +I  FMTC+S  I 
Sbjct: 189 VRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFMTCDSFNIA 248

Query: 331 QNYGDEITDVDITLVSKEYEMKYEAEFKEMVENEL-----SGSSVDVKN----VKKDDFA 381
           + Y     D+++ +V  E   ++E ++K+ +E ++     S S VD+ +       DDF 
Sbjct: 249 EAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPVDLDSDGIEFGNDDFR 308

Query: 382 TNEYELQLEKSESAEPSLLKSSENIR---DGS-FIKLALVGQDNKKMFVKARSSTLFKKI 437
            NEYE  L  + S + + ++ S  I    DG+  IK+ L+G DNKK++V  + +T F+K+
Sbjct: 309 VNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKVYVNVKPTTTFEKL 368

Query: 438 ADYYKDVKNLPSFTKLKLTFDH 459
           A++Y+ +K LP  TKL L+FDH
Sbjct: 369 AEHYRRIKKLPPTTKLILSFDH 390

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  163 bits (413), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 163/282 (57%), Gaps = 38/282 (13%)

Query: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280
           D  D FF  I   + R ST+    +PE+  R Y I +ISKL GS +++I+ K  G   F 
Sbjct: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211

Query: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340
           K+LP  L+ ++K  +IP  ++++YK +NVTLYWN +K+LNFM C+SL+IPQ Y +EI+++
Sbjct: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISEL 271

Query: 341 DITLVSKEYEMKYEAEFK-EMVENE-LSGSSVDVKNVKKDDF-----ATNEYELQLEKSE 393
           +I L+SKE E K+E +FK +++E+E LS  +++  N     F     + NEYE +LE   
Sbjct: 272 EIILISKEEEQKFEEQFKMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELENWN 331

Query: 394 SAEPSLL----------KSSENIR---------------------DGSFIKLALVGQDNK 422
           S + ++            SS N++                       + IK++L+  DNK
Sbjct: 332 SKDFNVTNDVLDVSNDENSSNNVKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNK 391

Query: 423 KMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
           K+FV  RSST  +K+ DY+K  KNL S  ++K+ FDH  LSL
Sbjct: 392 KIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSL 433

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  155 bits (392), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 149/277 (53%), Gaps = 31/277 (11%)

Query: 219 EEDDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSP 278
           EE++ D F   I  N+N  + V   +S     R Y I+F SKL GS+DKK++ +  GK  
Sbjct: 146 EEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQ 205

Query: 279 FTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEIT 338
           F++I+   LD+  K Y++ +  +  YK D VT+YW+ AK+L FMTCNSL+IP  +  EI+
Sbjct: 206 FSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEIS 265

Query: 339 DVDITLVSKEYEMKYEAEFKEMVENELS--------GSSVDV-------KNVKKDDF--- 380
            +++T++SKE E ++EA+ K  +E +          GSS +        +N KK +    
Sbjct: 266 HIELTIISKENEQQFEADIKAQLEVDQKENTNKTEVGSSKNFGIESQIDENKKKYEEYEN 325

Query: 381 -------------ATNEYELQLEKSESAEPSLLKSSENIRDGSFIKLALVGQDNKKMFVK 427
                         T E  + ++  E     ++  +      + +KLALVG DNKK+FV 
Sbjct: 326 ELNESIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKLALVGNDNKKIFVN 385

Query: 428 ARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
           AR +T F K+A+YY   + LP  TK+KL FD   + L
Sbjct: 386 ARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDL 422

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  147 bits (371), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 138/236 (58%), Gaps = 27/236 (11%)

Query: 250 KRTYKISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNV 309
           ++ + + F+SKL+G++D+ I++K  GK  F  IL S L+ +V+ ++IP  + + Y +DNV
Sbjct: 188 QKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLERVVEEFKIPYPVMHQYTVDNV 247

Query: 310 TLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSK-----------------EYEMK 352
           TLYWNG K+L FMTC+SL+I     +E+T++++T+VSK                 E E  
Sbjct: 248 TLYWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMVSKSDEERFEEEERARLLRVEKEAM 307

Query: 353 YEAEFKEMVENELSG----SSVDVKNVKKDDFATNEYELQLEKSESAEPSLLKSSENIRD 408
            +A+     E + S     +   ++ ++ DD ++ E E++ E S+ A P  L+  + +  
Sbjct: 308 SKAKLPTTFEADPSDDNGEADCSIEIIEMDD-SSRESEMK-EGSKLA-PVDLEDEDELE- 363

Query: 409 GSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSL 464
              IKLALVGQDN +++V  R ST F K+A+YYK  K LP   KL L FDH  L L
Sbjct: 364 --VIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEKLDL 417

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  133 bits (334), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 135/240 (56%), Gaps = 18/240 (7%)

Query: 220 EDDTDAFFTEITRNANRTSTVIRESSPELDK-RTYKISFISKLKGSIDKKIEVKAWGKSP 278
           ED+ D FF  I + +   S  +++ S  + + + Y + FIS + G+  K ++VKA G  P
Sbjct: 121 EDENDLFFQSIAKRSQ--SLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHP 178

Query: 279 FTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEIT 338
           F+K++ + L  +++A+R+P  ++ +Y+ ++V  YWN AK+L FMTC++LR+PQ YG +  
Sbjct: 179 FSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYL 238

Query: 339 DVDITLVSKEYEMKYEAEFKEMVENELSGSSVDVKNVKKDDFATNEYELQLEKSESAEPS 398
           ++ +  V      K EA++   +E E+          ++D     E EL+  K   A   
Sbjct: 239 EIQLVPV------KEEAQY---LEQEVFEEPERAPTPEEDAEEEFERELRDAKEVRAPVV 289

Query: 399 LLKSSENIRDGSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFD 458
            L+S E +R      +AL GQDNKK++V  + +T F ++ +YY+  K LP  T++ L  D
Sbjct: 290 DLESEEVLR------VALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALD 343

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  126 bits (316), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/265 (30%), Positives = 133/265 (50%), Gaps = 24/265 (9%)

Query: 220 EDDTDAFFTEITRNANRTS------TVIRESSPELDKRTYKISFISKLKGSIDKKIEVKA 273
           E + + F  E+ R+   ++      T   +   + D R Y + FIS+++GS ++++ VK 
Sbjct: 127 ESEANRFLAEMERDIELSAGPGGGETATGKGGRDTDARVYNVGFISRIEGSRNRRVNVKV 186

Query: 274 WGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNY 333
            G+  F   L   L A  K + I K+++  Y+ D V +Y  G ++  FMTC+S  I + Y
Sbjct: 187 TGQKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVKIYREGVEVFKFMTCDSFNIEEPY 246

Query: 334 GDEITDVDITLVSKEYEMKYEAEFKEMVENE---LSGSS----VDVKNVKKDDFATNEYE 386
               TD+++ +V  +    +E E+K   E     LS SS    +D      DDF  NEYE
Sbjct: 247 NASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSNSSFLEVMDDIEDDNDDFLVNEYE 306

Query: 387 LQLEKSESAEPSLLKSSENIRDGS-------FIKLALVGQDNKKMFVKARSSTLFKKIAD 439
             L  + S   + L     +R+G+        +K+ L+G DNKK+F+  R +T   K+A+
Sbjct: 307 KALVNARSLNETELA----VREGTPADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAE 362

Query: 440 YYKDVKNLPSFTKLKLTFDHVNLSL 464
           +Y+  K LP   +L L FDH  + L
Sbjct: 363 HYRVAKELPPTVQLSLMFDHEEIDL 387

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 119/251 (47%), Gaps = 32/251 (12%)

Query: 221 DDTDAFFTEITRNANR------TSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAW 274
           DD + FF E+ R   +      T+T     SP      Y++ F S+L+G++ K ++VK  
Sbjct: 99  DDEEQFFQELLRARTQSVEPAETATTSTVPSP-----VYRVRFQSQLEGTLGKSVQVKVI 153

Query: 275 GKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYG 334
           G  P   +LPS L A+V+A R+P+ +Q  Y    V +Y  GA++L FM CNSL + Q + 
Sbjct: 154 GTRPLGTVLPSVLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFE 213

Query: 335 DEITDVDITLVSKEYEMKYEAEFKEMVENELSGSSVDVKNVKKDDFATNEYELQLEKSES 394
           +E+ +VD+ L +   E                       +V     ATN  E        
Sbjct: 214 NEVLEVDVVLRALNLETP-------------------ASDVSGGQEATNGTEAAASVPVP 254

Query: 395 AEPSLLKSSENIRD--GSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTK 452
                  +SE+  +   + +K+AL+  DN++++VK    T   ++ +YY+  + LP+   
Sbjct: 255 VPAPATAASESPGNPAPALMKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAP 314

Query: 453 LKLTFDHVNLS 463
           L+L  D   +S
Sbjct: 315 LQLRLDDEQVS 325

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score =  112 bits (281), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 134/256 (52%), Gaps = 17/256 (6%)

Query: 220 EDDTDAFFTEITRNA-NRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSP 278
           +D+   F  E+T NA N   T    ++ ++ KR Y I+FIS L+GS DK++ VK  G   
Sbjct: 119 QDEMFDFLKEVTSNAKNHADT---HNNGKVTKRIYNINFISTLEGSQDKRVNVKVTGNKT 175

Query: 279 FTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEIT 338
           F  ILP T+   +++Y+IP+ ++  Y    + L+  G ++L F  C+SLRIP+   +  T
Sbjct: 176 FESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYET 235

Query: 339 DVDITLVSKEYEMKYEAEFKEMVENELSGSSVDVKNVKKDD----FATNEYELQLEKSES 394
            VD+ +V       Y+ E+K + E+ L  S +D  N+++ D     A +E     EK   
Sbjct: 236 TVDLVIVHSADANNYKTEYKRIRESRLQ-SFLDESNIEEQDPLEQPARDEKFKLFEKELE 294

Query: 395 AEPSLLKSSENIRD--------GSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVKN 446
           + P L + ++++ D         + I+L L+ + NK+  +    +T F +IA+ YK + +
Sbjct: 295 SAPKLAERTDDVIDLLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISS 354

Query: 447 LPSFTKLKLTFDHVNL 462
           L     + L FD+  L
Sbjct: 355 LSEDANVLLIFDNEEL 370

>KLLA0B14366g Chr2 (1260726..1262198) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|P00937 Saccharomyces cerevisiae
           YKL211C TRP3 anthranilate synthase Component II and
           indole-3-phosphate (multifunctional enzyme)
          Length = 490

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 11/111 (9%)

Query: 339 DVDITLVSKEYEMKYEAEFKEMVE-----NELSGSSVDVKNVKKDDFATNEYELQLEKSE 393
           D+D+++V+ E  +KY       +      +   GS  D++NV+K        E+     E
Sbjct: 287 DIDLSVVASEQALKYGQAGASAISVLTEPHWFKGSIEDLRNVRK------VLEVAFANDE 340

Query: 394 SAEPSLLKSSENIRDGSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDV 444
           S  P +L+          ++  L G D   + VK     L K++ DY K +
Sbjct: 341 SKRPCVLRKEFIFSKYQILEARLAGADTVLLIVKMLDDNLLKELYDYAKSL 391

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 37/83 (44%), Gaps = 14/83 (16%)

Query: 304 YKMDNVTLYWNGAKILN----FMTCNSLRIPQNYGDEITDVDIT-----LVSKEYEMKYE 354
           Y  D     W+ A ILN    FMT +     +  G  IT  D T     L SKEY  K  
Sbjct: 93  YHPDTWNPSWSVATILNGLLSFMTGD-----EQTGGSITTSDYTKKTLALSSKEYNAKQN 147

Query: 355 AEFKEMVENELSGSSVDVKNVKK 377
            EF+ M  + L  +  D++ +KK
Sbjct: 148 TEFQRMFPDLLKQNLKDIEELKK 170

>Kpol_304.1 s304 complement(138..473) [336 bp, 111 aa] {ON}
           complement(138..473) [336 nt, 112 aa]
          Length = 111

 Score = 30.0 bits (66), Expect = 4.2,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 7/88 (7%)

Query: 305 KMDNVTLYWNGAKILNFMTCNSLRIPQN-------YGDEITDVDITLVSKEYEMKYEAEF 357
           ++ NVTLY+N    L  M    + IP +       YGD++TD+ I  +   Y+   + E 
Sbjct: 16  RLINVTLYYNLGGALICMDYLVMNIPCSILDYIVIYGDKMTDITIMDLIGGYQFFEKTEI 75

Query: 358 KEMVENELSGSSVDVKNVKKDDFATNEY 385
                N    +++ V  + K +     Y
Sbjct: 76  STCESNVFHQANILVSQINKMNMENKTY 103

>Kpol_389.1 s389 complement(5037..5372) [336 bp, 111 aa] {ON}
           complement(5037..5372) [336 nt, 112 aa]
          Length = 111

 Score = 30.0 bits (66), Expect = 4.2,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 7/88 (7%)

Query: 305 KMDNVTLYWNGAKILNFMTCNSLRIPQN-------YGDEITDVDITLVSKEYEMKYEAEF 357
           ++ NVTLY+N    L  M    + IP +       YGD++TD+ I  +   Y+   + E 
Sbjct: 16  RLINVTLYYNLGGALICMDYLVMNIPCSILDYIVIYGDKMTDITIMDLIGGYQFFEKTEI 75

Query: 358 KEMVENELSGSSVDVKNVKKDDFATNEY 385
                N    +++ V  + K +     Y
Sbjct: 76  STCESNVFHQANILVSQINKMNMENKTY 103

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa]
           {ON} 
          Length = 1537

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 52/138 (37%), Gaps = 15/138 (10%)

Query: 291 VKAYRIPKA-IQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEY 349
           +KAY   K+    V+   N+T  W    I+     N LR P N      D+DI  + KE 
Sbjct: 206 IKAYYKEKSWFPTVHVFANLTFTWMNELIMETYHNNKLRDPNNLPLPPVDLDIASICKEV 265

Query: 350 EMKYEAEFKEMVENELSGSSVDVKNVKKDDFATNEYELQLEKSESAEPSLLK-------- 401
           E  +E    +  EN+ S  +   +           +E   +     EP  L+        
Sbjct: 266 EKNWEV---QKWENKFSLFTALWRTFALSIVFAFTFETLKDLLTILEPQFLRLFIIRFNP 322

Query: 402 ---SSENIRDGSFIKLAL 416
              S+  I  G FI LAL
Sbjct: 323 NVVSTYPILHGVFIALAL 340

>YNL139C Chr14 complement(360924..365717) [4794 bp, 1597 aa] {ON}
            THO2Subunit of the THO complex, which is required for
            efficient transcription elongation and involved in
            transcriptional elongation-associated recombination;
            required for LacZ RNA expression from certain plasmids
          Length = 1597

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 10/104 (9%)

Query: 334  GDEITDVDITLVSKE----------YEMKYEAEFKEMVENELSGSSVDVKNVKKDDFATN 383
            G E +DVD+T +SK+          Y++ ++    +  +N LSG +    + +K     N
Sbjct: 929  GAEFSDVDLTKISKDLFTTFWRLSLYDIHFDKSLYDERKNALSGENTGHMSNRKKHLIQN 988

Query: 384  EYELQLEKSESAEPSLLKSSENIRDGSFIKLALVGQDNKKMFVK 427
            + +  L    S + +  K+SE I + S +     G+D  K+F++
Sbjct: 989  QIKDILVTGISHQRAFKKTSEFISEKSNVWNKDCGEDQIKIFLQ 1032

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,719,263
Number of extensions: 2001103
Number of successful extensions: 6584
Number of sequences better than 10.0: 54
Number of HSP's gapped: 6853
Number of HSP's successfully gapped: 56
Length of query: 484
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 371
Effective length of database: 40,524,141
Effective search space: 15034456311
Effective search space used: 15034456311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)